[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81516.1

[Show Plain Result]


## Summary of Sequence Search
    1::172
   20::100     3e-14  51%  100 aa  PF00383 dCMP_cyt_deam_1 "Cytidine and deoxycytidylate deaminase
    1::172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAM
PF00383         ------------------CGNFPVGAVLVDDGEIIATGYNGENAGGGPT---------------------


                         .         .         *         .         .         .         .:140
query           YRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNExxxxxxxx
PF00383         -------------VHAEMNAILNAAKGGWRLTGYTLYVTLEPCGMCAMALVHSRIKRVVFGE--------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00383         --------------------------------