[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:murE

[Show Plain Result]

#ERROR : Can't open dsspfile "1e8cB.bssp"
#ERROR : Can't open dsspfile "1e8cA.bssp"
#ERROR : Can't open dsspfile "1gg4A.bssp"
#ERROR : Can't open dsspfile "1j6uA.bssp"
#ERROR : Can't open dsspfile "2am1A.bssp"
#ERROR : Can't open dsspfile "1o5zA.bssp"
#ERROR : Can't open dsspfile "1gqyB.bssp"
#ERROR : Can't open dsspfile "2f00B.bssp"
#ERROR : Can't open dsspfile "2f00A.bssp"
#ERROR : Can't open dsspfile "2vorA.bssp"

## Summary of PDB Search
:494
    4e-56  35%  1e8cB  [c.98.1 - c.72.2 - c.59.1]
    4e-56  35%  1e8cA  [c.98.1 - c.72.2 - c.59.1]
    1e-17  30%  1gg4A  [c.98.1 - c.72.2 - c.59.1]
    5e-16  34%  1j6uA  [c.5.1 - c.72.2 - c.59.1] UDP-N-ACETYLMURAMATE-ALANINE LIGASE
    6e-15  26%  2am1A  [x.x.x] UDP-N-ACETYLMURAMOYLALANINE-D-GLUTAMYL-LYSINE-D-
    1e-09  26%  1o5zA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE
    9e-08  22%  1gqyB  [c.5.1 - c.72.2 - c.59.1] UDP-N-ACETYLMURAMATE-L-ALANINE
    1e-06  26%  2f00B  [x.x.x] UDP-N-ACETYLMURAMATE--L-ALANINE LIGASE
    1e-06  26%  2f00A  [x.x.x] UDP-N-ACETYLMURAMATE--L-ALANINE LIGASE
    7e-06  45%  2vorA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
:494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
1e8cB           ----------------------------LDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
1e8cA           ----------------------------LDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
1gg4A           --------------------DITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAGGAGALLVSRP
1j6uA           ----------------------------------------------------------------------
2am1A           -------------------EDTQLEKAEFDSRLIGTGDLFVPLKGAR-DGHDFIETAFENGAAVTLSEKE
1o5zA           ----------------------------------------------------------------------
1gqyB           -------------------------------------------------GH--AEEHIE-GASVVVVSSA
2f00B           ----------------------------------------------------------------------
2f00A           ----------------------------------------------------------------------
2vorA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
1e8cB           DEATVPVIYLSQLNERLSALAGRFYHEPSDNLRLXXXXXXXXXXXXXQLLAQWSQLLGEISA-VGTVGNG
1e8cA           DEATVPVIYLSQLNERLSALAGRFYHEPSDNLRLXXXXXXXXXXXXXQLLAQWSQLLGEISA-VGTVGNG
1gg4A           LDIDLPQLIVKDTRLAFGEL--AAWVRQQVPARVVALTGSSGKTSVKETA-AILSQCGNTLYTAGNLNND
1j6uA           ----------------------------------------------------------------------
2am1A           VS-NHPYILVDDVLTAFQSLASYYLEKTT--VDVFAVTGSNGKTTTKDLAH-----------LLSTRY--
1o5zA           ---------VKPGLERISMLLSKL-GNPHLEYKTIHIGGTNGKGSVANMVSNILVSQGYRVGSYYSPHLK
1gqyB           IKDDNPELVTSKQKRIPVIQRAQMLAEIMRFRHGIAVAGTHGKTTTTAMISMIYTQAKLDPTFVNGGLVK
2f00B           ----------------------------------------------------------------------
2f00A           ----------------------------------------------------------------------
2vorA           ----------RPSLTRISALMDLL-GSPQRSYPSIHIAGTNGKTSVARMVDALVTALHRRTG--------


                         +         .         .         .         .         *         .:210
query           IGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSHALSLGRVHGCDYDIAVFTNLTQDHLDYHKT
1e8cB           LLGKVIPTENTTGSAVDVQHELAGLVDQGA-TFCAEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHG-
1e8cA           LLGKVIPTENTTGSAVDVQHELAGLVDQGA-TFCAEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHG-
1gg4A           IGVPTL--LRLTPE---------------YDYAVIE-------LGANH--QGEIAWTVSLTRPEVNNLAS
1j6uA           -------------------------------------------------------IITNARGDHLEYGNS
2am1A           ---KTYKTQGNYNNEIGLPYTV--LHPEGTEKLVLEGQDH---LGDIHLLSEKTAIVTLVGEAHLAFFKD
1o5zA           IYETMEPILNELDKEVVTAMAFLYFAEKNVDIAVLEVGLG----GRLDATNVVFPLCSTIVT--VDRY-T
1gqyB           SAGKNAHLGAS----------------RYLIAEADESDASFLHLQPM------VSVVTNMEPDHMDTYEG
2f00B           -----------------------------------------------------VAIVTNIEADHDTYQ--
2f00A           -----------------------------------------------------VAIVTNIEADHDTYQ--
2vorA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDEYRHAKSLLFSQLGGAFNHEHPKRAVLNADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGT
1e8cB           -DEHYEAAWLLYSE-------HHCGQAIINADDEVGRRWKLPDAVAVSEDHINPNCHLKATEVNYHDSGA
1e8cA           -DEHYEAAWLLYSE-------HHCGQAIINADDEVGRRWKLPDAVAVSEDHINPNCHLKATEVNYHDSGA
1gg4A           LAGVAKAKGEIFSGL--------PENGIINADNNDWLNWQSVIGSRKVWRFSPNNSDFTATNIHVTSHGT
1j6uA           LTRYRSA----FEKIS-----RNTDLVVTFAEDELTSHLGDVT------FGVKKGTYTLERSASRAEQKA
2am1A           RSEIAKGKQIADGASGSLL--------LAPADPIVEDYLP------IDKKVVRFGQGAELEITDLVERKD
1o5zA           IEQIAWEKSGIIKERVPLVTGERKREALKVMEDVARKKSSRM-------YVIDKDFSVKVKSLKL--HEN
1gqyB           DFEKMKATYVKF-----LHNLPFYGLAVMCADDPVLMELVPKVGRQVITYGFSEQADYRIEDYEQTGQGH
2f00B           -GDFENLKQTFIN-----FLHNLPGRAVCVDDPVIRELLPRV-GRQTTTYGFSEDADVRVEDYQQIGPQG
2f00A           -GDFENLKQTFIN-----FLHNLPGRAVCVDDPVIRELLPRV-GRQTTTYGFSEDADVRVEDYQQIGPQG
2vorA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SFDLVTNKGTKHITMSLVGQFNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIV
1e8cB           TIRFSSSWGDGEIESHL-GAFNVSNXXXXXXXXXXXXXXXXXXXKTAARLQPVCGR-EVFTAPGKPTVVV
1e8cA           TIRFSSSWGDGEIESHL-GAFNVSNXXXXXXXXXXXXXXXXXXXKTAARLQPVCGR-EVFTAPGKPTVVV
1gg4A           EFTLQTPTGSVDVLLPLPGRHNIXXXXXXXXXS-SVGATLDAIKAGLANLKAVPGR--------------
1j6uA           ----VEKNGKRYLELKLKGFHNVLNALAVIALFDSLGYDLAPVLEALEEFRGVHRRFSIAFHDPETNIYV
2am1A           SLTFKANFLEQALDLPVTGKYNATNAIASY-VALQEGVSEEQIRLAFQHLELTRNRTEWKKAANGADILS
1o5zA           RFDYCGENTFEDLVLTMNGPHQIENAGVALKTLEATGLPLKAIREGLKNAKNL-GRFEILEKNGKM-YIL
1gqyB           YTVICPNNERINVLLNVPGKHXXXXXXXXXXXXKEEGIANEAILEALADFQGAGRRFEFIRPNGKVRLVD
2f00B           HFTLLRQDKEPRVTLNAPGRHXXXXXXXXXXXXTEEGIDDEAILRALESFQGTGRRFEPVNGKSGTALVD
2f00A           HFTLLRQDKEPRVTLNAPGRHXXXXXXXXXXXXTEEGIDDEAILRALESFQGTGRRFEPVNGKSGTALVD
2vorA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DYAHTPDSLENVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
1e8cB           DYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRP-LGAIAEEFADVAVVTDDNPRTEEPRAIIN
1e8cA           DYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRP-LGAIAEEFADVAVVTDDNPRTEEPRAIIN
1gg4A           ----------------------------------------------------------------------
1j6uA           DYAHTPDEIRNLLQTAKEVFENEKIVVI------FQPHRGNFAK-ALQLADEVVVT--------------
2am1A           DVYNANPTAKLILET-------------------------------------------------------
1o5zA           DGAHNPHGAESLVRSLKLYFNGELSLVIGILDDKNR----------------------------------
1gqyB           DYGHHPTEVGVTIKAAREGWGDKRIVMI------------------------------------------
2f00B           DYGHHPTEVDATIKAAR-----------------------------------------------------
2f00A           DYGHHPTEVDATIKAAR-----------------------------------------------------
2vorA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVAARAIxxxxxx
1e8cB           DILAGLD-AGHAKVEGRAEAVTCAV-QAKENDVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLL------
1e8cA           DILAGLD-AGHAKVEGRAEAVTCAV-QAKENDVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLL------
1gg4A           ----------------------------------------------------------------------
1j6uA           ----------------------------------------------------------------------
2am1A           ----------------------------------------------------------------------
1o5zA           ----------------------------------------------------------------------
1gqyB           ----------------------------------------------------------------------
2f00B           ----------------------------------------------------------------------
2f00A           ----------------------------------------------------------------------
2vorA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
1e8cB           ----
1e8cA           ----
1gg4A           ----
1j6uA           ----
2am1A           ----
1o5zA           ----
1gqyB           ----
2f00B           ----
2f00A           ----
2vorA           ----