[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:ymaD

[Show Plain Result]

#ERROR : Can't open dsspfile "3i07B.bssp"
#ERROR : Can't open dsspfile "3i07A.bssp"
#ERROR : Can't open dsspfile "1nyeE.bssp"
#ERROR : Can't open dsspfile "1nyeD.bssp"
#ERROR : Can't open dsspfile "1nyeC.bssp"
#ERROR : Can't open dsspfile "1nyeA.bssp"
#ERROR : Can't open dsspfile "1nyeF.bssp"
#ERROR : Can't open dsspfile "3eerA.bssp"
#ERROR : Can't open dsspfile "1n2fA.bssp"
#ERROR : Can't open dsspfile "2onfA.bssp"
#ERROR : Can't open dsspfile "2bjoA.bssp"
#ERROR : Can't open dsspfile "1qwiA.bssp"

## Summary of PDB Search
:150
    6e-08  27%  3i07B  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    6e-08  27%  3i07A  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    3e-06  27%  1nyeE  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    3e-06  27%  1nyeD  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    3e-06  27%  1nyeC  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    3e-06  27%  1nyeA  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    4e-06  25%  1nyeF  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    6e-06  27%  3eerA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN,
    2e-04  29%  1n2fA  [d.227.1] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    2e-04  26%  2onfA  [x.x.x] HYPOTHETICAL PROTEIN TA0195
    3e-04  28%  2bjoA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
    7e-04  23%  1qwiA  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN
:150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
3i07B           -----YQTSATASAGRNGVVSTEDKLLELNLSYPKEMGGSGTATNPEQLFAVGYAACFSAILHVAREAKV
3i07A           -----YQTSATASAGRNGVVSTEDKLLELNLSYPKEMGGSGTATNPEQLFAVGYAACFSAILHVAREAKV
1nyeE           --------QAHWEGDKRGKGTVESGVLNQQYGFNTRFEGE-KGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeD           --------QAHWEGDKRGKGTVESGVLNQQYGFNTRFEGE-KGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeC           --------QAHWEGDKRGKGTVESGVLNQQYGFNTRFEGE-KGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeA           --------QAHWEGDKRGKGTVESGVLNQQYGFNTRFEGE-KGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeF           -----------------------------------------KGTNPEELIGAAHAACFSMALSLMLGEAG
3eerA           -----YQTSATASAGRNGVVSTEDKLLELNLSYPKE-GGSGTATNPEQLFAVGYAACFSAILHVAREAKV
1n2fA           ------------------------GVLDVKLSTPREMGGQGAATNPEQLFAAGYSACFI---GAMKFVAG
2onfA           ---HVYESDVSWIDDRRT--EVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRGN
2bjoA           -----FTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLXXXXXXXXXXXXLEHVAKEQN
1qwiA           -----------------------------------------KGTNPEELIGAAHAACF--SALSLLGEAG


                         .         .         *         .         .         .         .:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
3i07B           ALKEAPVTATVGIGPNGQGGFAL-SVALAAHIALEDEQARQLVTVAHQVCP-------YSNAVRGNIDVQ
3i07A           ALKEAPVTATVGIGPNGQGGFAL-SVALAAHIALEDEQARQLVTVAHQVCP-------YSNAVRGNIDVQ
1nyeE           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
1nyeD           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
1nyeC           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
1nyeA           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
1nyeF           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
3eerA           ALKEAPVTATVGIGPNGQGGFAL-SVALAAHIALEDEQARQLVTVAHQVCP-------YSNAVRGNIDVQ
1n2fA           QRKQTLPADASGKVGIGQGGFGLEVELHINLPGMXXXXXXXXXXXXHQVCP-------YSNATRGNIDVR
2onfA           LKSWNSHVTAELGPSPEKG---FK--FHRIKIHVKIGVNDEDKEKIPR-AQLAEKYCFISRAIRNNVE--
2bjoA           IE---IDSEIEGQVSLMKGGF-------KIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVK
1qwiA           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD


                         +         .         .         .         .         *         .:210
query           LEASVxxxxx
3i07B           VSVN------
3i07A           VSVN------
1nyeE           YQ--------
1nyeD           YQ--------
1nyeC           YQ--------
1nyeA           YQ--------
1nyeF           YQ--------
3eerA           VSVN------
1n2fA           LNVSV-----
2onfA           ----------
2bjoA           LE--------
1qwiA           YQ--------