[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bpvp2:AAR97635.1

[Show Plain Result]


## Summary of Sequence Search
    1::460
  104::219     3e-06  24%  376 aa  HOC_BPT4 RecName: Full=Highly immunogenic outer capsid protein;
  112::308     7e-05  31%  333 aa  P2SAF_CYAPA RecName: Full=Photosystem II stability/assembly factor
  339::513     8e-04  36% 1057 aa  VF396_IIV6 RecName: Full=Uncharacterized protein 396L;
    1::460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQPVGGSIYDSQTLGLSIAANVFGSTAA
HOC_BPT4        ------------------------------------------ASPAAGVIGTPVQFTAALASQPDGASAT
P2SAF_CYAPA     ----------------------------------------------------------------------
VF396_IIV6      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YQWLVDGAPIQGANSTSFTFVPSGLGTFDVTCEIKAFGPMVTSEVASVTVEQTPVDLTWQVLPAGYGLPS
HOC_BPT4        YQWYVDDSQVGGETNSTFSYTPTTSGVKRIKCVAQVTATSVTSNEVSLTVNKKTMNPQVTLTPPSINVQQ
P2SAF_CYAPA     ----------------------------------------------------------------------
VF396_IIV6      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NVSGLVGLNAIGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HOC_BPT4        DASATFTANVTGA---------------------------------------------------------
P2SAF_CYAPA     ----------------------------------------------------------------------
VF396_IIV6      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxSTNGGVSWTKLPDFLNSGATASAINKILHVGGNKLIALLGSGYAAVSNDLGATWSALPRWLNS
HOC_BPT4        ----------------------------------------------------------------------
P2SAF_CYAPA     -------TTDGGSSWSRIP----------LSNQL--PGDPALITALGTGKAELATDIGAIY----RTENS
VF396_IIV6      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GGSDNNTSFFDGAVTATGAIIAVGQNGFASISRNGGVTWSALPRYLGMPTNTSIVAIGVSDTAIVVGGNN
HOC_BPT4        ----------------------------------------------------------------------
P2SAF_CYAPA     GQTWKAQIQEPLGVIRTGSYVAVSAKGFYSTWKEGDDKWISHPRQ----SSRRIQSMGFT--------NN
VF396_IIV6      --SVNGTKVLLGNLSGTGNIIEVGKNGFLDVDESGGTGNSVLPLYLKGKEKDSVQKIPVTDIPNVVGSVN


                         .         .         .         .         *         .         .:420
query           GNCAISRNDGVTWSALPLNFGVPIGSGIRDRSIAGASNGTFLVGLSGSPISGNNGYLALSYDDGVTWQQP
HOC_BPT4        ----------------------------------------------------------------------
P2SAF_CYAPA     NRLWMLTRGGQLWFSSNDSFDEPNWEGPKTPE-GKVGFGLGLLNLAFKTVSGGSGILLSSQDTGNTWKKE
VF396_IIV6      G--VFPSKPGGNISLIFSNVTTGILSEIPSRQV----NGTIYI-ISGDPTPTNNGRTFIS--DGTNWNEV


                         .         .         +         .         .         .         .:490
query           PRYLGIPNAGYGALVNTIRNIDxxxxxxxxxxxxxxxxxx
HOC_BPT4        ----------------------------------------
P2SAF_CYAPA     TSTDNIPSNFY-----------------------------
VF396_IIV6      TNHLGSTDARYVQLAGSTMSED------------------