[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81560.1

[Show Plain Result]


## Summary of Sequence Search
    1::145
    4::146     2e-13  38%  148 aa  PF06591 Phage_T4_Ndd "T4-like phage nuclear disruption protein
    1::145

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFYFIVSAGVVKARTFVGDQETNRGFNET
PF06591         -----LTVTDINSAGATVIGTIKNGEF-FLGTPSKDILSKPGFYFLVSAGCVSARFYVGNQRSKQGFNAT


                         .         .         *         .         .         .         .:140
query           IYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLHLVPSLLKSPAQLELFGENMAKAQTLTTVSRQLFKVYNF
PF06591         LSRIRQRRSQLARTIANNNVSY--TVYYVPASLTTGFGKGQLALAFTRNHHSEYQTLTEMNRMLADNFKF


                         +         .         .         .         .         *         .:210
query           EYQxx
PF06591         VLQ--