[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:yjkB

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2zzzA.bssp"
#ERROR : Can't open dsspfile "2zzyA.bssp"
#ERROR : Can't open dsspfile "1ex7A.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"

## Summary of PDB Search
:250
    2e-31  35%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-26  32%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    4e-26  35%  2oukB  [x.x.x] PROTEIN ARTP
    4e-26  35%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-25  37%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    1e-25  37%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-25  36%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-25  36%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-25  36%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-25  34%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    9e-25  34%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-24  36%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-24  36%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-24  33%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-24  33%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-24  32%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-22  33%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    1e-22  31%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    1e-22  33%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-22  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-22  33%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-22  33%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-22  33%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-21  33%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-21  31%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-21  31%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-20  32%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-20  32%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-20  33%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    3e-20  33%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-20  30%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-20  30%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-20  32%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    5e-20  37%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-19  33%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    6e-19  29%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-19  30%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-18  35%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-18  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-17  31%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-17  33%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    1e-17  28%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-17  29%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-17  29%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    5e-17  31%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-16  28%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-16  28%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-16  30%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-15  33%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    9e-15  31%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    1e-14  28%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-14  32%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14  31%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-14  27%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-14  31%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    3e-14  31%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-14  31%  1yqtA  [x.x.x] RNASE L INHIBITOR
    6e-14  34%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-13  32%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-13  34%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    1e-13  26%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    1e-13  30%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  30%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-13  31%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-13  31%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-13  31%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-13  31%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-13  31%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-13  31%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-13  31%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  31%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  31%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  31%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-13  29%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    6e-13  29%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-12  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  30%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  31%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  1ji0A  [c.37.1] ABC TRANSPORTER
    5e-12  29%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-12  29%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-12  30%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-12  26%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    9e-12  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  30%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  26%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-11  26%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-11  30%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    4e-10  35%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    4e-10  35%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-09  28%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-09  28%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  28%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  28%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  28%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  28%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  28%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-09  35%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    5e-09  35%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    5e-09  35%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    5e-09  28%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-09  29%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-08  26%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-08  30%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    6e-08  27%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    2e-07  27%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-07  27%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-07  25%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-07  34%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-07  35%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-06  26%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-06  27%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-06  28%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-05  30%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-04  51%  2zzzA  [x.x.x] GUANYLATE KINASE
    3e-04  51%  2zzyA  [x.x.x] GUANYLATE KINASE
    3e-04  51%  1ex7A  [c.37.1] GUANYLATE KINASE
    3e-04  51%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-04  51%  3a00A  [x.x.x] GUANYLATE KINASE
    5e-04  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-04  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-04  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-04  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-04  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-04  34%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-04  34%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-04  28%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 164->245)
    4e-06  28%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 164->245)
:250

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxNDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLSMCNLMRTPDS
3dhwC           ------------IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTE
3d31A           -------------------------------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDS
2oukB           ----------------------KKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDXXX
2oljA           ----------------------KKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDXXX
1mt0A           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEN
2ff7A           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEN
2fgkA           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEN
2ffbA           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEN
3b5jA           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPEN
2it1B           ----------------------------FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTS
2it1A           ----------------------------FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTS
1xefA           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEN
2ffaA           ------------ITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEN
1l2tB           ------------IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTE
1l2tA           ------------IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTE
1pf4A           --------------------TFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDS
1q12A           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
1jj7A           ------------------------------VLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTG
3fh6A           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2awoA           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2awnB           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2r6gB           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2r6gA           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2yyzA           ----------------------------------VSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTS
1g291           -------------------------------VREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSR
2awoC           --------------------------QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
1mv5D           ------------LSARHVDFAYDDSEQ---ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTA
1mv5A           ------------LSARHVDFAYDDSEQ---ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTA
3g60A           ------------------------------VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMA
3g5uA           ------------------------------VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMA
2ixfC           ------------VKFQDVSFAYPNHPNV-QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTG
2ixfA           ------------VKFQDVSFAYPNHPNV-QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTG
2hydA           --------------------SFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTS
1f3oA           ------------IKLKNVTKTYKGEEIIY-ALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTE
2pcjA           ----------------------------YEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTE
2ixeA           ------------VKFQDVSFAYPNHPNV-QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTG
2ixfD           ------------VKFQDVSFAYPNHPNV-QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTG
2awnC           --------------------------QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRM---------
1b0uA           ----------------------------HEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSE
2ixeD           ------------VKFQDVSFAYPNHPNV-QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTG
2onkA           ----------------------------------------------LLGPTGAGKSVFLELIAGIVKPDR
2ixgA           ------------VKFQDVSFAYPNHPNV-QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTG
3fvqB           --------------------------QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDS
3fvqA           --------------------------QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDS
3bk7A           ------------------------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTE
1z47B           ------------IEFVGVEKIYPGGARS---VRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTK
1z47A           ------------IEFVGVEKIYPGGARS---VRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTK
2ghiA           ------------IEFSDVNFSYPKQ-TNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKL--LYRFYDA
2d62A           -------------------------------VKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGL-EEPTR
2qi9C           -------------------------------LGPLSGEVRAGEILHLVGPNGAGKSTLLARAG---TSGK
1v43A           --------------------------------------IKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTE
2nq2D           -------------------------GFYYQAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQ
1l7vC           -------------------------------LGPLSGEVRAGEILHLVGPNGAGKSTLLARAG---TSGK
2ghiC           ------------IEFSDVNFSYPKQ-TNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKL--LYRFYDA
1z2rA           ---NAQFQRGMAAEFRNVTFTYP--GREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDE
1vplA           -------------------------------------------------PNGAGKTTTLRIISTLIKPSS
1yqtA           ------------------------------------GEIKKGEVIGIVGPNGIGKTTFVKLAGV-EEPTE
2cbzA           -------------------------------LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVE
2nq2C           ------------------------------LFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQ
2ghiB           ------------IEFSDVNFSYPKQ-TNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKL--LYRFYDA
3gfoA           -------------------------------LKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSS
2bbtB           --------------FGELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
3b60A           ------------LEFRNVTFTYP--GREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDE
1xmiB           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2awnA           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2pzfB           --------------------AFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2pzgA           --------------------AFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2pzfA           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2pzeB           --------------------AFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2pzeA           --------------------AFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1xmiE           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1xmiC           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1xmiA           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1oxvA           ------------IIVKNVSKVFKKGKVV--ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPST
1oxsC           ------------IIVKNVSKVFKKGKVV--ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPST
2bbsA           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2pzgB           --------------------AFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2bbtA           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2bbsB           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1ji0A           --------------------------------------VPRGQIVTLIGANGAGKTTTLSAIAGLVRAQK
2yz2B           -------------------------------LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTS
2yz2A           -------------------------------LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTS
1xmiD           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1g6hA           ----------------------------FKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADE
2bboA           --------------------AFWEEGLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1xmjA           ------------------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1gajA           ----------------------------FKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADE
1g9xA           ----------------------------FKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADE
2ghiD           ------------IEFSDVNFSYHR------TLKSINFFIPSGTTCALVGHTGSGKSTIAKL--LYRFYDA
2ix3A           ---------------------FQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTS
2iwhB           ---------------------FQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTS
2d2eA           ------------------------DGET--ILKGVNLVVPKGEVHALMGPNGAGKSTLILAGDPEYTVER
1r10A           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0zD           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0zC           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0zB           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0zA           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0xD           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0xC           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0xB           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0xA           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0wC           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0wB           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1r0wA           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1q3hD           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1q3hC           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1q3hB           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1q3hA           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1xfaA           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1xf9D           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1xf9C           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1xf9B           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1xf9A           ------------------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
2ix8A           -----------------VTNEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTS
2iw3B           -----------------VTNEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTS
2iw3A           -----------------VTNEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTS
2ihyA           ----------------------RKQGKT--ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATS
2d2fA           ------------------------DGET--ILKGVNLVVPKGEVHALMGPNGAGKSTLILAGDPEYTVER
2ihyB           ----------------------RKQGKT--ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATS
2pjzA           -----------------------------------------GEKVIILGPNGSGKTTLLRAISGL-LPYS
1sgwA           -------------------------GYDKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLK
2zu0C           ------------------------------ILRGLSLDVHPGEVHAIMGPNGSGKSTL--SATLAGREDG
2d3wA           ------------------------------ILRGLSLDVHPGEVHAIMGPNGSGKSTL--SATLAGREDG
1oxxK           ------------IIVKNVSKVFKKGKVV--ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPST
2awoD           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2awnD           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2d3wC           ------------------------------ILRGLSLDVHPGEVHAIMGPNGSGKSTL--SATLAGREDG
2d3wD           ------------------------------ILRGLSLDVHPGEVHAIMGPNGSGKSTL--SATLAGREDG
2d3wB           ------------------------------ILRGLSLDVHPGEVHAIMGPNGSGKSTL--SATLAGREDG
1e69A           -------------------------------------------VTAIVGPNGSGKSNIIDAIKWVNLPPA
2zzzA           --------------------------------------------IVISGPSGTGKSTLLSVSSTTRTPRA
2zzyA           --------------------------------------------IVISGPSGTGKSTLLSVSSTTRTPRA
1ex7A           --------------------------------------------IVISGPSGTGKSTLLSVSSTTRTPRA
3a00B           --------------------------------------------IVISGPSGTGKSTLLSVSSTTRTPRA
3a00A           --------------------------------------------IVISGPSGTGKSTLLSVSSTTRTPRA
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQLYSPEKLASLAGLPPELLDR
3dhwC           GSVLVDGQELTTLSESELRRQIGMIFQHFNLLSSTVFGNVALPLELDNTPKDEVKRLLSLVGLGDKH-DS
3d31A           GRILLDGKDVTD--LSPEKHDIAFVYQNYSLFPHNVKKNLEFGMRM--KKIKDPKRVLDTADLKIELLDR
2oukB           XXXXXXNLKAKDTNLNKVREEVGMVFQRFNLFPHTVLNNITLAPM--KVRKWPREKAEAKA---MELLDK
2oljA           XXXXXXNLKAKDTNLNKVREEVGMVFQRFNLFPHTVLNNITLAPM--KVRKWPREKAEAKA---MELLDK
1mt0A           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
2ff7A           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
2fgkA           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
2ffbA           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
3b5jA           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
2it1B           GKIYFDEKDVTELPPKD--RNVGLVFQNWALYPHTVYKNIAFPLELRKAPREEIDKVAKMLHID-KLLNR
2it1A           GKIYFDEKDVTELPPKD--RNVGLVFQNWALYPHTVYKNIAFPLELRKAPREEIDKVAKMLHID-KLLNR
1xefA           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
2ffaA           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANGMSVEKVIYAAKLAGAHDFISELVGE
1l2tB           GEVYIDNIKTNDLDDDELRDKIGFVFQQIPLLTALENVELPLIFKYRGAMSGEERRKRALAELEERFANH
1l2tA           GEVYIDNIKTNDLDDDELRDKIGFVFQQIPLLTALENVELPLIFKYRGAMSGEERRKRALAELEERFANH
1pf4A           GSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAEQIEQAQAHAMEFIENMPQGLDTVIGE
1q12A           GDLFIGEKRMNDTPPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
1jj7A           GQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIALTQKPTMEEITAAAVKSGISGLPQGYVDE
3fh6A           GDLFIGEKRMNDTPPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
2awoA           GDLFIGEKRMNDTPPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
2awnB           GDLFIGEKRMNDTPPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
2r6gB           GDLFIGEKRMNDTPPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
2r6gA           GDLFIGEKRMNDTPPAE--RGVGMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
2yyzA           GE--IYFDDVLVNDIPPKYREVGMVFQNYALYPHTVFENIAFPLRARRISKDEVEKVVEIARLIDNLLDR
1g291           GQIYIGDKLVADPEVPPKDRDIAMVFQSYALYPHTVYDNIAFPLKLRKVPRQEIDQVAELLGLT-ELLNR
2awoC           GDLFIGEKRMNDTPPAE-RGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLA-HLLDR
1mv5D           GEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTLEGDYTDEDLWQVLDLASFVENMPDQLNT
1mv5A           GEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTLEGDYTDEDLWQVLDLASFVENMPDQLNT
3g60A           GSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGD---NSRVVSYEEIVRAASLPDKYNTR
3g5uA           GSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGD---NSRVVSYEEIVRAASLPDKYNTR
2ixfC           GKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENLTRTPTMEEITAVAMESGAHISGFPQGYVGE
2ixfA           GKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENLTRTPTMEEITAVAMESGAHISGFPQGYVGE
2hydA           GQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRTATDEEVVEAAKMANAQGYDTEVGER
1f3oA           GEVYIDNIKTNDLDDDELRDKIGFVFQQIPLLTALENVELPLIFKYRGASGEERRKRA-LECLKAELEER
2pcjA           GKVFLEGKEVDYTNEKELNRKLGFVFQELTALENVIVPMLKMGKPKKEAK-ERGEYLLSELGL-GDKLSR
2ixeA           GKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENLTRTPTMEEITAVAMESGAHISGFPQGYVGE
2ixfD           GKVLLDGEPLVQYDHHYLHTQVAAVGQL--LFGRSFRENLTRTPTMEEITAVAMESGAHISGFPQGYVGE
2awnC           ----IAGLGV------------GMVFQSYALYPHSVAENMSFGLKLAGAKKQRVNQVAEVLQLA-HLLDR
1b0uA           GAIIVNGQNINKNQLRLLRTRLTMVFQHFNLWSHTVLENVAPIQVLGLSKHDAREKYLAKVGIDERAQGK
2ixeD           GKVLLDGEPLVQYDHHYLHTQVAAV---GPLLFGSFRENIA----------YGLTRTPTMEEITAVAMES
2onkA           GEVRLNGADITP--LPPERRGIGFVPQDYALFPHSVYRNIALXXXXXXXXXXXXXXMAEKLGIA-HLLDR
2ixgA           GKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENLTRTPTMEEITAVAMESGAHISGFPQGYVGE
3fvqB           GEISLSGKTIFSKNTNLPVRERRLGYL---VQEGVLFPHLTVYRNITAQERQRIEAMLELTGI-SELAGR
3fvqA           GEISLSGKTIFSKNTNLPVRERRLGYL---VQEGVLFPHLTVYRNITAQERQRIEAMLELTGI-SELAGR
3bk7A           GKV--------EWDLTVAYKPQYIKAE----YEGTVYELLSKIDSSKNSNFYKTELLKPLGII--DLYDR
1z47B           GDVWIGGKRVTD--LPPQKRNVGLVFQNYALFQHTVYDNVSF--GLREKRVPKDEMDARVRELLESYANR
1z47A           GDVWIGGKRVTD--LPPQKRNVGLVFQNYALFQHTVYDNVSF--GLREKRVPKDEMDARVRELLESYANR
2ghiA           GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNIEVIKATKSAQLYDPKKWDTIVG-------N
2d62A           GQIYIEDNLVADPEVPPKERDVAV-FQSYALYPHTVYDNIAFPLKLRKVPKQEIDKVREVAELGTELLNR
2qi9C           GSIQFAGQPLEAWSATKLAHRAYLSQQQTPPFATPVWHYLT----LHQHDKTRTELLNDVAGALDDKLGR
1v43A           GRIYFGDRDVTYLPPKD--RNISMVFQHM-----TVYENIAFLKKFPKDEIDKRVRWAAELLQIEELLNR
2nq2D           GKIEVYQ------SIGFVPQ-----FFSSPFAY-SVLDIVLMGRSTHINTFAKPKSHDYQVAMQAHLAKR
1l7vC           GSIQFAGQPLEAWSATKLAHRAYLSQQQTPPFATPVWHYLT----LHQHDKTRTELLNDVAGALDDKLGR
2ghiC           GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATEEVIKATKSAQLYDFIPKKWDT
1z2rA           GHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYA----RTEEYSREQIEEAARMAYAMMDN
1vplA           GIVTVFGKNVVE-EPHEVRKLISYLPEEA----GAYRNMQGIEYLRFVAGFYASERATEIAGLGEKIKDR
1yqtA           GKI--------EWDLTVAYKPQYIKAD----YEGTVYELLSKIDASKNSNFYKTELLKPLGII--DLYDR
2cbzA           GHVAIKG-------------SVAYVPQQAWIQNDSLRENIQLEEPYYRSVIQACALLPDLEILPSEIGEK
2nq2C           GKIEVYQ------SIGFVPQ-----FFSSPFAY-SVLDIVLMGRSTHINTFAKPKSHDYQVAMQAHLAKR
2ghiB           GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNIEVIKATKSAQLYDPKKWDTIVG--------
3gfoA           GRILFDNKPISRKGIMKLRESIGIVFQDPDLFSASVYQDVSVNMKLPEDEIRKRVDNALKRTGIEHLKDK
2bbtB           GKIKHSGR-------------ISFCSQNSWIMPGTIKENIIGV----SYDEYRYRSVIKACQLEEDISKF
3b60A           GHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYA----RTEEYSREQIEEAARMAYAMMDN
1xmiB           GKIKHSGR-------------ISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQL----EEDISK
2awnA           GDLFIGEKRMNDTPPAE--RGVGMVFQSYAL----------------------------------EVINQ
2pzfB           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
2pzgA           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
2pzfA           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
2pzeB           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
2pzeA           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
1xmiE           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
1xmiC           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
1xmiA           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
1oxvA           GELYFDDRLVASNGVPPEDRKIGMVFQTWALYPNTAFENIAFLTNMKMSKEEIRKRVEEVAKILDHVLNH
1oxsC           GELYFDDRLVASNGVPPEDRKIGMVFQTWALYPNTAFENIAFLTNMKMSKEEIRKRVEEVAKILDHVLNH
2bbsA           GKIKHSGR-------------ISFCSQNSWIMPGTIKENIIGV----SYDEYRYRSVIKACQLEEDISKF
2pzgB           GKIKHSGR-------------ISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEK
2bbtA           GKIKHSGR-------------ISFCSQNSWIMPGTIKENIIGV----SYDEYRYRSVIKACQLEEDISKF
2bbsB           GKIKHSGR-------------ISFCSQNSWIMPGTIKENIIGV----SYDEYRYRSVIKACQLEEDISKF
1ji0A           GKIIFNGQDITNKPAHVINRGIALVPEGRRIFELTVYENLGAYNRKDKEGIKRDEWIFSLFPRLKERLKQ
2yz2B           GDVLYDGERKKGY---EIRRNIGIAFQEDQFFAERVFDEVAFVKNFYPDRDPVPKKAMEFVGLDDSFKDR
2yz2A           GDVLYDGERKKGY---EIRRNIGIAFQEDQFFAERVFDEVAFVKNFYPDRDPVPKKAMEFVGLDDSFKDR
1xmiD           GKIKHSGR-------------ISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEK
1g6hA           GRVYFENKDITNKEPAELYHYGIVTFQTQPLKEMTVLENLPLNSLFYKKWIPKEEEMVEKAFKILEFLDR
2bboA           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
1xmjA           GKIKHSGR-------------ISFCSQFSWIMPGTIKENISYDEYRYRSVIKAEEDISKFAEKDNIVLGE
1gajA           GRVYFENKDITNKEPAELYHYGIVTFQTQPLKEMTVLENLPLNSLFYKKWIPKEEEMVEKAFKILEFLDR
1g9xA           GRVYFENKDITNKEPAELYHYGIVTFQTQPLKEMTVLENLPLNSLFYKKWIPKEEEMVEKAFKILEFLDR
2ghiD           GDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNIEVIKATKSAQLYD-----FIEALPKKW---
2ix3A           GEV---------------------------------------------------EEHCSMLGLDPEIVSH
2iwhB           GEV---------------------------------------------------EEHCSMLGLDPEIVSH
2d2eA           GEILLDGENILELSPDEARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDW
1r10A           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0zD           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0zC           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0zB           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0zA           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0xD           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0xC           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0xB           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0xA           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0wC           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0wB           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1r0wA           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1q3hD           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1q3hC           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1q3hB           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1q3hA           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLAEQDNTVLGE
1xfaA           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLAEQDNTVLGE
1xf9D           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLAEQDNTVLGE
1xf9C           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLAEQDNTVLGE
1xf9B           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLAEQDNTVLGE
1xf9A           GIIKHSGR-------------VSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLAEQDNTVLGE
2ix8A           GEV----------------------------------------------------------GLDPEIVSH
2iw3B           GEV----------------------------------------------------------GLDPEIVSH
2iw3A           GEV----------------------------------------------------------GLDPEIVSH
2ihyA           GTVNLFGKETVRQHIGFVSHSLLEKFQEGEVISGAIDDEIR--NEAHQLKLVGSAKAQQYIGY-------
2d2fA           GEILLDGENILELSPDEARKGLFLAFQYPVEVPGVTIANLALQAKLGRAEFWTKVKKAELLDWDESYLSR
2ihyB           GTVNLFGKETVRQHIGFVSHSLLEKFQEGEVISGAFK-SIGVYQDIDDEIRNEAHQLLKLVG--SAKAQQ
2pjzA           GNIFINGMEVRKIR-NYIRYSTNL--PEAYEIGVTVNDIVYLYEELKGLDRDLFLEMLKALKLGEEILRR
1sgwA           GEIIYNGVPITKVK----GKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKK
2zu0C           GTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRMEEKIALLKMPEDLLTR
2d3wA           GTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRMEEKIALLKMPEDLLTR
1oxxK           GELYFDDRLVAKLIVPPEDRKIGMVFQTWALYPNTAFENIAFLTNMKMSKEEIRKRVEEVAKILDHVLNH
2awoD           GDLFIGEKRMNDTPPAE--RGVGMVEPSVFLLDEPLDAALRVQMRIEISRLH------------------
2awnD           GDLFIGEKRMNERGVGMVEPSVFLLDEPLSNLDAALRVQMRIISRLHK----------------------
2d3wC           GTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRMEEKIALLKMPEDLLTR
2d3wD           GTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRMEEKIALLKMPEDLLTR
2d3wB           GTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRMEEKIALLKMPEDLLTR
1e69A           GSAYVEGEEITV--ARELKRTGENTYNGSPVRLKDIRDRVNAYQRVNESLFFGGEGRLEISIRKPGRRDQ
2zzzA           GEVN--GKDYNFVSVDEFK---------------------------------------------------
2zzyA           GEVN--GKDYNFVSVDEFK---------------------------------------------------
1ex7A           GEVN--GKDYNFVSVDEFK---------------------------------------------------
3a00B           GEVN--GKDYNFVSVDEFK---------------------------------------------------
3a00A           GEVN--GKDYNFVSVDEFK---------------------------------------------------
2vf8B           -------------------------------------------------------------------LGQ
2vf8A           -------------------------------------------------------------------LGQ
2vf7C           -------------------------------------------------------------------LGQ
2vf7B           -------------------------------------------------------------------LGQ
2vf7A           -------------------------------------------------------------------LGQ
2r6fB           -------------------------------------------------------------------LGQ
2r6fA           -------------------------------------------------------------------LGQ
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSALEIEELIKRQHQEKKWTVMWVTHNMEQAKR
3dhwC           YPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKR
3d31A           NPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARI
2oukB           VGLSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK-QLANEGMTMVVVTHEMGFARE
2oljA           VGLSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK-QLANEGMTMVVVTHEMGFARE
1mt0A           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALD----YESEHVIMRNMHKKGRTVIIIAHRLSTVKN
2ff7A           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALD----YESEHVIMRNMHKKGRTVIIIAHRLSTVKN
2fgkA           QGAGLSGGQRQRIAIARALVNNPKILIFDQATSALD----YESEHVIMRNMHKKGRTVIIIAHRLSTVKN
2ffbA           QGAGLSGGQRQRIAIARALVNNPKILIFDQATSALD----YESEHVIMRNMHKKGRTVIIIAHRLSTVKN
3b5jA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALD----YESEHVIMRNMHKKGRTVIIIAHRLSTVKN
2it1B           YPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALA
2it1A           YPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALA
1xefA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALD----YESEHVIMRNMHKKGRTVIIIAARLSTVKN
2ffaA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALD----YESEHVIMRNMHKKGRTVIIIAARLSTVKN
1l2tB           KPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVA-R
1l2tA           KPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVA-R
1pf4A           NGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNK--TVLVIAHRLSTIEQ
1q12A           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
1jj7A           AGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQ
3fh6A           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2awoA           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2awnB           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2r6gB           KPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2r6gA           KPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2yyzA           KPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMT
1g291           KPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMT
2awoC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
1mv5D           EVGEISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKAL--DSLMKGRTTLVIAHRLSTIVD
1mv5A           EVGEISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKAL--DSLMKGRTTLVIAHRLSTIVD
3g60A           KGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGR--TCIVIAHRLSTIQN
3g5uA           KGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGR--TCIVIAHRLSTIQN
2ixfC           TGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER
2ixfA           TGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER
2hydA           GVK-LSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDR--TTLIVAHRLSTITH
1f3oA           FANQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKI-QLLKKLNEEDGKTVVVVTHDINVA-R
2pcjA           KPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKIN-EGGTSIVMVTHERELAEL
2ixeA           TGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER
2ixfD           TGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER
2awnC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
1b0uA           YPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGK-TMVVVTHEMGFARH
2ixeD           GAHDLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER
2onkA           KPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAM
2ixgA           TGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER
3fvqB           YPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQ
3fvqA           YPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQ
3bk7A           NVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDY
1z47B           FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALE
1z47A           FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALE
2ghiA           KGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAV--EDLRKNRTLIIIAHRLSTISS
2d62A           KPRELSGGQRQRVALGRAIIRRPKV-FLDEPLSNLDAKLRVKRAELKKLQRQ-LGVTTIYVTH--DQVEA
2qi9C           STNQLSGGEWQRVRLAAVVANPAGQLLLLDEPNSLDVAQQSALDKILSALSQQGLAIVS--SHDLNHTLR
1v43A           YPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMT
2nq2D           EFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVA
1l7vC           STNQLSGGEWQRVRLAAVVANPAGQLLLLDEPNSLDVAQQSALDKILSALCQQGLAIVS--SHDLNHTLR
2ghiC           IVGGMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAV--EDLRKNRTLIIIAHRLSTISS
1z2rA           GLDTIIGENGVLLSXXXXXXXDSPILILDEATSALDTESERAIQAAL--DELQKNRTSLVIAHRL-----
1vplA           VST-YSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQE-GLTILVSSHNMLEVEF
1yqtA           EVNELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEK-TALVVEHDV-----
2cbzA           GV-NLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQ
2nq2C           EFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVA
2ghiB           NKMKLSGGERQRIAIARCLLKDPKIVIFDEATS-------------------------------------
3gfoA           PTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXXXXXXXXXXVPL
2bbtB           AEKDLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
3b60A           GLDTIIGENGVLLSXXXXXXXDSPILILDEATSALDTESERAIQAAL--DELQKNRTSLVIAHRL-----
1xmiB           IVLTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2awnA           RVNQVA----EVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2pzfB           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2pzgA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2pzfA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2pzeB           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2pzeA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1xmiE           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1xmiC           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1xmiA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1oxvA           FPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFA
1oxsC           FPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFA
2bbsA           AEKDLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2pzgB           DGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2bbtA           AEKDLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
2bbsB           AEKDLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1ji0A           LGGTLSGGE-QQLAIGRALSRPK---LLDEPSLGLAPILVSEVFEVIQKINQEGT-TILLVEQNALGALK
2yz2B           VPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGK-TVILISHDIETVIN
2yz2A           VPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGK-TVILISHDIETVIN
1xmiD           GEITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1g6hA           KAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLN
2bboA           GGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1xmjA           GGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKK
1gajA           KAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLN
1g9xA           KAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLN
2ghiD           DTIVLSGGERQRIAIARCLLKDPKIVIFDDSKT-----------EYLFQKAVEDNRTLIIIAHRLSTISS
2ix3A           SRRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALK----EFEGGVIIITHSAEFTKN
2iwhB           SRRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALK----EFEGGVIIITHSAEFTKN
2d2eA           DSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLD-IDALKVVARGVNAMRGPNFGALVITHYQRILNY
1r10A           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0zD           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0zC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0zB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0zA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0xD           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0xC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0xB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0xA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0wC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0wB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1r0wA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1q3hD           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1q3hC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1q3hB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1q3hA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1xfaA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1xf9D           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1xf9C           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1xf9B           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
1xf9A           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRIL-VTSKMEHLRK
2ix8A           SRRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALK----EFEGGVIIITHSAEFTKN
2iw3B           SRRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALK----EFEGGVIIITHSAEFTKN
2iw3A           SRRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALK----EFEGGVIIITHSAEFTKN
2ihyA           ----LSTGEKQRV-IARALGQP-QVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITA
2d2fA           YLNEFSGGEKKRNEILQLLVLEPTYAVLDETDSGLD-IDALKVVARGVNAMRGPNFGALVITHYQRILNY
2ihyB           YIGYLSTGEKQRV-IARALGQP-QVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITA
2pjzA           KLYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG----ILVTHELDMLNL
1sgwA           KLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEK----------------
2zu0C           SVNGFSGGEKKRNDILQMAVLEPELCILDESDSGLD-IDALKVVADGVNSLRDGKRSFIIVTHYQRILDY
2d3wA           SVNGFSGGEKKRNDILQMAVLEPELCILDESDSGLD-IDALKVVADGVNSLRDGKRSFIIVTHYQRILDY
1oxxK           FPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFA
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2d3wC           SVNGFSGGEKKRNDILQMAVLEPELCILDE----SDDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDY
2d3wD           SVNGFSGGEKKRNDILQMAVLEPELCILDE-SDGLD-IDALKVVADGVNSLRDGKRSFIIVTHYQRILDY
2d3wB           SVNGFSGGEKKRNDILQMAVLEPELCILDE-SDSLD-IDALKVVADGVNSLRDGKRSFIIVTH-------
1e69A           KLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIV--ITHN------
2zzzA           ----------------------------------------------------------------------
2zzyA           ----------------------------------------------------------------------
1ex7A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2vf8B           PATELSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQQLVKLVDAGN--TVIAVEHKMQV---
2vf8A           PATELSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQQLVKLVDAGN--TVIAVEHKMQV---
2vf7C           PATELSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQQLVKLVDAGN--TVIAVEHKMQV---
2vf7B           PATELSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQQLVKLVDAGN--TVIAVEHKMQV---
2vf7A           PATELSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQQLVKLVDAGN--TVIAVEHKMQV---
2r6fB           PATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRL-VDNGDTVLVIEHNLDVIK-
2r6fA           PATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRL-VDNGDTVLVIEHNLDVIK-
2awoD           -----------------------SVFLLDE---PLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
2awnD           -----------------------SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT


                         .         .         .         +         .         .         .:280
query           IADTIWFMADGRLLEIAETDTFFSAPQHEAAKEFLKGGTR
3dhwC           ICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQ----
3d31A           MADRIAVVMDGKLIQVGKPEEIFEKPVEGRVASFV-----
2oukB           VGDRVLFMDGGYIIEEGKPEDLFDRPQHERTKAFL-----
2oljA           VGDRVLFMDGGYIIEEGKPEDLFDRPQHERTKAFL-----
1mt0A           -ADRIIVMEKGKIVE-------------------------
2ff7A           -ADRIIVMEKGKIVE-------------------------
2fgkA           -ADRIIVMEKGKIVE-------------------------
2ffbA           -ADRIIVMEKGKIVE-------------------------
3b5jA           -ADRIIVMEKGKIVE-------------------------
2it1B           MADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL-----
2it1A           MADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL-----
1xefA           -ADRIIVMEKGKIVE-------------------------
2ffaA           -ADRIIVMEKGKIVE-------------------------
1l2tB           FGERIIYLKDGEV---------------------------
1l2tA           FGERIIYLKDGEV---------------------------
1pf4A           -ADEILVVDEGEIIE-------------------------
1q12A           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
1jj7A           -ADHILFLEGGAIRE-------------------------
3fh6A           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2awoA           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2awnB           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2r6gB           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2r6gA           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2yyzA           MASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFI-----
1g291           MGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFI-----
2awoC           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
1mv5D           -ADKIYFIEKGQI---------------------------
1mv5A           -ADKIYFIEKGQI---------------------------
3g60A           -ADLIVVIQNGKVKE-------------------------
3g5uA           -ADLIVVIQNGKVKE-------------------------
2ixfC           -AHHILFLKEGSVCE-------------------------
2ixfA           -AHHILFLKEGSVCE-------------------------
2hydA           -ADKIVVIENGHIVE-------------------------
1f3oA           FGERIIYLKDGEV---------------------------
2pcjA           THRTL-EMKDGKVV--------------------------
2ixeA           -AHHILFLKEGSVCE-------------------------
2ixfD           -AHHILFLKEGSVCE-------------------------
2awnC           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
1b0uA           VSSHVIFLHQGKIEEEGDPEQVFGNPQSPRLQQFLKGSLK
2ixeD           -AHHILFLKEGSVCE-------------------------
2onkA           LADEVAVMLNGRIVEKGKLKELFSAKNGEVA-EFL-----
2ixgA           -AHHILFLKEGSVCE-------------------------
3fvqB           YADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEG--
3fvqA           YADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEG--
3bk7A           VSDRL-----------------------------------
1z47B           VADRVLVLHEGNVEQFGTPEEVYEKP--------------
1z47A           VADRVLVLHEGNVEQFGTPEEVYEKP--------------
2ghiA           -AESIILLNKGKIVE-------------------------
2d62A           TGDRI-AVNKGELQQVGTPDEVYYKPVNTFVAGFI-----
2qi9C           HAHRAWLLKGGKL---------------------------
1v43A           MGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFI-----
2nq2D           IAN-------------------------------------
1l7vC           HAHRAWLLKGGKL---------------------------
2ghiC           -AESIILLNKGKIVE-------------------------
1z2rA           ----------------------------------------
1vplA           LCDRIALIHNGTIVE-------------------------
1yqtA           ----------------------------------------
2cbzA           V-DVIIVMSGGKISEMGSYQELLA--RDGAFAEFLR----
2nq2C           IAN-------------------------------------
2ghiB           ----------------------------------------
3gfoA           YCDNVFVMKEGRVI--------------------------
2bbtB           -ADKILILHEG-----------------------------
3b60A           ----------------------------------------
1xmiB           -ADKILILHEG-----------------------------
2awnA           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2pzfB           -ADKILILHEG-----------------------------
2pzgA           -ADKILILHEG-----------------------------
2pzfA           -ADKILILHEG-----------------------------
2pzeB           -ADKILILHEG-----------------------------
2pzeA           -ADKILILHEG-----------------------------
1xmiE           -ADKILILHEG-----------------------------
1xmiC           -ADKILILHEG-----------------------------
1xmiA           -ADKILILHEG-----------------------------
1oxvA           IAD-------------------------------------
1oxsC           IAD-------------------------------------
2bbsA           -ADKILILHEG-----------------------------
2pzgB           -ADKILILHEG-----------------------------
2bbtA           -ADKILILHEG-----------------------------
2bbsB           -ADKILILHEG-----------------------------
1ji0A           VAHYGYVLETGQIV--------------------------
2yz2B           HVDRVVVLEKGK----------------------------
2yz2A           HVDRVVVLEKGK----------------------------
1xmiD           -ADKILILHEG-----------------------------
1g6hA           YIDHLYVMFNGQII--------------------------
2bboA           -ADKILILHEG-----------------------------
1xmjA           -ADKILILHEG-----------------------------
1gajA           YIDHLYVMFNGQII--------------------------
1g9xA           YIDHLYVMFNGQII--------------------------
2ghiD           -AESIILLNKGKIVE-------------------------
2ix3A           LTEEVWAVKDGRM---------------------------
2iwhB           LTEEVWAVKDGRM---------------------------
2d2eA           IPDKVHVMMDGRVV--------------------------
1r10A           -ADKILILHQG-----------------------------
1r0zD           -ADKILILHQG-----------------------------
1r0zC           -ADKILILHQG-----------------------------
1r0zB           -ADKILILHQG-----------------------------
1r0zA           -ADKILILHQG-----------------------------
1r0xD           -ADKILILHQG-----------------------------
1r0xC           -ADKILILHQG-----------------------------
1r0xB           -ADKILILHQG-----------------------------
1r0xA           -ADKILILHQG-----------------------------
1r0wC           -ADKILILHQG-----------------------------
1r0wB           -ADKILILHQG-----------------------------
1r0wA           -ADKILILHQG-----------------------------
1q3hD           -ADKILILHQG-----------------------------
1q3hC           -ADKILILHQG-----------------------------
1q3hB           -ADKILILHQG-----------------------------
1q3hA           -ADKILILHQG-----------------------------
1xfaA           -ADKILILHQG-----------------------------
1xf9D           -ADKILILHQG-----------------------------
1xf9C           -ADKILILHQG-----------------------------
1xf9B           -ADKILILHQG-----------------------------
1xf9A           -ADKILILHQG-----------------------------
2ix8A           LTEEVWAVKDGR----------------------------
2iw3B           LTEEVWAVKDGR----------------------------
2iw3A           LTEEVWAVKDGR----------------------------
2ihyA           NFSKILLLKDGQSIQ-------------------------
2d2fA           IPDKVHVMMDGRVV--------------------------
2ihyB           NFSKILLLKDGQSIQ-------------------------
2pjzA           YKEKAYFLVGNRL---------------------------
1sgwA           ----------------------------------------
2zu0C           IPDYVHVLYQGRIVK-------------------------
2d3wA           IPDYVHVLYQGRIVK-------------------------
1oxxK           IAD-------------------------------------
2awoD           ----------------------------------------
2awnD           ----------------------------------------
2d3wC           IPDYVHVLYQGRIVK-------------------------
2d3wD           IPDYVHVLYQGRIVK-------------------------
2d3wB           ----------------------------------------
1e69A           ----------------------------------------
2zzzA           ----------------------------------------
2zzyA           ----------------------------------------
1ex7A           ----------------------------------------
3a00B           ----------------------------------------
3a00A           ----------------------------------------
2vf8B           VAASDWLVAQGTPAEVAQAAGSVTAPYLRAA---------
2vf8A           VAASDWLVAQGTPAEVAQAAGSVTAPYLRAA---------
2vf7C           VAASDWLVAQGTPAEVAQAAGSVTAPYLRAA---------
2vf7B           VAASDWLVAQGTPAEVAQAAGSVTAPYLRAA---------
2vf7A           VAASDWLVAQGTPAEVAQAAGSVTAPYLRAA---------
2r6fB           ----------------------------------------
2r6fA           ----------------------------------------
2awoD           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
2awnD           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----