[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bpvp2:AAR97635.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3a0fA.bssp"
#ERROR : Can't open dsspfile "2ebsB.bssp"
#ERROR : Can't open dsspfile "2cn2A.bssp"
#ERROR : Can't open dsspfile "2bihA.bssp"
#ERROR : Can't open dsspfile "3b7fA.bssp"
#ERROR : Can't open dsspfile "3d2fA.bssp"
#ERROR : Can't open dsspfile "3c7nA.bssp"
#ERROR : Can't open dsspfile "2ebsB.bssp"
#ERROR : Can't open dsspfile "2cn2A.bssp"

## Summary of PDB Search
:460
    2e-14  20%  3a0fA  [x.x.x] XYLOGLUCANASE
    2e-10  14%  2ebsB  [x.x.x] OLIGOXYLOGLUCAN REDUCING END-SPECIFIC
    2e-06  18%  2cn2A  [x.x.x] BETA-1,4-XYLOGLUCAN HYDROLASE
    6e-06  12%  2bihA  [x.x.x] NITRATE REDUCTASE [NADPH]
    2e-04  12%  3b7fA  [x.x.x] GLYCOSYL HYDROLASE, BNR REPEAT
    5e-04  16%  3d2fA  [x.x.x] HEAT SHOCK PROTEIN HOMOLOG SSE1
    8e-04  16%  3c7nA  [x.x.x] HEAT SHOCK PROTEIN HOMOLOG SSE1
    3e-04  14%  2ebsB  [x.x.x] OLIGOXYLOGLUCAN REDUCING END-SPECIFIC(query 128->185)
    7e-04  15%  2cn2A  [x.x.x] BETA-1,4-XYLOGLUCAN HYDROLASE(query 170->285)
:460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3a0fA           ----------------------------------------------------------------------
2ebsB           ----------------------------------------------------------------------
2cn2A           ----------------------------------------------------------------------
2bihA           ----------------------------------------------------------------------
3b7fA           ----------------------------------------------------------------------
3d2fA           ----------------------------------------------------------------------
3c7nA           ----------------------------------------------------------------------
2ebsB           ----------------------------------------------------------------------
2cn2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTWQVLPAGYGLPS
3a0fA           ----------------------------------------------------------------------
2ebsB           ----------------------------------------------------------------------
2cn2A           ----------------------------------------------------------------------
2bihA           ----------------------------------------------------------------------
3b7fA           ----------------------------------------------------------------------
3d2fA           ----------------------------------------------------------------------
3c7nA           ----------------------------------------------------------------------
2ebsB           ---------------------------------------------------------TWT--RVNDQEHN
2cn2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NVSGLVGLNAIGSDGSLVVGAMGMEGMRSTDKGLTWSYIGNGFGTGQTSGTISAICXXXXXXXXXXXXXX
3a0fA           ----------------------------------------------------------------------
2ebsB           ----------------------------------------------------------------------
2cn2A           ----------------------------------------------------------------------
2bihA           ----------------------------------------------------------------------
3b7fA           ----------------------------------------------------------------------
3d2fA           ----------------------------------------------------------------------
3c7nA           ----------------------------------------------------------------------
2ebsB           YSGPTMIEADPKVYGRVYLGTNGRGIVYADLTKSTAKCANGQKGT-------------------------
2cn2A           -----------------------------TSVPYKWDNVVIGGGGGFPGIVFN------ETEKDLIYARA


                         .         .         .         +         .         .         .:280
query           XXXXXXRSTNGGVSWTKLPDFLNSGATASAINKILHVGGNKLIALLGSGYAAVSNDLGATWSALPRWLNS
3a0fA           ------YTTNSGDSWTLFQTCVPSLEVGNGGTIAVGADGKTFVWSPSKADGKTSSDYGKTWTAPSGLSKQ
2ebsB           ---------------------------------------------------------GASFTRVGTANAT
2cn2A           ----------------------------------------------------------------------
2bihA           ------VSLDKGKSWKPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDE
3b7fA           ----------------------------------------------------------------------
3d2fA           --------------------------------------------------TPFGLDLGNNNSVLAVARNR
3c7nA           --------------------------------------------------TPFGLDLGNNNSVLAVARNR
2ebsB           ----------------------------------------------------------------------
2cn2A           DIGGAYRWDPSTETWIPLLDHFQDEYSYYGVESITDPVDPNRVYIVAGGAILRSTDRGETWEKTILPFKG


                         .         *         .         .         .         .         +:350
query           GGSDNNTSFFDGAVTATGAIIAVGQNGFASISRNGGVTWSALPRYLGMPTNTSIVAIGVSDTAIVVGGNN
3a0fA           T-------TGIAADRVQANTFYVYVEGDFFVSTDGGKSYTKKGNGLPCCWTYTGTPVTSNLRALWVSVKG
2ebsB           LVSVGAPKSSAPSAVFIWGTDKPGSDIGLYRSDDNGSTWTRVNDEHNYSGPTMIEADPKVYGRVYLGTNG
2cn2A           ----------------------------------VPYKWDNV--VIGGGGGFPGIVFNETKDLIYARADI
2bihA           RMMVQPRTMYWNVTS-----MLNNWWYRVAIIREGESLRFEHP---------------------------
3b7fA           -------------------LVATIKGAWFLASDPARRTWE-LRGPVFLGHTIHHIVQPREPERLAARTLG
3d2fA           GINEVSNRSTPSVVGFGPKNRYLGETGKNKQTSNIKNTVANLKRIIGLDYHHPDFEQESKHFTSLVELDD
3c7nA           GINEVSNRSTPSVVGFGPKNRYLGETGKNKQTSNIKNTVANLKRIIGLDYHHPDFEQESKHFTSLVELDD
2ebsB           ----------------------------------------------------------------------
2cn2A           GNPGR-----------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GNCAISRNDGVTWSALPLNFGVPIGSGIRDRSIAGASNGTFLVGLSGSPISGNNGYLALSYDDGVTWQQP
3a0fA           VGIYHSTDFGNTFTALA-GSGSSLNPAVFSIGAPQTPNATETLFLWGIPSASQPEGLYMSTDNGGLWT--
2ebsB           RGIVYADLTKSTAKCANGQKGTH-----------------------------------------------
2cn2A           GGAYRWDPSTETWIPLLDHFQ-DEYSYYGVESIAPVDPNRVYIVAGYTNDWLPNGAILRSTDRGETWEKT
2bihA           ----------------------------------------------------------------------
3b7fA           PTVFRSDDGGGNWTEATRPPAFNKAPGRVVDHVFWLTPGHASEPGTWYAG-TSPQGLFRSTDHGASWEPV
3d2fA           KKTGAERFAGEKHVFSATQLAAMFIDKVKD----------------------------------------
3c7nA           KKTGAERFAGEKHVFSATQLAAMFIDKVKD----------------------------------------
2ebsB           ----------------------------------------------------------------------
2cn2A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PRYLGIPNAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3a0fA           ----------------------------------------
2ebsB           ----------------------------------------
2cn2A           I---------------------------------------
2bihA           ----------------------------------------
3b7fA           AGFNDHPRR-------------------------------
3d2fA           ----------------------------------------
3c7nA           ----------------------------------------
2ebsB           ----------------------------------------
2cn2A           ----------------------------------------