[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bp441:AAQ81341.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w36D1.bssp"
#ERROR : Can't open dsspfile "1w36D2.bssp"
#ERROR : Can't open dsspfile "1ve6A1.bssp"

## Summary of PDB Search
:439
    4e-10  22%  1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
    2e-05  35%  1w36D2 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:361 -- 606
    3e-05  15%  1ve6A1 [b.69.7.2] ACYLAMINO-ACID-RELEASING ENZYME A:9 -- 321
:439

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xLTYDDLTNGQKLAIDGAMDAISTKRHITIRGPAXXXXXXXXXXXXDRLFQTGQQGIVLAAPTHQAKKEL
1w36D1          -FPVSDEINWQKVAAA----VALTRRISVISGGPGTGKTTTVAKLLAALIQMADCRIRLAAPTGKAAARL
1w36D2          ----------------------------------------------------------------------
1ve6A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIG
1w36D1          TESLGKALRQLLTDEQKKRIPEDASTLHRLLHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIF
1w36D2          ----------------------------------------------------------------------
1ve6A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IGDKAQIRGVSEDNETHELSPFFTDDRFSQVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w36D1          LGDRDQLASVEAGAVLGDICAGFTAERARQLS--------------------------------------
1w36D2          ----------------------------------------------------------------------
1ve6A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w36D1          ----------------------------------------------------------------------
1w36D2          ----------------------------------------------------------------------
1ve6A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w36D1          ----------------------------------------------------------------------
1w36D2          ----------------------------------------------------------------------
1ve6A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV
1w36D1          ----------------------------------------------------------------------
1w36D2          ----------------------------PSRLPEHETTWAMTVHKSQGSEFDHAALILPSQRTPVVTR--
1ve6A1          ---------------------------------TAREARLVTVDPRDGSVEDLELPSKDFSSYRPTAITW


                         .         .         +         .         .         .         .:490
query           AQELIYVGNTRARENVGFV
1w36D1          -------------------
1w36D2          --ELVYTAVTRARRRLSLY
1ve6A1          LGRLAVVARREGRSAV---