[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81419.1

[Show Plain Result]


## Summary of Sequence Search
    1::191
    1::184     2e-38  47%  184 aa  PF00265 TK "Thymidine kinase"
    1::191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
PF00265         -AQLYFIYGPMFSGKSTELLQRAHNYEERGRKVLVFKPAIDDRYGEGVVSRIGLSREA-IVGDPTDLFAD


                         .         .         *         .         .         .         .:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEH
PF00265         ILELIAENPVDVVLIDEAQFFDKEQVVQLARVVDDLGIPVIVAGLDTDFRGELFEGSARLLELADKVTKL


                         +         .         .         .         .         *         .:210
query           ETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWxxxxxxx
PF00265         KAICHCGRKATFNLRLVDGPAVYEGEQVLIGGNESYESVCRKHY-------