[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81437.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
   32::106     5e-17  56%  106 aa  PF01228 Gly_radical "Glycine radical"
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxVDDQTNNAKVIASKTYEIDTIVEDSVIRGRPGRFFDVQPEPTVEGGQHLNV
PF01228         -------------------LDGISNNFKIVPDALGKYDEVGYENLNTLLDGYF---------EGGQHLNV


                         .         .         *         .         .         .         .:140
query           NVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNxxxxxxxxxxxxxxxxxxx
PF01228         NVLSRETLLDAQKHPEKYPQLTIRVSGYAVRFN-------------------