[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bp441:AAQ81419.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b8tA2.bssp"
#ERROR : Can't open dsspfile "1xx6A2.bssp"
#ERROR : Can't open dsspfile "1xbtA2.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"

## Summary of PDB Search
:191
    9e-15  31%  2b8tA2 [g.39.1.14] THYMIDINE KINASE A:150 -- 216
    6e-12  24%  1xx6A2 [g.39.1.14] THYMIDINE KINASE A:143 -- 191
    4e-11  36%  1xbtA2 [g.39.1.14] THYMIDINE KINASE, CYTOSOLIC A:151 -- 191
    6e-06  14%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
:191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
2b8tA2          ----------------------------------------------------------------------
1xx6A2          ----------------------------------------------------------------------
1xbtA2          ----------------------------------------------------------------------
1oftA           -------LSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAA


                         .         .         *         .         .         .         .:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2b8tA2          ----------------------------------------------------------------------
1xx6A2          ----------------------------------------------------------------------
1xbtA2          ----------------------------------------------------------------------
1oftA           LALSCEALGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQS------------------------------


                         +         .         .         .         .         *         .:210
query           xxICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKEGKIQK
2b8tA2          --ICNCGAEATHSLRKIDGKHADYDDIVKIGCQEFYSAVCRHHHKVPNRPY
1xx6A2          --ICVCGNPATRTQRLINGKPAFYD----DPVXESYEARCRKCHVVPQ---
1xbtA2          --VCMCFREAAYTKRLGTEKEVE-----VIGGADKYHSVCRLCYFK-----
1oftA           ---------------------------------------------------