[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81502.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
    8::339     e-113  63%  340 aa  PF11091 T4_tail_cap "Tail-tube assembly protein"
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxVQDVVKGILKGENPAGGSTPRQPLSKITIAQFPAERNAANDSTQDFNVNDLYKNGLLLSA
PF11091         ----------VVDLFKGI-GSKTSAGQSTKTKPTTKIVTAQFPAERASGNDTT--FNVNDLYKNGLLFTA


                         .         .         *         .         .         .         .:140
query           FNYSGRQTGDLRSFRTDQNNIGDYRKGVVKEAIANILMPKGQTDIDTINHKFNDVQQSLVERGNGSITGA
PF11091         YDYSSRTSGSLRSMRQSSGSVSSKVSGFSKEAIANILLPRSQSDVDTISHKFNDVGDSLIERGGGAATGA


                         +         .         .         .         .         *         .:210
query           LSSMASHAVYGGLESITQGAFADRGEQVYIASRAMYAGAENRTKTYTWQLTPRNVYDLVEIIKIYEMLSY
PF11091         LSNMASTAVFGALESITQGVLADSGEQIYPTSRSMYQGASNRTKTFTWKLTPRSLEDLKEIIKIYEYFKY


                         .         .         .         +         .         .         .:280
query           YSYGSVEKSNTANDIRKSVDAAYKETIINPLTPEATHGQTTMFERITSFLSNVNVVSNPIIWTIRNFGQS
PF11091         LSYGSTGKSTTANELKGKIDSWYNNTFIKPLTPEDALSNKTLFEGITGFLSNVIVVKNPTIWMIRNFGET


                         .         *         .         .         .         .         +:350
query           SSFDSRSDIFGPAQIQSIRFDKSPDGHFGGLAVAPNLPSSFVLEVTFREILALNRSxxxxxx
PF11091         DSFDTPHDIFGPCQITSIRFDKTPDGQFNGLAIAPNLPSSFVLEVTFREIITLNRA------