[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:ydaM

[Show Plain Result]

#ERROR : Can't open dsspfile "2z86A.bssp"
#ERROR : Can't open dsspfile "2z87B.bssp"
#ERROR : Can't open dsspfile "2z86C.bssp"
#ERROR : Can't open dsspfile "2z86B.bssp"
#ERROR : Can't open dsspfile "2z86D.bssp"
#ERROR : Can't open dsspfile "2z87A.bssp"
#ERROR : Can't open dsspfile "3e26A.bssp"
#ERROR : Can't open dsspfile "3e25A.bssp"
#ERROR : Can't open dsspfile "3ckqA.bssp"
#ERROR : Can't open dsspfile "3ckjA.bssp"

## Summary of PDB Search
:420
    8e-10  26%  2z86A  [x.x.x] CHONDROITIN SYNTHASE
    4e-09  28%  2z87B  [x.x.x] CHONDROITIN SYNTHASE
    4e-09  28%  2z86C  [x.x.x] CHONDROITIN SYNTHASE
    1e-08  27%  2z86B  [x.x.x] CHONDROITIN SYNTHASE
    3e-08  25%  2z86D  [x.x.x] CHONDROITIN SYNTHASE
    6e-08  25%  2z87A  [x.x.x] CHONDROITIN SYNTHASE
    2e-04  30%  3e26A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-04  30%  3e25A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-04  30%  3ckqA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-04  30%  3ckjA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
:420

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
2z86A           ----------------------------------------WAGKRKELDGLSIVIPTYNRAKILAITLAC
2z87B           ----------------------------------------WAGKRKQLDGLSIVIPTYNRAKILAITLAC
2z86C           ----------------------------------------WAGKRKELDDLSIVIPTYNRAKILAITLAC
2z86B           --------------------------------------------------LSIVIPTYNRAKILAITLAC
2z86D           ----------------------------------------WAGKRKELDGLSIVIPTYNRAKILAITLAC
2z87A           ----------------------------------------WAGKRKEIDGLSIVIPTYNRAKILAITLAC
3e26A           --------------------------------------PGWTIGELEAAKISVVLPALNEEATIESVIDS
3e25A           --------------------------------------PGWTIGELEAAKISVVLPALNEEATIESVIDS
3ckqA           ------------------------------------NRPGWTVAELEAAKISVVLPALDEEDTIGSVIDS
3ckjA           ------------------------------------NRPGWTVAELEAAKISVVLPALDEEDTIGSVIDS


                         .         .         *         .         .         .         .:140
query           MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
2z86A           LCNQKTIYD-YEVIVADDGSKENIEEIVREFESLLN-IKYVRQK--DYGYQLCAVRNLGLRAAKYNYVAI
2z87B           LCNQKTIYD-YEVIVADDGSKENIEEIVREFESLLN-IKYVRQK--DYGYQLCAVRNLGLRAAKYNYVAI
2z86C           LCNQKTIYD-YEVIVADDGSKENIEEIVREFESLLN-IKYVRQK--DYGYQLCAVRNLGLRAAKYNYVAI
2z86B           LCNQKTIYD-YEVIVADDGSKENIEEIVREFESLLN-IKYVRQK--DYGYQLCAVRNLGLRAAKYNYVAI
2z86D           LCNQKTIYD-YEVIVADDGSKENIEEIVREFE---SLLNIKYVRQKDYGYQLCAVRNLGLRAAKYNYVAI
2z87A           LCNQKTIYD-YEVIVADDGSKENIEEIVREFE---SLLNIKYVRQKDYGYQLCAVRNLGLRAAKYNYVAI
3e26A           ISPLV---DGLELIVLDSGSTDDTEIRAIASGARVVSREQALPEVP-VRPGKGEALWRSLAATSGDIVVF
3e25A           ISPLV---DGLELIVLDSGSTDDTEIRAIASGARVVSREQALPEVP-VRPGKGEALWRSLAATSGDIVVF
3ckqA           ISPLV---DGLELIVLDSGSTDDTEIXXXXXXXXXXXXEQALPEVP-IRPGKGEALWRSLAASRGDIVVF
3ckjA           ISPLV---DGLELIVLDSGSTDDTEIXXXXXXXXXXXXEQALPEVP-IRPGKGEALWRSLAASRGDIVVF


                         +         .         .         .         .         *         .:210
query           YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
2z86A           LDCDMAPNPLWVQSYMELLAVDDNV-ALIGPRKYIDTSKHTYLDFLSQKSLINE-IPESVDWRILRLCNT
2z87B           LDCDMAPNPLWVQSYMELLAVDDNV-ALIGPRKYIDTSKHTYLDFLSQEIITNQNKSVDWRIEHFKLCNT
2z86C           LDCDMAPNPLWVQSYMELLAVDDNV-ALIGPRKYIDTSKHTYLDFLSQEIITNQNKSVDWRIEHFKLCNT
2z86B           LDCDMAPNPLWVQSYMELLAVDDNV-ALIGPRKYIDTSKHTYLDFLSIPEIITNNKSVDWRIEHFKLCNT
2z86D           LDCDMAPNPLWVQYMELLAVDDNV--ALIGPRKYIDTSKHTYLDFLSQKSLINEKVEQNKSVDWLRLCNT
2z87A           LDCDMAPNPLWVQYMELLAVDDNV--ALIGPRKYIDTSKHTYLDFLSQKSLINEKVEQNKSVDWLRLCNT
3e26A           IDSDINPHPLFVPWLVGPLLTGEGIQLVKSFYR-------------------------------------
3e25A           IDSDINPHPLFVPWLVGPLLTGEGIQLVKSFYR-------------------------------------
3ckqA           VDSDINPHPMFVPWLVGPLLTGDGVHLVKSFYR-------------------------------------
3ckjA           VDSDINPHPMFVPWLVGPLLTGDGVHLVKSFYR-------------------------------------


                         .         .         .         +         .         .         .:280
query           PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPxxxxxxxxxxxxxxxxx
2z86A           PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
2z87B           PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
2z86C           PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
2z86B           PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
2z86D           PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
2z87A           PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2z86A           ----------------------------------------------------------------------
2z87B           ----------------------------------------------------------------------
2z86C           ----------------------------------------------------------------------
2z86B           ----------------------------------------------------------------------
2z86D           ----------------------------------------------------------------------
2z87A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2z86A           ----------------------------------------------------------------------
2z87B           ----------------------------------------------------------------------
2z86C           ----------------------------------------------------------------------
2z86B           ----------------------------------------------------------------------
2z86D           ----------------------------------------------------------------------
2z87A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------