[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:gabP

[Show Plain Result]

#ERROR : Can't open dsspfile "3hqkD.bssp"
#ERROR : Can't open dsspfile "3hqkC.bssp"
#ERROR : Can't open dsspfile "3hqkB.bssp"
#ERROR : Can't open dsspfile "3hqkA.bssp"
#ERROR : Can't open dsspfile "3h6bC.bssp"
#ERROR : Can't open dsspfile "3h6bA.bssp"
#ERROR : Can't open dsspfile "3h5mA.bssp"
#ERROR : Can't open dsspfile "3giaA.bssp"
#ERROR : Can't open dsspfile "3gi9C.bssp"
#ERROR : Can't open dsspfile "3gi8C.bssp"

## Summary of PDB Search
:469
    2e-05  24%  3hqkD  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    2e-05  24%  3hqkC  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    2e-05  24%  3hqkB  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    2e-05  24%  3hqkA  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    2e-05  25%  3h6bC  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    2e-05  25%  3h6bA  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    2e-05  25%  3h5mA  [x.x.x] ARGININE/AGMATINE ANTIPORTER
    3e-04  26%  3giaA  [x.x.x] UNCHARACTERIZED PROTEIN MJ0609
    3e-04  26%  3gi9C  [x.x.x] UNCHARACTERIZED PROTEIN MJ0609
    3e-04  26%  3gi8C  [x.x.x] UNCHARACTERIZED PROTEIN MJ0609
:469

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRMLGEMSAVN
3hqkD           ----------------VTLMVSGNIMGSGVFLLPANLA-ATGGIAIYGWLVTIIGALALSMVYAKMSSLD
3hqkC           ----------------VTLMVSGNIMGSGVFLLPANLA-ATGGIAIYGWLVTIIGALALSMVYAKMSSLD
3hqkB           ----------------VTLMVSGNIMGSGVFLLPANLA-ATGGIAIYGWLVTIIGALALSMVYAKMSSLD
3hqkA           ----------------VTLMVSGNIMGSGVFLLPANLA-ATGGIAIYGWLVTIIGALALSMVYAKMSSLD
3h6bC           ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
3h6bA           ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
3h5mA           ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
3giaA           ----------------------------------------------------------------------
3gi9C           ----------------------------------------------------------------------
3gi8C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PTSGSFSQYAHDAIGPWAGFTIGWLYWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hqkD           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3hqkC           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3hqkB           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3hqkA           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3h6bC           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3h6bA           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3h5mA           PSPGGSYAYARRCFGPFLGYQTNVLYW-------------------------------------------
3giaA           ----------------------------------------------------------------------
3gi9C           ----------------------------------------------------------------------
3gi8C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hqkD           ----------------------------------------------------------------------
3hqkC           ----------------------------------------------------------------------
3hqkB           ----------------------------------------------------------------------
3hqkA           ----------------------------------------------------------------------
3h6bC           ----------------------------------------------------------------------
3h6bA           ----------------------------------------------------------------------
3h5mA           ----------------------------------------------------------------------
3giaA           ----------------------------------------------------------------------
3gi9C           ----------------------------------------------------------------------
3gi8C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxMGTEIVAIAAGETSNPIESVTKATRSVVWRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVP
3hqkD           ----------------------------------------------------------------------
3hqkC           ----------------------------------------------------------------------
3hqkB           ----------------------------------------------------------------------
3hqkA           ----------------------------------------------------------------------
3h6bC           ----------------------------------------------------------------------
3h6bA           ----------------------------------------------------------------------
3h5mA           ----------------------------------------------------------------------
3giaA           --MGFGVITNASEHIENPKKNVPRAIFISILIVMFVYVGVAISAIGNLPINALAVAAKPFLGNLGFLLIS
3gi9C           --MGFGVITNASEHIENPKKNVPRAIFISILIVMFVYVGVAISAIGNLPINALAVAAKPFLGNLGFLLIS
3gi8C           --MGFGVITNASEHIENPKKNVPRAIFISILIVMFVYVGVAISAIGNLPINALAVAAKPFLGNLGFLLIS


                         .         *         .         .         .         .         +:350
query           AAAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNY
3hqkD           ----------------------------------------------------------------------
3hqkC           ----------------------------------------------------------------------
3hqkB           ----------------------------------------------------------------------
3hqkA           ----------------------------------------------------------------------
3h6bC           ----------------------------------------------------------------------
3h6bA           ----------------------------------------------------------------------
3h5mA           ----------------------------------------------------------------------
3giaA           IGA-------LFSISSAMNATIYGGANVAYSLAKDGELPEFFERKSTEGLYITSAL-GVLFALL------
3gi9C           IGA-------LFSISSAMNATIYGGANVAYSLAKDGELPEFFERKSTEGLYITSAL-GVLFALL------
3gi8C           IGA-------LFSISSAMNATIYGGANVAYSLAKDGELPEFFERKSTEGLYITSAL-GVLFALL------


                         .         .         .         .         *         .         .:420
query           FSPDTVFLFLVNSSGAIALLVYLVIAVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hqkD           ----------------------------------------------------------------------
3hqkC           ----------------------------------------------------------------------
3hqkB           ----------------------------------------------------------------------
3hqkA           ----------------------------------------------------------------------
3h6bC           ----------------------------------------------------------------------
3h6bA           ----------------------------------------------------------------------
3h5mA           ----------------------------------------------------------------------
3giaA           FNMEGV----ASITSAVFMVIYLFVILS------------------------------------------
3gi9C           FNMEGV----ASITSAVFMVIYLFVILS------------------------------------------
3gi8C           FNMEGV----ASITSAVFMVIYLFVILS------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3hqkD           -------------------------------------------------
3hqkC           -------------------------------------------------
3hqkB           -------------------------------------------------
3hqkA           -------------------------------------------------
3h6bC           -------------------------------------------------
3h6bA           -------------------------------------------------
3h5mA           -------------------------------------------------
3giaA           -------------------------------------------------
3gi9C           -------------------------------------------------
3gi8C           -------------------------------------------------