[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:aprX

[Show Plain Result]

#ERROR : Can't open dsspfile "1y4dE.bssp"
#ERROR : Can't open dsspfile "1supA.bssp"
#ERROR : Can't open dsspfile "2sniE.bssp"
#ERROR : Can't open dsspfile "1s02A.bssp"
#ERROR : Can't open dsspfile "1lw6E.bssp"
#ERROR : Can't open dsspfile "1suaA.bssp"
#ERROR : Can't open dsspfile "1sueA.bssp"
#ERROR : Can't open dsspfile "1sbiA.bssp"
#ERROR : Can't open dsspfile "1s01A.bssp"
#ERROR : Can't open dsspfile "1sbtA.bssp"
#ERROR : Can't open dsspfile "1subA.bssp"
#ERROR : Can't open dsspfile "1spbS.bssp"
#ERROR : Can't open dsspfile "1v5iA.bssp"
#ERROR : Can't open dsspfile "1duiA.bssp"
#ERROR : Can't open dsspfile "1sbhA.bssp"
#ERROR : Can't open dsspfile "1sudA.bssp"
#ERROR : Can't open dsspfile "1ak9A.bssp"
#ERROR : Can't open dsspfile "1aqnA.bssp"
#ERROR : Can't open dsspfile "1gnvA.bssp"
#ERROR : Can't open dsspfile "1bh6A.bssp"
#ERROR : Can't open dsspfile "1a2qA.bssp"
#ERROR : Can't open dsspfile "1q5pA.bssp"
#ERROR : Can't open dsspfile "1gnsA.bssp"
#ERROR : Can't open dsspfile "1st2A.bssp"
#ERROR : Can't open dsspfile "1st3A.bssp"
#ERROR : Can't open dsspfile "1dbiA.bssp"
#ERROR : Can't open dsspfile "1nduA.bssp"
#ERROR : Can't open dsspfile "1sucA.bssp"
#ERROR : Can't open dsspfile "3f49S.bssp"
#ERROR : Can't open dsspfile "3cnqS.bssp"
#ERROR : Can't open dsspfile "3bgoS.bssp"
#ERROR : Can't open dsspfile "1meeA.bssp"
#ERROR : Can't open dsspfile "2tecE.bssp"
#ERROR : Can't open dsspfile "1scjA.bssp"
#ERROR : Can't open dsspfile "1c9mA.bssp"
#ERROR : Can't open dsspfile "2ixtB.bssp"
#ERROR : Can't open dsspfile "2ixtA.bssp"
#ERROR : Can't open dsspfile "1wsdA.bssp"
#ERROR : Can't open dsspfile "1wmdA.bssp"
#ERROR : Can't open dsspfile "1gciA.bssp"
#ERROR : Can't open dsspfile "1c13A.bssp"
#ERROR : Can't open dsspfile "2gkoA.bssp"
#ERROR : Can't open dsspfile "2zwpB.bssp"
#ERROR : Can't open dsspfile "1c3lA.bssp"
#ERROR : Can't open dsspfile "1ea7A.bssp"
#ERROR : Can't open dsspfile "2zwpA.bssp"
#ERROR : Can't open dsspfile "2zwoC.bssp"
#ERROR : Can't open dsspfile "2zwoB.bssp"
#ERROR : Can't open dsspfile "2zwoA.bssp"
#ERROR : Can't open dsspfile "2z56A.bssp"
#ERROR : Can't open dsspfile "2z30A.bssp"
#ERROR : Can't open dsspfile "2z2zA.bssp"
#ERROR : Can't open dsspfile "2e1pA.bssp"
#ERROR : Can't open dsspfile "3a3nA.bssp"
#ERROR : Can't open dsspfile "1iavA.bssp"
#ERROR : Can't open dsspfile "1cseE.bssp"
#ERROR : Can't open dsspfile "1a1yE.bssp"
#ERROR : Can't open dsspfile "2z2yA.bssp"
#ERROR : Can't open dsspfile "1sh7B.bssp"
#ERROR : Can't open dsspfile "1sh7A.bssp"
#ERROR : Can't open dsspfile "1s2nB.bssp"
#ERROR : Can't open dsspfile "1thmA.bssp"
#ERROR : Can't open dsspfile "3a3pA.bssp"
#ERROR : Can't open dsspfile "1wmfA.bssp"
#ERROR : Can't open dsspfile "2z2xA.bssp"
#ERROR : Can't open dsspfile "1av7A.bssp"
#ERROR : Can't open dsspfile "2b6nA.bssp"
#ERROR : Can't open dsspfile "1r6vA.bssp"
#ERROR : Can't open dsspfile "1c9nA.bssp"
#ERROR : Can't open dsspfile "1c9jA.bssp"
#ERROR : Can't open dsspfile "1ic6A.bssp"
#ERROR : Can't open dsspfile "3dw3X.bssp"
#ERROR : Can't open dsspfile "1ht3A.bssp"
#ERROR : Can't open dsspfile "2w2qA.bssp"
#ERROR : Can't open dsspfile "2w2mA.bssp"
#ERROR : Can't open dsspfile "3gcwA.bssp"
#ERROR : Can't open dsspfile "3bpsA.bssp"
#ERROR : Can't open dsspfile "2w2pA.bssp"
#ERROR : Can't open dsspfile "2w2oA.bssp"
#ERROR : Can't open dsspfile "2w2nA.bssp"
#ERROR : Can't open dsspfile "1r64A.bssp"
#ERROR : Can't open dsspfile "1ot5A.bssp"
#ERROR : Can't open dsspfile "2id4B.bssp"
#ERROR : Can't open dsspfile "2id4A.bssp"
#ERROR : Can't open dsspfile "3eifA.bssp"
#ERROR : Can't open dsspfile "2pmwB.bssp"
#ERROR : Can't open dsspfile "2qtwB.bssp"
#ERROR : Can't open dsspfile "2p4eA.bssp"
#ERROR : Can't open dsspfile "3h42B.bssp"
#ERROR : Can't open dsspfile "1xf1A.bssp"
#ERROR : Can't open dsspfile "1p8jH.bssp"
#ERROR : Can't open dsspfile "1p8jF.bssp"
#ERROR : Can't open dsspfile "1p8jC.bssp"
#ERROR : Can't open dsspfile "1p8jB.bssp"
#ERROR : Can't open dsspfile "1p8jA.bssp"
#ERROR : Can't open dsspfile "1v6cB.bssp"
#ERROR : Can't open dsspfile "1v6cA.bssp"
#ERROR : Can't open dsspfile "2iy9A.bssp"

## Summary of PDB Search
:442
    7e-33  42%  1y4dE  [x.x.x] SUBTILISIN BPN'
    7e-33  42%  1supA  [c.41.1 (1sbnE)] SUBTILISIN BPN'
    7e-33  42%  2sniE  [c.41.1] SUBTILISIN NOVO
    7e-33  42%  1s02A  [x.x.x] SUBTILISIN BPN'
    1e-32  42%  1lw6E  [c.41.1] SUBTILISIN BPN'
    5e-32  43%  1suaA  [c.41.1] SUBTILISIN BPN'
    6e-32  43%  1sueA  [x.x.x] SUBTILISIN BPN'
    1e-31  41%  1sbiA  [x.x.x] SUBTILISIN 8397
    1e-31  41%  1s01A  [x.x.x] SUBTILISIN BPN'
    2e-31  41%  1sbtA  [x.x.x] SUBTILISIN BPN'
    2e-31  42%  1subA  [x.x.x] SUBTILISIN BPN' CRB-S3
    4e-31  42%  1spbS  [c.41.1] SUBTILISIN BPN'
    5e-31  41%  1v5iA  [c.41.1 (1ubnA)] SUBTILISIN BPN'
    5e-31  42%  1duiA  [c.41.1] PROTEIN (SUBTILISIN BPN')
    7e-31  41%  1sbhA  [x.x.x] SUBTILISIN 8397+1
    9e-31  41%  1sudA  [x.x.x] SUBTILISIN BPN' CRB-S3
    9e-31  41%  1ak9A  [x.x.x] SUBTILISIN 8321
    2e-30  41%  1aqnA  [x.x.x] SUBTILISIN 8324
    4e-30  43%  1gnvA  [c.41.1] SUBTILISIN BPN'
    1e-29  39%  1bh6A  [c.41.1] SUBTILISIN DY
    2e-29  41%  1a2qA  [x.x.x] SUBTILISIN BPN'
    3e-29  40%  1q5pA  [c.41.1] SERINE PROTEASE
    4e-29  43%  1gnsA  [c.41.1] SUBTILISIN BPN'
    1e-28  41%  1st2A  [x.x.x] SUBTILISIN BPN'
    7e-28  39%  1st3A  [x.x.x] SUBTILISIN BL
    5e-27  38%  1dbiA  [c.41.1] AK.1 SERINE PROTEASE
    7e-26  38%  1nduA  [c.41.1] SUBTILISIN SAVINASE
    3e-25  41%  1sucA  [x.x.x] SUBTILISIN BPN' CRB-S3
    6e-25  39%  3f49S  [x.x.x] SUBTILISIN BPN'
    1e-24  39%  3cnqS  [x.x.x] SUBTILISIN BPN'
    1e-24  39%  3bgoS  [x.x.x] SUBTILISIN BPN'
    2e-24  38%  1meeA  [c.41.1] MESENTERICOPEPTIDASE
    1e-23  34%  2tecE  [c.41.1] THERMITASE
    1e-23  37%  1scjA  [c.41.1] SUBTILISIN E
    2e-23  38%  1c9mA  [c.41.1] SERINE PROTEASE
    2e-23  35%  2ixtB  [x.x.x] 36KDA PROTEASE
    2e-23  35%  2ixtA  [x.x.x] 36KDA PROTEASE
    4e-23  36%  1wsdA  [c.41.1] M-PROTEASE
    4e-23  36%  1wmdA  [c.41.1 - b.18.1] PROTEASE
    9e-23  36%  1gciA  [c.41.1 (1ndqA)] SUBTILISIN
    9e-23  36%  1c13A  [x.x.x] SUBTILISIN
    3e-22  38%  2gkoA  [x.x.x] MICROBIAL SERINE PROTEINASES SUBTILISIN
    4e-22  41%  2zwpB  [x.x.x] TK-SUBTILISIN
    1e-21  36%  1c3lA  [c.41.1] SUBTILISIN-CARLSBERG
    2e-21  35%  1ea7A  [c.41.1] SERINE PROTEASE
    5e-21  39%  2zwpA  [x.x.x] TK-SUBTILISIN
    5e-21  39%  2zwoC  [x.x.x] TK-SUBTILISIN
    5e-21  39%  2zwoB  [x.x.x] TK-SUBTILISIN
    5e-21  39%  2zwoA  [x.x.x] TK-SUBTILISIN
    5e-21  39%  2z56A  [x.x.x] TK-SUBTILISIN
    5e-21  39%  2z30A  [x.x.x] TK-SUBTILISIN
    5e-21  39%  2z2zA  [x.x.x] TK-SUBTILISIN PRECURSOR
    5e-21  39%  2e1pA  [x.x.x] TK-SUBTILISIN
    5e-21  39%  3a3nA  [x.x.x] TK-SUBTILISIN
    6e-21  36%  1iavA  [c.41.1] SUBTILISIN SAVINASE
    6e-21  35%  1cseE  [c.41.1] SUBTILISIN CARLSBERG
    6e-21  35%  1a1yE  [x.x.x] ALCALASE
    8e-21  39%  2z2yA  [x.x.x] TK-SUBTILISIN
    1e-20  43%  1sh7B  [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE
    1e-20  43%  1sh7A  [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE
    1e-20  43%  1s2nB  [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE
    2e-20  32%  1thmA  [x.x.x] THERMITASE
    2e-20  39%  3a3pA  [x.x.x] TK-SUBTILISIN
    1e-19  35%  1wmfA  [c.41.1 - b.18.1] PROTEASE
    2e-19  39%  2z2xA  [x.x.x] TK-SUBTILISIN
    5e-19  35%  1av7A  [c.41.1 (1selA)] SUBTILISIN CARLSBERG, TYPE VIII
    3e-17  36%  2b6nA  [x.x.x] PROTEINASE K
    6e-16  33%  1r6vA  [c.41.1] SUBTILISIN-LIKE SERINE PROTEASE
    1e-13  45%  1c9nA  [c.41.1] SERINE PROTEASE
    1e-13  45%  1c9jA  [c.41.1] SERINE PROTEASE
    2e-12  55%  1ic6A  [c.41.1] PROTEINASE K
    2e-12  55%  3dw3X  [c.41.1 (1bjrE)] PROTEINASE K
    7e-12  54%  1ht3A  [c.41.1] PROTEINASE K
    3e-11  31%  2w2qA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    3e-11  31%  2w2mA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    3e-11  31%  3gcwA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    3e-11  31%  3bpsA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    4e-11  31%  2w2pA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    5e-11  31%  2w2oA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    5e-11  31%  2w2nA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    5e-11  30%  1r64A  [c.41.1 - b.18.1] KEXIN
    5e-11  30%  1ot5A  [c.41.1 - b.18.1] KEXIN
    5e-11  30%  2id4B  [x.x.x] KEXIN
    5e-11  30%  2id4A  [x.x.x] KEXIN
    2e-10  45%  3eifA  [x.x.x] C5A PEPTIDASE
    2e-10  30%  2pmwB  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    3e-10  31%  2qtwB  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    3e-10  30%  2p4eA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    4e-09  30%  3h42B  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    7e-07  49%  1xf1A  [x.x.x] C5A PEPTIDASE
    7e-07  32%  1p8jH  [c.41.1 - b.18.1] FURIN PRECURSOR
    7e-07  32%  1p8jF  [c.41.1 - b.18.1] FURIN PRECURSOR
    7e-07  32%  1p8jC  [c.41.1 - b.18.1] FURIN PRECURSOR
    7e-07  32%  1p8jB  [c.41.1 - b.18.1] FURIN PRECURSOR
    7e-07  32%  1p8jA  [c.41.1 - b.18.1] FURIN PRECURSOR
    2e-05  30%  1v6cB  [c.41.1] ALKALINE SERINE PROTEASE
    2e-05  30%  1v6cA  [c.41.1] ALKALINE SERINE PROTEASE
    0.001  30%  2iy9A  [x.x.x] SUBA
:442

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1y4dE           ----------------------------------------------------------------------
1supA           ----------------------------------------------------------------------
2sniE           ----------------------------------------------------------------------
1s02A           ----------------------------------------------------------------------
1lw6E           ----------------------------------------------------------------------
1suaA           ----------------------------------------------------------------------
1sueA           ----------------------------------------------------------------------
1sbiA           ----------------------------------------------------------------------
1s01A           ----------------------------------------------------------------------
1sbtA           ----------------------------------------------------------------------
1subA           ----------------------------------------------------------------------
1spbS           ----------------------------------------------------------------------
1v5iA           ----------------------------------------------------------------------
1duiA           ----------------------------------------------------------------------
1sbhA           ----------------------------------------------------------------------
1sudA           ----------------------------------------------------------------------
1ak9A           ----------------------------------------------------------------------
1aqnA           ----------------------------------------------------------------------
1gnvA           ----------------------------------------------------------------------
1bh6A           ----------------------------------------------------------------------
1a2qA           ----------------------------------------------------------------------
1q5pA           ----------------------------------------------------------------------
1gnsA           ----------------------------------------------------------------------
1st2A           ----------------------------------------------------------------------
1st3A           ----------------------------------------------------------------------
1dbiA           ----------------------------------------------------------------------
1nduA           ----------------------------------------------------------------------
1sucA           ----------------------------------------------------------------------
3f49S           ----------------------------------------------------------------------
3cnqS           ----------------------------------------------------------------------
3bgoS           ----------------------------------------------------------------------
1meeA           ----------------------------------------------------------------------
2tecE           ----------------------------------------------------------------------
1scjA           ----------------------------------------------------------------------
1c9mA           ----------------------------------------------------------------------
2ixtB           ----------------------------------------------------------------------
2ixtA           ----------------------------------------------------------------------
1wsdA           ----------------------------------------------------------------------
1wmdA           ----------------------------------------------------------------------
1gciA           ----------------------------------------------------------------------
1c13A           ----------------------------------------------------------------------
2gkoA           ----------------------------------------------------------------------
2zwpB           ----------------------------------------------------------------------
1c3lA           ----------------------------------------------------------------------
1ea7A           ----------------------------------------------------------------------
2zwpA           ----------------------------------------------------------------------
2zwoC           ----------------------------------------------------------------------
2zwoB           ----------------------------------------------------------------------
2zwoA           ----------------------------------------------------------------------
2z56A           ----------------------------------------------------------------------
2z30A           ----------------------------------------------------------------------
2z2zA           ----------------------------------------------------------------------
2e1pA           ----------------------------------------------------------------------
3a3nA           ----------------------------------------------------------------------
1iavA           ----------------------------------------------------------------------
1cseE           ----------------------------------------------------------------------
1a1yE           ----------------------------------------------------------------------
2z2yA           ----------------------------------------------------------------------
1sh7B           ----------------------------------------------------------------------
1sh7A           ----------------------------------------------------------------------
1s2nB           ----------------------------------------------------------------------
1thmA           ----------------------------------------------------------------------
3a3pA           ----------------------------------------------------------------------
1wmfA           ----------------------------------------------------------------------
2z2xA           ----------------------------------------------------------------------
1av7A           ----------------------------------------------------------------------
2b6nA           ----------------------------------------------------------------------
1r6vA           ----------------------------------------------------------------------
1c9nA           ----------------------------------------------------------------------
1c9jA           ----------------------------------------------------------------------
1ic6A           ----------------------------------------------------------------------
3dw3X           ----------------------------------------------------------------------
1ht3A           ----------------------------------------------------------------------
2w2qA           ----------------------------------------------------------------------
2w2mA           ----------------------------------------------------------------------
3gcwA           ----------------------------------------------------------------------
3bpsA           ----------------------------------------------------------------------
2w2pA           ----------------------------------------------------------------------
2w2oA           ----------------------------------------------------------------------
2w2nA           ----------------------------------------------------------------------
1r64A           ----------------------------------------------------------------------
1ot5A           ----------------------------------------------------------------------
2id4B           ----------------------------------------------------------------------
2id4A           ----------------------------------------------------------------------
3eifA           ----------------------------------------------------------------------
2pmwB           ----------------------------------------------------------------------
2qtwB           ----------------------------------------------------------------------
2p4eA           ----------------------------------------------------------------------
3h42B           ----------------------------------------------------------------------
1xf1A           ----------------------------------------------------------------------
1p8jH           ----------------------------------------------------------------------
1p8jF           ----------------------------------------------------------------------
1p8jC           ----------------------------------------------------------------------
1p8jB           ----------------------------------------------------------------------
1p8jA           ----------------------------------------------------------------------
1v6cB           ----------------------------------------------------------------------
1v6cA           ----------------------------------------------------------------------
2iy9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHAKEVVRN
1y4dE           -------------------------------------------------------------SQIKAPALH
1supA           -------------------------------------------------------------SQIKAPALH
2sniE           -------------------------------------------------------------SQIKAPALH
1s02A           -------------------------------------------------------------SQIKAPALH
1lw6E           -------------------------------------------------------------SQIKAPALH
1suaA           -------------------------------------------------------------SQIKAPALH
1sueA           -------------------------------------------------------------SQIKAPALH
1sbiA           -------------------------------------------------------------SQIKAPALH
1s01A           -------------------------------------------------------------SQIKAPALH
1sbtA           -------------------------------------------------------------SQIKAPALH
1subA           -------------------------------------------------------------SQIKAPALH
1spbS           -------------------------------------------------------------SQIKAPALH
1v5iA           -------------------------------------------------------------SQIKAPALH
1duiA           -------------------------------------------------------------SQIKAPALH
1sbhA           -------------------------------------------------------------SQIKAPALH
1sudA           -------------------------------------------------------------SQIKAPALH
1ak9A           -------------------------------------------------------------SQIKAPALH
1aqnA           -------------------------------------------------------------SQIKAPALH
1gnvA           -------------------------------------------------------------SQIKAPALH
1bh6A           ----------------------------------------------------------------------
1a2qA           -------------------------------------------------------------SQIKAPALH
1q5pA           -------------------------------------------------------------SRVQAPAAH
1gnsA           -------------------------------------------------------------SQIKAPALH
1st2A           -------------------------------------------------------------SQIKAPALH
1st3A           -------------------------------------------------------------SRVQAPAAH
1dbiA           ----------------------------------------------------------------------
1nduA           -------------------------------------------------------------SRVQAPAAH
1sucA           -------------------------------------------------------------SQIKAPALH
3f49S           ---------------------------------------------------------------------H
3cnqS           ---------------------------------------------------------------------H
3bgoS           ---------------------------------------------------------------------H
1meeA           -------------------------------------------------------------SQIKAPALH
2tecE           ----------------------------------------------------------------------
1scjA           -------------------------------------------------------------SQIKAPALH
1c9mA           -------------------------------------------------------------SRVQAPAAH
2ixtB           -----------------------------------------------------------------KAIYN
2ixtA           -----------------------------------------------------------------KAIYN
1wsdA           -------------------------------------------------------------SRVQAPAAH
1wmdA           -----------------------------------------------------------------DVAQS
1gciA           -------------------------------------------------------------SRVQAPAAH
1c13A           -------------------------------------------------------------SRVQAPAAH
2gkoA           -----------------------------------------------------------------KAIYN
2zwpB           ----------------------------------------------------------------------
1c3lA           ----------------------------------------------------------------------
1ea7A           -----------------------------------------------------------------KAIYN
2zwpA           ----------------------------------------------------------------------
2zwoC           ----------------------------------------------------------------------
2zwoB           ----------------------------------------------------------------------
2zwoA           ----------------------------------------------------------------------
2z56A           ----------------------------------------------------------------------
2z30A           ----------------------------------------------------------------------
2z2zA           ----------------------------------------------------------------------
2e1pA           ----------------------------------------------------------------------
3a3nA           ----------------------------------------------------------------------
1iavA           -------------------------------------------------------------SRVQAPAAH
1cseE           ----------------------------------------------------------------------
1a1yE           ----------------------------------------------------------------------
2z2yA           ----------------------------------------------------------------------
1sh7B           ----------------------------------------------------------------------
1sh7A           ----------------------------------------------------------------------
1s2nB           ----------------------------------------------------------------------
1thmA           ----------------------------------------------------------------------
3a3pA           ----------------------------------------------------------------------
1wmfA           -----------------------------------------------------------------DVAQS
2z2xA           ----------------------------------------------------------------------
1av7A           ----------------------------------------------------------------------
2b6nA           ----------------------------------------------------------------------
1r6vA           ----------------------------------------------------------------------
1c9nA           -------------------------------------------------------------SRVQAPAAH
1c9jA           -------------------------------------------------------------SRVQAPAAH
1ic6A           ----------------------------------------------------------------------
3dw3X           ----------------------------------------------------------------------
1ht3A           ----------------------------------------------------------------------
2w2qA           ----------------------------------------------------------------------
2w2mA           ----------------------------------------------------------------------
3gcwA           ----------------------------------------------------------------------
3bpsA           ----------------------------------------------------------------------
2w2pA           ----------------------------------------------------------------------
2w2oA           ----------------------------------------------------------------------
2w2nA           ----------------------------------------------------------------------
1r64A           ----------------------------------------------------------------------
1ot5A           ----------------------------------------------------------------------
2id4B           ----------------------------------------------------------------------
2id4A           ----------------------------------------------------------------------
3eifA           ----------------------------------------------------------------------
2pmwB           ----------------------------------------------------------------------
2qtwB           ----------------------------------------------------------------------
2p4eA           ----------------------------------------------------------------------
3h42B           ----------------------------------------------------------------------
1xf1A           ----------------------------------------------------------------------
1p8jH           ----------------------------------------------------------------------
1p8jF           ----------------------------------------------------------------------
1p8jC           ----------------------------------------------------------------------
1p8jB           ----------------------------------------------------------------------
1p8jA           ----------------------------------------------------------------------
1v6cB           ----------------------------------------------------------------------
1v6cA           ----------------------------------------------------------------------
2iy9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYRGPA
1y4dE           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1supA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
2sniE           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1s02A           SEGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1lw6E           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1suaA           SQGYTGSNVKVAVIDSGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1sueA           SQGYTGSNVKVAVIDSGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1sbiA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFDNNSHGTHVAGTVAALDNSIGVL--GVA
1s01A           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFDNNSHGTHVAGTVAALDNSIGVL--GVA
1sbtA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETPNFDDNSHGTHVAGTVAALNNSIGVL--GVA
1subA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1spbS           SQGYTGSNVKVAVINSGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1v5iA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1duiA           SQGYTGSNVKVAVIDSGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1sbhA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFDNNSHGTHVAGTVAALDNSIGVL--GVA
1sudA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1ak9A           SQGYCGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1aqnA           SQGYCGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1gnvA           SQGYTGSNVKVAVIDSGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1bh6A           -QGYKGANVKVGIIDTGIASHTDL--KVVGGASFVSGESYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
1a2qA           SQGYCGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1q5pA           NRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALDNSIG--VLGVA
1gnsA           SQGYTGSNVKVAVIDSGISSHPAL--KVAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1st2A           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
1st3A           NRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIG--VLGVA
1dbiA           --TKGSSGQEIAVIDTGVYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAG-IAAAETNNATGIAGMA
1nduA           NRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIG--VLGVA
1sucA           SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASFVPSETNPFQDNNSXXXXXXXXXXXXX----------
3f49S           SQGYTGSNVKVAVLASGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
3cnqS           SQGYTGSNVKVAVLASGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
3bgoS           SQGYTGSNVKVAVLASGISSHPDLN--VAGGASFVPSETNPFDNNSHGTHVAGTVLAV-----------A
1meeA           SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVA
2tecE           -----GSGAKIAIVDTGVQSHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAG-IAAAVTNNSTGIAGTA
1scjA           SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVS
1c9mA           NRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALDNSIG--VLGVA
2ixtB           NDTLTGSGINIAVLDTGVNTHPDLVNNVEQCKDFTGATTSCTDRNGHGTHVAGTALADGGSDQAGIYGVA
2ixtA           NDTLTGSGINIAVLDTGVNTHPDLVNNVEQCKDFTGATTSCTDRNGHGTHVAGTALADGGSDQAGIYGVA
1wsdA           NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
1wmdA           SYGLYGQGQIVAVADTGLDTHEAFRGKITALYAL-GRTNNANDTNGHGTHVAGSVLGNGSTN----KGMA
1gciA           NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
1c13A           NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
2gkoA           NSNLTGAGINIAVLDTGVNTHPDLSNNVEQCKDFTNSCT---DRQGHGTHVAGSALANGGTGSGVY-GVA
2zwpB           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
1c3lA           -QGFKGANVKVAVLDTGIQAHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
1ea7A           NDTLTGSGINIAVLDTGVNTHPDLVNNVEQCKDFTGATTSCTDRNGHGTHVAGTALADGGSDQAGIYGVA
2zwpA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2zwoC           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2zwoB           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2zwoA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2z56A           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2z30A           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2z2zA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
2e1pA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
3a3nA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
1iavA           NRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIG--VLGVA
1cseE           -QGFKGANVKVAVLDTGIQAHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
1a1yE           -QGFKGANVKVAVLDTGIQAHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
2z2yA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
1sh7B           -----GFGVTAYVIDTGVNNHEEFGGRSVSGYDFVDNDADSSDCNGHGTHVAGTI------GGSQY-GVA
1sh7A           -----GFGVTAYVIDTGVNNHEEFGGRSVSGYDFVDNDADSSDCNGHGTHVAGTI------GGSQY-GVA
1s2nB           -----GFGVTAYVIDTGVNNHEEFGGRSVSGYDFVDNDADSSDCNGHGTHVAGTI------GGSQY-GVA
1thmA           -----GSGAKIAIVDTGVQSHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAG-IAAAVTNNSTGIAGTA
3a3pA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
1wmfA           SYGLYGQGQIVAVADTGLDTHEAFRGKITALYAL-GRTNNANDTNGHGTHVAGSVLGNGSTN----KGMA
2z2xA           --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
1av7A           -QGFKGANVKVAVLDTGIQAHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
2b6nA           -----GSGVTAFVIDTGVLTHNEFGGRASSGYDFIDNDYDATDCNGHGTHVAGTIGGSTY-------GXX
1r6vA           ----SGTNIIVAVVDTGVDTHPDLEGQVIGYRPAFDEELPAGTDSSYGTHVAGTIAAKKDGKGIV--GVA
1c9nA           NRGLTGSGVRVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIG--VLGVA
1c9jA           NRGLTGSGVRVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIG--VLGVA
1ic6A           -----GQGSCVYVIDTGIEAHPEFEGR----AQMV--KTYYYDGNGHGTHCAGTV-------GSRTYGVA
3dw3X           -----GQGSCVYVIDTGIEAHPEFEGR----AQMV--KTYYYDGNGHGTHCAGTV-------GSRTYGVA
1ht3A           -----GQGSCVYVIDTGIEAHPEFEGR----AQMV--KTYYYDGNGHGTHCAGTV-------GSRTYGVV
2w2qA           --------VEVYLLDTSIQSHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA-------GVA
2w2mA           -----GSLVEVYLLDTSIQSHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA-------GVA
3gcwA           -----GSLVEVYLLDTSIQSHREIEGRVM-VTDFENVPEEASKCDSHGTHLAGVVSGRDA-------GVA
3bpsA           -----GSLVEVYLLDTSIQSHREIEGRVM-VTDFENVPEEASKCDSHGTHLAGVVSGRDA-------GVA
2w2pA           --------VEVYLLDTSIQSHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA-------GVA
2w2oA           --------VEVYLLDTSIQSHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA-------GVA
2w2nA           --------VEVYLLDTSIQSHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA-------GVA
1r64A           ---ITGAGVVAAIVDDGLYENEDLKDNFCAFNDNTNLPKPRLSDDYHGTRCAGEIAAKKGNNFCGV-GVG
1ot5A           ---ITGAGVVAAIVDDGLYENEDLKDNFCAFNDNTNLPKPRLSDDYHGTRCAGEIAAKKGNNFCGV-GVG
2id4B           ---ITGAGVVAAIVDDGLYENEDLKDNFADFNDNTNLPKPRLSDDYHGTRCAGEIAAKKGNNFCGV-GVG
2id4A           ---ITGAGVVAAIVDDGLYENEDLKDNFADFNDNTNLPKPRLSDDYHGTRCAGEIAAKKGNNFCGV-GVG
3eifA           ----------------------------------------------------------------------
2pmwB           -----GSLVEVYLLDTSIQSHREIEGRVMDFENVPEEQASKCDS--HGTHLAGVVSGRDA-------GVA
2qtwB           -----GSLVEVYLLDTSIQSHREIEGRVM-VTDFENVPEEDASKDSHGTHLAGVVSGRDA-------GVA
2p4eA           -----GSLVEVYLLDTSIQSHREIEGRVVTDFENVPEEDQASKCDSHGTHLAGVVSGRDA-------GVA
3h42B           --------VEVYLLDTSIQSHREIEGRVM----VTDFENVPEEDDSHGTHLAGVVSGRDA-------GVA
1xf1A           ----------------------------------------------------------------------
1p8jH           -QGFTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
1p8jF           -QGFTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
1p8jC           -QGFTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
1p8jB           -QGFTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
1p8jA           -QGFTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
1v6cB           ---------------------------------------QPGNNNAHGTHVAGTIAAIANNEGVVGVMPN
1v6cA           ---------------------------------------QPGNNNAHGTHVAGTIAAIANNEGVVGVMPN
2iy9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEA
1y4dE           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1supA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
2sniE           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1s02A           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1lw6E           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1suaA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1sueA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1sbiA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1s01A           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1sbtA           PSSALYAVKVLGDAGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1subA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1spbS           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1v5iA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1duiA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1sbhA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1sudA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1ak9A           PCASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1aqnA           PCASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1gnvA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1bh6A           PNVSLYAIKVLNXXXXXXXXXXXXXIEWATQNG-------LDVINMSLGGPS------GSTALKQAVDKA
1a2qA           PCASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1q5pA           PSAELYAVKVLXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
1gnsA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
1st2A           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN--------DVIN-SLGGPS------GSXXXXXXXXXX
1st3A           PSAELYAVKVLGADGRGAISSIAQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
1dbiA           PNTRILAVRALDRNGSGTLS-------XXXXXXXXXXXSGAEVINLSLGCDC------HTTTLENAVNYA
1nduA           PNAELYAVKVLXXXXXXXXXXIAQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
1sucA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
3f49S           PSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMSLGSPS----GSXXXXXXXXXXXX
3cnqS           PSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMSLGSPS----GSXXXXXXXXXXXX
3bgoS           PSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMSLGSPS----GSXXXXXXXXXXXX
1meeA           PSASLYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPT------GSTALKTVVDKX
2tecE           PKASILAVRVLDNSGSGTWTAVANGITYA-------ADQGAKVISLSLGGTV------GNSGLQQAVNYA
1scjA           PSASLYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPT------GSTALKTVVDKX
1c9mA           PSAELYAVKVLXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
2ixtB           PDADLWAYKVLLDSGSGYSXXXXXXXXXXXXXXXXXGTKTI--ISMSLGSSA------NNSLISSAVNYA
2ixtA           PDADLWAYKVLLDSGSGYSXXXXXXXXXXXXXXXXXGTKTI--ISMSLGSSA------NNSLISSAVNYA
1wsdA           PSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
1wmdA           PQANLVFQSIMDSXXXXXXXPSNLQTLFSQAYSAG-----ARIHTNSWGAGAYTTDSRNVDDYVRKND--
1gciA           PSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
1c13A           PNAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
2gkoA           PEADLWAYKVLGDDGSGYADDIAEAIRHA--GDQATALNTKVVINMSLGSSG------ESSLITNAVDYA
2zwpB           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIL----GPDXXXEVISMSLGGPA------DDSYLYDMIIQA
1c3lA           PSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGGAS------GSTAMKQAVDNA
1ea7A           PDADLWAYKVLLDSGSGYSXXXXXXXXXXXXXXXXXGTK--TIISMSLGSSA------NNSLISSAVNYA
2zwpA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2zwoC           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2zwoB           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2zwoA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2z56A           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2z30A           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2z2zA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
2e1pA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
3a3nA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
1iavA           PNAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
1cseE           PSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGGAS------GSTAMKQAVDNA
1a1yE           PSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGGAS------GSTAMKQAVDNA
2z2yA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
1sh7B           KNVNIVGVRVLSCXXXXXXXXXXXXXDWVAQ-NASGP----SVANMSLGGG-------QSTALDSAVQGA
1sh7A           KNVNIVGVRVLSCXXXXXXXXXXXXXDWVAQ-NASGP----SVANMSLGGG-------QSTALDSAVQGA
1s2nB           KNVNIVGVRVLSCXXXXXXXXXXXXXDWVAQ-NASGP----SVANMSLGGG-------QSTALDSAVQGA
1thmA           PKASILAVRVLDNSGSGTWTAVANGITYA-------ADQGAKVISLSLGGTV------GNSGLQQAVNYA
3a3pA           PGVQIYSVRVLDARGSGSYSDIAIGIAQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
1wmfA           PQANLVFQSIMDSXXXXXXXPSNLQTLFSQAYSAG-----ARIHTNSWGAGAYTTDSRNVDDYVRKND--
2z2xA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
1av7A           PSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGGAS------GSTAMKQAVDNA
2b6nA           XXXXXXXXXXXXCSGSGSNSGVIAGINW-VKNNASGP----AVANMSLGGGA-------SQXXXXXXXXX
1r6vA           PGAKIMPIVIFDDPAXXXXXXXAAGIIWAT-------DHGAKVMNHSWGGWGYSYTMKE------AFDYA
1c9nA           PSAELYAVKVLXXXXXXXXXXIAQGLEW------------------------------------------
1c9jA           PSAELYAVKVLXXXXXXXXXXIAQGLEW------------------------------------------
1ic6A           KKTQLFGVKVLDDNGSGQYSTIIAGMDF------------------------------------------
3dw3X           KKTQLFGVKVLDDNGSGQYSTIIAGMDF------------------------------------------
1ht3A           KKTQLFGVKVLDDNGSGQYSTIIAGMDF------------------------------------------
2w2qA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
2w2mA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
3gcwA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
3bpsA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
2w2pA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
2w2oA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
2w2nA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
1r64A           YNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSWGADDGRHLQGPSDALVKGVTEG
1ot5A           YNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSWGADDGRHLQGPSDALVKGVTEG
2id4B           YNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSWGADDGRHLQGPSDALVKGVTEG
2id4A           YNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSWGADDGRHLQGPSDALVKGVTEG
3eifA           ----------------------------------------------------------------------
2pmwB           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
2qtwB           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
2p4eA           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
3h42B           KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
1xf1A           ----------------------------------------------------------------------
1p8jH           -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
1p8jF           -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
1p8jC           -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
1p8jB           -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
1p8jA           -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
1v6cB           QNANIHIVKVFNEAGWGYSSSLVAAIDTCVNSGGAN------VVTMXXXXXXXXXXER------NALNTH
1v6cA           QNANIHIVKVFNEAGWGYSSSLVAAIDTCVNSGGAN------VVTMXXXXXXXXXXER------NALNTH
2iy9A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAP
1y4dE           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1supA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
2sniE           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1s02A           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1lw6E           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1suaA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1sueA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1sbiA           XXXXXXXXXXXGNEGTSSSTVGYPAKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1s01A           XXXXXXXXXXXGNEGTSSSTVGYPAKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1sbtA           XXXXXXXXXXXGNEGSSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1subA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1spbS           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1v5iA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1duiA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1sbhA           XXXXXXXXXXXGNEGTSSSTVGYPAKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1sudA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1ak9A           XXXXXXXXXXXGNEGTSSSTVGYPAKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1aqnA           XXXXXXXXXXXGNEGTSSSTVGYPAKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1gnvA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1bh6A           YASGIVVVAAAGNSGNSGSTIGYPAKYDSVIAVGAVDSNKNR-------ASFSSVGSEL------EVMAP
1a2qA           XXXXXXXXXXXGNEGTSSSTVGYPAKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1q5pA           TSRGVLVVAASGNEGAGS--IDYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
1gnsA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1st2A           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
1st3A           TSRXXXXXXXXXXXXXXXXXY--PARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
1dbiA           WNKGSVVVAAAGNNS-----------YENVIAVG-------AVDQYDRLASFSNYGTWV------DVVAP
1nduA           TSR--XXXXXXXXXXXXXXXISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
1sucA           XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
3f49S           XXXXXXXXXXXXXXXXXXXXXXYPAKYPSVIAVGAVDSSNQR-------APFSSVGPEL------DVMAP
3cnqS           XXXXXXXXXXXXXXXXXXXXXXYPAKYPSVIAVGAVDSSNQR-------APFSSVGPEL------DVMAP
3bgoS           XXXXXXXXXXXXXXXXXXXXXXYPAKYPSVIAVGAVDSSNQR-------APFSSVGPEL------DVMAP
1meeA           XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSANQR-------ASFSSAGSEL------DVMAP
2tecE           WNKG---------SXXXXXXXXXXXXXXXXXXXXSNAIAVASTDQNDNKSSFSTYGSVV------DVAAP
1scjA           XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSSNQR-------ASFSSAGSEL------DVMAP
1c9mA           TSR--XXXXXXXXXXXXXXXISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
2ixtB           YSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYR--VADYSSRG---YISTAGDYVIQ
2ixtA           YSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYR--VADYSSRG---YISTAGDYVIQ
1wsdA           TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
1wmdA           ----MTILFAAGNEGPNGGTISAPGTAKNAITVGATENLRPSFGSYADVAQFSSRGPTKDGRIKPDVMAP
1gciA           TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
1c13A           TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
2gkoA           YDKGVLIIAAAGNSGPKPGSIGYPGXXXXXXXXXXXENTIQNGTYR--VADFSSRGHKVIQKGDVEISAP
2zwpB           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
1c3lA           YXXXXXXXXXXXXXXXXTNTIGYPAKYDSVIAVGAVDSNSNR-------ASFSSVGAEL------EVMAP
1ea7A           YSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVA--ALENVQQNGTYRVADYSSRG---YISTAGDYVIQ
2zwpA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2zwoC           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2zwoB           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2zwoA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2z56A           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2z30A           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2z2zA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
2e1pA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
3a3nA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
1iavA           TSR--XXXXXXXXXXXXXXXISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
1cseE           YARXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDSNSNR-------ASFSSVGAEL------EVMAP
1a1yE           YARXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDSNSNR-------ASFSSVGAEL------EVMAP
2z2yA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
1sh7B           IQSGVSFMLAAGNSNADACN-TSPARXXXXXXXXXXXXXXXXXXXXXXXXCV-------------DLFAP
1sh7A           IQSGVSFMLAAGNSNADACN-TSPARXXXXXXXXXXXXXXXXXXXXXXXXCV-------------DLFAP
1s2nB           IQSGVSFMLAAGNSNADACN-TSPARXXXXXXXXXXXXXXXXXXXXXXXXCV-------------DLFAP
1thmA           WNKG---------SXXXXXXXXXXXXXXXXXXXXSNAIAVASTDQNDNKSSFSTYGSWV------DVAAP
3a3pA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
1wmfA           ----MTILFAAGNEGPNGGTISAPGTAKNAITVGATENLRPSFGSYADVAQFSSRGPTKDGRIKPDVMAP
2z2xA           YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
1av7A           YARXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDSNSNR-------ASFSSVGAEL------EVMAP
2b6nA           XXXGITFVVAAGNDNSNACNY-SPARAADAITVG------------XXXXXXXXXXXXXYG-TCLDIYAP
1r6vA           MEHGVVMVVSAGNNTSDSHH-QYPAGYPGVIQVAALDYYGGTFR----VAGFSSRSDGV------SVGAP
1c9nA           -------------------------------------------------ASFSQYGAGL------DIVAP
1c9jA           -------------------------------------------------ASFSQYGAGL------DIVAP
1ic6A           ----------------------------------------------------------------------
3dw3X           ----------------------------------------------------------------------
1ht3A           ----------------------------------------------------------------------
2w2qA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
2w2mA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
3gcwA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
3bpsA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
2w2pA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
2w2oA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
2w2nA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
1r64A           RSKGAIYVFASGNGGTRGDNCNYDGYTNSIITIGAIDHKDLHPP---------------YSEGCSAVMA-
1ot5A           RSKGAIYVFASGNGGTRGDNCNYDGYTNSIITIGAIDHKDLHPP---------------YSEGCSAVMA-
2id4B           RSKGAIYVFASGNGGTRGDNCNYDGYTNSIITIGAIDHKDLHPP---------------YSEGCSAVMA-
2id4A           RSKGAIYVFASGNGGTRGDNCNYDGYTNSIITIGAIDHKDLHPP---------------YSEGCSAVMA-
3eifA           ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
2pmwB           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
2qtwB           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
2p4eA           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
3h42B           ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
1xf1A           ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
1p8jH           FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
1p8jF           FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
1p8jC           FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
1p8jB           FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
1p8jA           FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
1v6cB           YNNGVLLIAAAGNAG--------------------------------------------------DITVP
1v6cA           YNNGVLLIAAAGNAG--------------------------------------------------DITVP
2iy9A           -----------------------------------------------------------FGNNWVDIAAP


                         .         .         .         .         *         .         .:420
query           GVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW
1y4dE           GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1supA           GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
2sniE           GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKL
1s02A           GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1lw6E           GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1suaA           GVSIV--------------STLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1sueA           GVSIC--------------STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1sbiA           GVSI---------------STLPGNKYGAYSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1s01A           GVSIC--------------STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1sbtA           GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKL
1subA           GVSI--------------QSTLPGNKYGAYSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1spbS           GVSIV--------------STLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1v5iA           GVSI--------------QSTLPGNKYGAYNGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1duiA           GVSIC--------------STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1sbhA           GVSI---------------STLPGNKYGAYSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTYL
1sudA           GVSI--------------QSTLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1ak9A           GVSI--------------QSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1aqnA           GVSIC--------------STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1gnvA           GVSIC--------------STLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1bh6A           GVSVYSTYPSNTYT--------------SLNGTSMASPHVAGAAALILSKYPTLSASQVRNRLSSTATNL
1a2qA           GVSI--------------QSTLPGNKYGAYSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1q5pA           GVNV--------------QSTYPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1gnsA           GVSI--------------WSTLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1st2A           GVSI--------------QSTLPGNKYGAYNGTS-ASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1st3A           GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1dbiA           GVDIV--------------STITGNRYAYMSGTSMASPHVAGLAALLASQGRNNI--EIRQAIEQTADKI
1nduA           GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1sucA           GVSI--------------QSTLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
3f49S           GVSIC--------------STLPGGKYGALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKL
3cnqS           GVSIC--------------STLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKL
3bgoS           GVSIC--------------STLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKL
1meeA           GVSI--------------QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
2tecE           G----------SWI----YSTYPTSTYASLSGTSMATPHVAGVAGLLASQG--RSASNIRAAIENTADKI
1scjA           GVSI--------------QSTLPGGTYGAYNGTCMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
1c9mA           GVNV--------------QSTYPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
2ixtB           EGDI-EISAPGSSV----YSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQ------
2ixtA           EGDI-EISAPGSSV----YSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQ------
1wsdA           GVNV--------------QSTYPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATGL
1wmdA           GTFILSARS--SLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREKNRGITP--------------
1gciA           GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1c13A           GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
2gkoA           GAAVYS-----TWFD---------GGYATISGTSMASPHAAGLAAKIWAQSPAASNVDVR----------
2zwpB           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
1c3lA           GAGVYSTYPTNTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
1ea7A           EGD-IEISAPGSSV----YSTWYNGGYNTISGT-MATPHVSGLAAKIWAENPSLSNTQLRSNLQ------
2zwpA           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2zwoC           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2zwoB           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2zwoA           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2z56A           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2z30A           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2z2zA           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
2e1pA           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
3a3nA           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
1iavA           GVNV--------------QSTYPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1cseE           GAGVYSTYPTNTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
1a1yE           GAGVYSTYPTNTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
2z2yA           GVDILS-----TYPD---------DSYETLMGTCMATPHVSGVVALI-----------------------
1sh7B           GSQI--------------KSAWYDGGYKTISGTSMATPHVAGVAALYLQENNGLTPLQLTGLLNSRASEN
1sh7A           GSQI--------------KSAWYDGGYKTISGTSMATPHVAGVAALYLQENNGLTPLQLTGLLNSRASEN
1s2nB           GSQI--------------KSAWYDGGYKTISGTSMATPHVAGVAALYLQENNGLTPLQLTGLLNSRASEN
1thmA           G--------------XXXXXXXXXXXXXXXXGTSMATPHVAGVAGLLASQG--RSASNIRAAIENTADKI
3a3pA           GVDILS-----TYPD---------DSYETLMGTAMATPHVSGVVALI-----------------------
1wmfA           GTFILSARSPDSSFWANHDSK------YAYGGTS-ATPIVAGNVAQLREKNRGITP--------------
2z2xA           GVDILS-----TYPD---------DSYETLMGT-MATPHVSGVVALI-----------------------
1av7A           GAGVYSTYPTNTYA--------------TLNGT-MASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
2b6nA           GXXXXXXXXXXXXATN------------TISGTSMASPHVAGVAALYLDENPNLSPAQVTNLLK------
1r6vA           GVTILSTVPGEDSIGYEGHNENVGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLEN-----
1c9nA           GVNV--------------QSTYPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1c9jA           GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1ic6A           ----------------------------------------------------------------------
3dw3X           ----------------------------------------------------------------------
1ht3A           ----------------------------------------------------------------------
2w2qA           GEDIIG------------ASSHCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
2w2mA           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
3gcwA           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
3bpsA           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
2w2pA           GEDIIG------------ASSACSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
2w2oA           GEDIIG------------ASSYCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
2w2nA           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
1r64A           ---VTYSSGSGEYIHSSDINGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSKNADGDW
1ot5A           ---VTYSSGSGEYIHSSDINGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSKNADGDW
2id4B           ---VTYSSGSGEYIHSSDINGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSKNADGDW
2id4A           ---VTYSSGSGEYIHSSDINGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSKNADGDW
3eifA           GQDIL--------------SSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYPDMTPSEAKKVLMSSATAL
2pmwB           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
2qtwB           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
2p4eA           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
3h42B           GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
1xf1A           GQDIL--------------SSVANNKYAKLSGTSSA-PLVAGIGLLQKQQYPD-TPSEAKKVLSSATALY
1p8jH           -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
1p8jF           -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
1p8jC           -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
1p8jB           -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
1p8jA           -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
1v6cB           SVSVLALKA------KLGQSTTVSNQYEYYNGTSMATPHVSGVATLVWSYHPECSASQVRAALNATADDL
1v6cA           SVSVLALKA------KLGQSTTVSNQYEYYNGTSMATPHVSGVATLVWSYHPECSASQVRAALNATADDL
2iy9A           GQNITFLRPD--------------AKXXXXXXXXEATAIVSGVLAAMTSCNPRATATELKRTLLESADKY


                         .         .         +         .         .         .         .:490
query           KDEDPNIYGAGAVNAENSVxxx
1y4dE           GDS--FYYGKGLINVQ------
1supA           GDS--FYYGKGLINVQ------
2sniE           GDS--FYYGKGLINVQ------
1s02A           GDS--FYYGKGLINVE------
1lw6E           GDS--FYYGKGLIN--------
1suaA           GDS--FYYGKGLINVE------
1sueA           GDS--FYYGKGLINVE------
1sbiA           GDS--FYYGKGLINVQ------
1s01A           GDS--FYYGKGLINVQ------
1sbtA           GDS--FYYGKGLINVQ------
1subA           GDS--FYYGKGLINVQ------
1spbS           GDS--FYYGKGLINVQ------
1v5iA           GDS--FYYGKGLINVQ------
1duiA           GNS--FYYGKGLINVQ------
1sbhA           GDS--FYYGKGLINVQ------
1sudA           GDS--FYYGKGLINVQ------
1ak9A           GDS--FYYGKGLINVQ------
1aqnA           GDS--FYYGKGLINVQ------
1gnvA           GDS--FYYGKGLINVE------
1bh6A           GDS--FYYGKGLINVE------
1a2qA           GDS--FYYGKGLINVQ------
1q5pA           --GSTNLYGSGLVNAE------
1gnsA           GDS--FYYGKGLINVE------
1st2A           GDS--FYYGKGLINVQ------
1st3A           --GSTNLYGSGLVNAE------
1dbiA           SGTG-TYFKYGRINSYNAV---
1nduA           --GSTNLYGSGLVNAE------
1sucA           GDS--FYYGKGLINVQ------
3f49S           GDS--FYYGKGLINVE------
3cnqS           GDS--FYYGKGLINVE------
3bgoS           GDS--FYYGKGLINVE------
1meeA           GSS--FYYGKGLINVQ------
2tecE           SGTG-TYWAKGRVNAYKAV---
1scjA           GNS--FYYGKGLINVQ------
1c9mA           --GSTNLYGSGLVNAE------
2ixtB           ----------------------
2ixtA           ----------------------
1wsdA           --GNTNLYGSGLVNAE------
1wmdA           ----------------------
1gciA           --GSTNLYGSGLVNAE------
1c13A           --GSTNLYGSGLVNAE------
2gkoA           ----------------------
2zwpB           ----------------------
1c3lA           GSS--FYYGKGLINVE------
1ea7A           ----------------------
2zwpA           ----------------------
2zwoC           ----------------------
2zwoB           ----------------------
2zwoA           ----------------------
2z56A           ----------------------
2z30A           ----------------------
2z2zA           ----------------------
2e1pA           ----------------------
3a3nA           ----------------------
1iavA           --GSTNLYGSGLVNAE------
1cseE           GSS--FYYGKGLINVE------
1a1yE           GSS--FYYGKGLINVE------
2z2yA           ----------------------
1sh7B           KVSD------------------
1sh7A           KVSD------------------
1s2nB           KVSD------------------
1thmA           SGTG-TYWAKGRVNAYKAV---
3a3pA           ----------------------
1wmfA           ----------------------
2z2xA           ----------------------
1av7A           GSS--FYYGKGLINVE------
2b6nA           ----------------------
1r6vA           ----------------------
1c9nA           --GSTNLYGSGLVNAE------
1c9jA           --GSTNLYGSGLVNAE------
1ic6A           ----------------------
3dw3X           ----------------------
1ht3A           ----------------------
2w2qA           FPEDQRVLTPNLVAA-------
2w2mA           FPEDQRVLTPNLVAA-------
3gcwA           FPEDQRVLTPNLVAA-------
3bpsA           FPEDQRVLTPNLVAA-------
2w2pA           FPEDQRVLTPNLVAA-------
2w2oA           FPEDQRVLTPNLVAA-------
2w2nA           FPEDQRVLTPNLVAA-------
1r64A           RDKYSHRYGFGKIDAHKLI---
1ot5A           RDKYSHRYGFGKIDAHKLI---
2id4B           RDKYSHRYGFGKIDAHKLI---
2id4A           RDKYSHRYGFGKIDAHKLI---
3eifA           YDEDEKAY--------------
2pmwB           FPEDQRVLTPNLVAA-------
2qtwB           FPEDQRVLTPNLVAA-------
2p4eA           FPEDQRVLTPNLVAA-------
3h42B           FPEDQRVLTPNLVAA-------
1xf1A           -DEDEKAY--------------
1p8jH           ----------------------
1p8jF           ----------------------
1p8jC           ----------------------
1p8jB           ----------------------
1p8jA           ----------------------
1v6cB           SVAGDNQTGYGMINA-------
1v6cA           SVAGDNQTGYGMINA-------
2iy9A           PSLVDKVTEGRVLNAEKAI---