[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:mecA

[Show Plain Result]

#ERROR : Can't open dsspfile "3jtpB.bssp"
#ERROR : Can't open dsspfile "3jtpA.bssp"
#ERROR : Can't open dsspfile "3jtoA.bssp"
#ERROR : Can't open dsspfile "3jtoE.bssp"
#ERROR : Can't open dsspfile "3jtoC.bssp"
#ERROR : Can't open dsspfile "3jtnB.bssp"
#ERROR : Can't open dsspfile "3jtoB.bssp"
#ERROR : Can't open dsspfile "3jtnA.bssp"
#ERROR : Can't open dsspfile "3jtoF.bssp"
#ERROR : Can't open dsspfile "1qwgA.bssp"

## Summary of PDB Search
:218
    2e-48  97%  3jtpB  [x.x.x] ADAPTER PROTEIN MECA 1
    7e-48  97%  3jtpA  [x.x.x] ADAPTER PROTEIN MECA 1
    2e-13  34%  3jtoA  [x.x.x] ADAPTER PROTEIN MECA 2
    5e-13  37%  3jtoE  [x.x.x] ADAPTER PROTEIN MECA 2
    5e-13  37%  3jtoC  [x.x.x] ADAPTER PROTEIN MECA 2
    5e-13  37%  3jtnB  [x.x.x] ADAPTER PROTEIN MECA 2
    7e-13  37%  3jtoB  [x.x.x] ADAPTER PROTEIN MECA 2
    7e-13  37%  3jtnA  [x.x.x] ADAPTER PROTEIN MECA 2
    3e-12  34%  3jtoF  [x.x.x] ADAPTER PROTEIN MECA 2
    8e-04  31%  1qwgA  [c.1.27] (2R)-PHOSPHO-3-SULFOLACTATE SYNTHASE
:218

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDKG
3jtpB           ----------------------------------------------------------------------
3jtpA           ----------------------------------------------------------------------
3jtoA           ----------------------------------------------------------------------
3jtoE           ----------------------------------------------------------------------
3jtoC           ----------------------------------------------------------------------
3jtnB           ----------------------------------------------------------------------
3jtoB           ----------------------------------------------------------------------
3jtnA           ----------------------------------------------------------------------
3jtoF           ----------------------------------------------------------------------
1qwgA           ------------------------------------------------------------------LDAG


                         .         .         *         .         .         .         .:140
query           LEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVI
3jtpB           -------------------------------------------------------KLQFVLRFGDFEDVI
3jtpA           --------------------------------------------------------LQFVLRFGDFEDVI
3jtoA           -----------------------------------------------------DESADIIYQFHSFEDII
3jtoE           -----------------------------------------------------------IYQFHSFEDII
3jtoC           -----------------------------------------------------------IYQFHSFEDII
3jtnB           -----------------------------------------------------------IYQFHSFEDII
3jtoB           -----------------------------------------------------------IYQFHSFEDII
3jtnA           -----------------------------------------------------------IYQFHSFEDII
3jtoF           ------------------------------------------------------ESADIIYQFHSFEDII
1qwgA           ADYVIIEGRESGKGKGLF-----DKEGKVKENELDVLAKNVDINKVIFEAPQKSQQVAFILKFGSFDEVI


                         +         .         .         .         .         *         .:210
query           SLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALE
3jtpB           SLSKLNVNGSKTTLYSFENRYYLYVDFCDMTDEEVENQLSIMLEYANESSISIHRLEEYGKLIISEHALE
3jtpA           SLSKLNVNGSKTTLYSFENRYYLYVDFCDMTDEEVENQLSIMLEYANESSISIHRLEEYGKLIISEHALE
3jtoA           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
3jtoE           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
3jtoC           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
3jtnB           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
3jtoB           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
3jtnA           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
3jtoF           QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
1qwgA           SLETL-----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TIKKHFAS
3jtpB           TIKKHFAS
3jtpA           TIKKHFAS
3jtoA           TIQTHFS-
3jtoE           TIQTHFS-
3jtoC           TIQTHFS-
3jtnB           TIQTHFS-
3jtoB           TIQTHF--
3jtnA           TIQTHF--
3jtoF           TIQTH---
1qwgA           --------