[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81503.1

[Show Plain Result]


## Summary of Sequence Search
    1::285
   20::131     2e-07  37%  135 aa  PF06841 Phage_T4_gp19 "T4-like virus tail tube protein gp19"
    1::285

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06841         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGLTVYSVQMPENRLGYEMDK
PF06841         -------------------------------------------------SGLSV-EVEVVEYREGGENNR


                         +         .         .         .         .         *         .:210
query           FHNAPNIKLMGREYDPLVISFRMDHQASNYRAMQDWVNAVEDPVTGLRSLPADVEADIQINLHARDGIPH
PF06841         VHKLPG----RRKFDNLTLKRGVDENSS---ALWDWFNAVLDGGTG-----GAYRKDGTITLLDEDGEPV


                         .         .         .         +         .         .         .:280
query           TVTMFGGCIPVAVSSPELSYEDNNTITTFNVTFAYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06841         ARWTFYGAWPVKWSGPDLD-ASSNEVAIETVELAY-----------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxx
PF06841         -----