[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:nrdE

[Show Plain Result]

#ERROR : Can't open dsspfile "1peuA.bssp"
#ERROR : Can't open dsspfile "1peoA.bssp"
#ERROR : Can't open dsspfile "1pemA.bssp"
#ERROR : Can't open dsspfile "2bq1F.bssp"
#ERROR : Can't open dsspfile "1peqA.bssp"
#ERROR : Can't open dsspfile "2bq1E.bssp"
#ERROR : Can't open dsspfile "2wghA.bssp"
#ERROR : Can't open dsspfile "2wghB.bssp"
#ERROR : Can't open dsspfile "2cvtA.bssp"
#ERROR : Can't open dsspfile "2eudA.bssp"
#ERROR : Can't open dsspfile "2zlfA.bssp"
#ERROR : Can't open dsspfile "2cvxA.bssp"
#ERROR : Can't open dsspfile "2cvwA.bssp"
#ERROR : Can't open dsspfile "2cvuA.bssp"
#ERROR : Can't open dsspfile "1zyzB.bssp"
#ERROR : Can't open dsspfile "1zyzA.bssp"
#ERROR : Can't open dsspfile "2cvsA.bssp"
#ERROR : Can't open dsspfile "2zlgA.bssp"
#ERROR : Can't open dsspfile "1zzdA.bssp"
#ERROR : Can't open dsspfile "4r1rA.bssp"
#ERROR : Can't open dsspfile "2r1rA.bssp"
#ERROR : Can't open dsspfile "1rlrA.bssp"
#ERROR : Can't open dsspfile "7r1rA.bssp"
#ERROR : Can't open dsspfile "6r1rA.bssp"
#ERROR : Can't open dsspfile "1r1rA.bssp"
#ERROR : Can't open dsspfile "5r1rA.bssp"
#ERROR : Can't open dsspfile "1xjeB.bssp"
#ERROR : Can't open dsspfile "1xjeA.bssp"
#ERROR : Can't open dsspfile "1xjnB.bssp"
#ERROR : Can't open dsspfile "1xjfB.bssp"
#ERROR : Can't open dsspfile "1xjnC.bssp"
#ERROR : Can't open dsspfile "1xjfA.bssp"
#ERROR : Can't open dsspfile "1xjnD.bssp"
#ERROR : Can't open dsspfile "1xjjB.bssp"
#ERROR : Can't open dsspfile "1xjkA.bssp"
#ERROR : Can't open dsspfile "1xjnA.bssp"
#ERROR : Can't open dsspfile "1xjmB.bssp"
#ERROR : Can't open dsspfile "1xjkB.bssp"
#ERROR : Can't open dsspfile "1xjjA.bssp"
#ERROR : Can't open dsspfile "1xjgA.bssp"
#ERROR : Can't open dsspfile "1xjmA.bssp"
#ERROR : Can't open dsspfile "1xjgB.bssp"
#ERROR : Can't open dsspfile "1rp5B.bssp"
#ERROR : Can't open dsspfile "1rp5A.bssp"

## Summary of PDB Search
:700
    e-173  45%  1peuA  [a.98.1 - c.7.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-169  45%  1peoA  [a.98.1 - c.7.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-169  45%  1pemA  [a.98.1 - c.7.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-169  45%  2bq1F  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-165  45%  1peqA  [a.98.1 - c.7.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-165  45%  2bq1E  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    4e-50  29%  2wghA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE
    9e-49  29%  2wghB  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE
    1e-47  28%  2cvtA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    4e-46  28%  2eudA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    5e-46  28%  2zlfA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    7e-46  28%  2cvxA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    7e-46  28%  2cvwA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    7e-46  28%  2cvuA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    2e-45  29%  1zyzB  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    2e-45  29%  1zyzA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    9e-44  28%  2cvsA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    3e-43  28%  2zlgA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    4e-42  28%  1zzdA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    4e-40  25%  4r1rA  [a.98.1 - c.7.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    1e-39  25%  2r1rA  [a.98.1 - c.7.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    2e-39  25%  1rlrA  [x.x.x] RIBONUCLEOTIDE REDUCTASE PROTEIN R1
    3e-39  25%  7r1rA  [a.98.1 - c.7.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    3e-39  25%  6r1rA  [a.98.1 - c.7.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    4e-39  25%  1r1rA  [a.98.1 - c.7.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    6e-39  25%  5r1rA  [a.98.1 - c.7.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    5e-33  29%  1xjeB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    5e-33  29%  1xjeA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    7e-33  28%  1xjnB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    3e-32  29%  1xjfB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    4e-31  28%  1xjnC  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    5e-31  30%  1xjfA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    8e-31  28%  1xjnD  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    1e-30  28%  1xjjB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    1e-30  30%  1xjkA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    2e-30  30%  1xjnA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    2e-30  27%  1xjmB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    5e-30  27%  1xjkB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    1e-29  29%  1xjjA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    1e-29  29%  1xjgA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    2e-29  29%  1xjmA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    9e-28  29%  1xjgB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, B12-DEPENDENT
    3e-04  26%  1rp5B  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
    3e-04  26%  1rp5A  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
:700

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
1peuA           ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
1peoA           ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
1pemA           ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
2bq1F           ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
1peqA           ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
2bq1E           ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
2wghA           ----------------------------------------------------------------------
2wghB           ----------------------------------------------------------------------
2cvtA           ----------------------------------------------------------------------
2eudA           ----------------------------------------------------------------------
2zlfA           ----------------------------------------------------------------------
2cvxA           ----------------------------------------------------------------------
2cvwA           ----------------------------------------------------------------------
2cvuA           ----------------------------------------------------------------------
1zyzB           ----------------------------------------------------------------------
1zyzA           ----------------------------------------------------------------------
2cvsA           ----------------------------------------------------------------------
2zlgA           ----------------------------------------------------------------------
1zzdA           ----------------------------------------------------------------------
4r1rA           ---------------------------------------------------------MVEMGKYDNHLLE
2r1rA           ---------------------------------------------------------MVEMGKYDNHLLE
1rlrA           ---------------------------------------------------------MVEMGKYDNHLLE
7r1rA           ---------------------------------------------------------MVEMGKYDNHLLE
6r1rA           ---------------------------------------------------------MVEMGKYDNHLLE
1r1rA           ---------------------------------------------------------MVEMGKYDNHLLE
5r1rA           ---------------------------------------------------------MVEMGKYDNHLLE
1xjeB           ----------------------------------------------------------------------
1xjeA           ----------------------------------------------------------------------
1xjnB           ----------------------------------------------------------------------
1xjfB           ----------------------------------------------------------------------
1xjnC           ----------------------------------------------------------------------
1xjfA           ----------------------------------------------------------------------
1xjnD           ----------------------------------------------------------------------
1xjjB           ----------------------------------------------------------------------
1xjkA           ----------------------------------------------------------------------
1xjnA           ----------------------------------------------------------------------
1xjmB           ----------------------------------------------------------------------
1xjkB           ----------------------------------------------------------------------
1xjjA           ----------------------------------------------------------------------
1xjgA           ----------------------------------------------------------------------
1xjmA           ----------------------------------------------------------------------
1xjgB           ----------------------------------------------------------------------
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
1peuA           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
1peoA           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
1pemA           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
2bq1F           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
1peqA           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
2bq1E           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
2wghA           ---------------------------------YLLKINGK--VAERPQHMLMRVSVGIHKEDIDAAIET
2wghB           ---------------------------------YLLKINGK--VAERPQHMLMRVSVGIHKEDIDAAIET
2cvtA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2eudA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2zlfA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2cvxA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2cvwA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2cvuA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
1zyzB           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
1zyzA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2cvsA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2zlgA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
1zzdA           --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
4r1rA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
2r1rA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
1rlrA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
7r1rA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
6r1rA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
1r1rA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
5r1rA           DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
1xjeB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjeA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjnB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjfB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjnC           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjfA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjnD           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjjB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjkA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjnA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjmB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjkB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjjA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjgA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjmA           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1xjgB           ------------------------------------KKNEKLDRIKEWEDRVLKARLFIPNSPTDLLWKP
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
1peuA           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
1peoA           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
1pemA           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
2bq1F           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
1peqA           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
2bq1E           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
2wghA           YNLLSERWFTHASPTLFNAGTNRP-QLSSCFLLSMDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATG
2wghB           YNLLSERWFTHASPTLFNAGTNRP-QLSSCFLLSMDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATG
2cvtA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2eudA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2zlfA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvxA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvwA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvuA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
1zyzB           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
1zyzA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvsA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2zlgA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
1zzdA           YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
4r1rA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
2r1rA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
1rlrA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
7r1rA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
6r1rA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
1r1rA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
5r1rA           VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
1xjeB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjeA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjnB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjfB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjnC           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjfA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjnD           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjjB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjkA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjnA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjmB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjkB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjjA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjgA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjmA           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGGGVGSNFSELRPKG
1xjgB           IDQMTLEDYEE-----IYRSRNHLHMLSACFVVPVGDSIEEIFEAVKEYALITKVGG-VGSNFSELRPKG
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
1peuA           APIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
1peoA           APIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKR-------RIKTLSL
1pemA           APIKRIENQSSGVIPVMKMLEDAFSYAN-----QGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
2bq1F           APIKRIENQSSGVIPVMKMLEDAFSYAN-----QGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
1peqA           APIKRIENQSSGVIPVMKMLEDAFSYAN-----QGAGAVYLHAHHPDILRFLDTK--------RIKTLSL
2bq1E           APIKRIENQSSGVIPVMKMLEDAFSYAN-----QGAGAVYLHAHHPDILRFLDTK--------RIKTLSL
2wghA           SYIAGTNGNSNGLVPMLRVYNNTARYVDQGGKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFF
2wghB           SYIAGTNGNSNGLVPMLRVYNNTARYVDQGGKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFF
2cvtA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2eudA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2zlfA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvxA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvwA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvuA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
1zyzB           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
1zyzA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvsA           SYIAGTNGTSNGLIPMIRVFNNTARYVD------GAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2zlgA           SYIAGTNGTSNGLIPMIRVFNNTARYV-------GAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
1zzdA           SYIAGTNGTSNGLIPMIRVFNNTARYV--------AFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
4r1rA           SPIRGGEAFHTGCIPFYKHFQTAVKSASQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
2r1rA           SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
1rlrA           SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
7r1rA           SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
6r1rA           SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
1r1rA           SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
5r1rA           SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
1xjeB           SFVAGTHGKASGPVSFMHVFNSAISVVKQGSRRRGALMGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjeA           SFVAGTHGKASGPVSFMHVFNSAISVVKQGSRRRGALMGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjnB           SFVAGTHGKASGPVSFMHVFNSAI---SVVKQRRGALMGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjfB           SFVAGTHGKASGPVSFMHVFNSAISVV-----KQGRGAGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjnC           SFVAGTHGKASGPVSFMHVFNSAISVVKQGGALMG----ILNINHPDIEEFIDAKK---ENVLNFFNLSV
1xjfA           SFVAGTHGKASGPVSFMHVFNSAISVV-----KQGALMGILNINHPDIEEFIDAKK----EVLNFFNLSV
1xjnD           SFVAGTHGKASGPVSFMHVFNSAISVVKAL-------MGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjjB           SFVAGTHGKASGPVSFMHVFNSAISVVKQ------ALMGILNINHPDIEEFIDAKK---EAVLNFFNLSV
1xjkA           SFVAGTHGKASGPVSFMHVFNSAISVVKQGSALMG----ILNINHPDIEEFIDAKK----EVLNFFNLSV
1xjnA           SFVAGTGKAS-GPVSFMHVFNSAISVVKQGGALMG----ILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjmB           SFVAGTHGKASGPVSFMHVFNSAISVVKAL-------MGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjkB           SFVAGTHGKASGPVSFMHVFNSAISVVKQ------ALMGILNINHPDIEEFIDAKK---EAVLNFFNLSV
1xjjA           SFVAGTHGKASGPVSFMHVFNSAISVVKQ------ALMGILNINHPDIEEFIDAKK---ENVLNFFNLSV
1xjgA           SFVAGTHGKASGPVSFMHVFNSAISVVKAL-------MGILNINHPDIEEFIDAKKV-----LNFFNLSV
1xjmA           SFVAGTHGKASGPVSFMHVFNSAISVVKQ------ALMGILNINHPDIEEFIDAKK---EAVLNFFNLSV
1xjgB           SFVAGTHGKASGPVSFMHVFNSAISVVKQ------ALMGILNINHPDIEEFIDAKKV-----LNFFNLSV
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
1peuA           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
1peoA           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
1pemA           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
2bq1F           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
1peqA           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
2bq1E           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
2wghA           ALWIPDLFMKRVETNQDWSLMCPNEC-----PGLDEVEFEKLYASYEKQGRVRK-VVKAQQLWYAIIESQ
2wghB           ALWIPDLFMKRVETNQDWSLMCPNEC-----PGLDEVEFEKLYASYEKQGRVRK-VVKAQQLWYAIIESQ
2cvtA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
2eudA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
2zlfA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
2cvxA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
2cvwA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
2cvuA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
1zyzB           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
1zyzA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
2cvsA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
2zlgA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
1zzdA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
4r1rA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
2r1rA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
1rlrA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
7r1rA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
6r1rA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
1r1rA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
5r1rA           GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
1xjeB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjeA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjnB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjfB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjnC           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjfA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjnD           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjjB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjkA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjnA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjmB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjkB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjjA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjgA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjmA           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1xjgB           GFPMDKKILKLYEEDGELELSHPRSTI--------------------------RKKVKIRELFRKIATNA
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
1peuA           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
1peoA           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
1pemA           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
2bq1F           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
1peqA           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
2bq1E           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
2wghA           TETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIV---------EYTSKDEVAV---CNLASLNMYVTS
2wghB           TETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIV---------EYTSKDEVAV---CNLASLNMYVTS
2cvtA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIV---------EYSAPDETAV---CNLASVALPAFI
2eudA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIV---------EYSAPDETAV---CNLASVALPAFI
2zlfA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIV---------EYSAPDETAV---CNLASVALPAFI
2cvxA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
2cvwA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
2cvuA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
1zyzB           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
1zyzA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
2cvsA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
2zlgA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIV---------EYSAPDETAV---CNLASVALPAFI
1zzdA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
4r1rA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLEIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
2r1rA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLEIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
1rlrA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLEIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
7r1rA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLQIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
6r1rA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLDIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
1r1rA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLEIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
5r1rA           ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLAIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
1xjeB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjeA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjnB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjfB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjnC           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjfA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjnD           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjjB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjkA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjnA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjmB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjkB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjjA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjgA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjmA           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1xjgB           WKSGDPGLAFLGEMNKYYPLYPHRKINSTNPCGEI-------GLSDYE---------ACNLGSIDVAGFV
1rp5B           --------------------------------------------------DRNGVPIAEDATSYNVYAV-
1rp5A           --------------------------------------------------DRNGVPIAEDATSYNVYAV-


                         .         .         +         .         .         .         .:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
1peuA           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
1peoA           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
1pemA           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
2bq1F           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
1peqA           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
2bq1E           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
2wghA           EHKKLAEVTKVVVRNLNKIID-INYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQ
2wghB           EHKKLAEVTKVVVRNLNKIID-INYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQ
2cvtA           EFKKLHEIAKVVTRNLNRVID-RNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2eudA           EFKKLHEIAKVVTRNLNRVID-RNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2zlfA           EFKKLHEIAKVVTRNLNRVID-RNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvxA           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvwA           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvuA           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
1zyzB           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
1zyzA           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvsA           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2zlgA           EFKKLHEIAKVVTRNLNRVID-RNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
1zzdA           EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
4r1rA           NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
2r1rA           NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
1rlrA           NLDELDELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
7r1rA           NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
6r1rA           NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
1r1rA           NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
5r1rA           NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
1xjeB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjeA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjnB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjfB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjnC           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjfA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjnD           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjjB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjkA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjnA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjmB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjkB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjjA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjgA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjmA           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1xjgB           DLEALQELVQIAVRFLDNVID-VNVFPIDKITKAVKESRRLGLGIMGFADLLYKLEIPYNSQEARDFAAN
1rp5B           ----IDENYKSATGKILYVEKTQFNKVAEVFH------KYLDMEESYVREQLSQPNLKQVSFGAKGNGIT
1rp5A           ----IDENYKSATGKILYVEKTQFNKVAEVFH------KYLDMEESYVREQLSQPNLKQVSFGAKGNGIT


                         *         .         .         .         .         +         .:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
1peuA           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
1peoA           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
1pemA           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
2bq1F           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
1peqA           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
2bq1E           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
2wghA           IFETIYYGALEASCDLAKEQG-PYETYEGSPVSKG--ILQYDMWNVTP-----TDLW---------DWKV
2wghB           IFETIYYGALEASCDLAKEQG-PYETYEGSPVSKG--ILQYDMWNVTP-----TDLW---------DWKV
2cvtA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGLQFDMWDQKPY------------GMW-----DWDT
2eudA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGLQFDMWDQKPY------------GMW-----DWDT
2zlfA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGLQFDMWDQKPY------------GMW-----DWDT
2cvxA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
2cvwA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
2cvuA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
1zyzB           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
1zyzA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
2cvsA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
2zlgA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGLQFDMWDQKPY------------GMW-----DWDT
1zzdA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
4r1rA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
2r1rA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
1rlrA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
7r1rA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
6r1rA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
1r1rA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
5r1rA           TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
1xjeB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjeA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjnB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjfB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjnC           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjfA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjnD           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjjB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjkA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjnA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjmB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjkB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjjA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjgA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjmA           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1xjgB           LMAFIALHAHRTSYELGKEKG-NFPLLEISRYRTEDNFVPFAMSNYDDEIREVMKM--------TKEFRR
1rp5B           Y---ANMMSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIG---------LAQLHEN------EDGSK
1rp5A           Y---ANMMSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIG---------LAQLHEN------EDGSK


                         .         .         .         *         .         .         .:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
1peuA           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
1peoA           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
1pemA           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
2bq1F           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
1peqA           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
2bq1E           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
2wghA           LKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPLLKDLTERGLGSIQS---IPEIPDDLKQLYKTVW
2wghB           LKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPLWEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVW
2cvtA           LRKDIMKHGVRNSLTMAPMPTASTNYLLRDLVDLGIWDEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2eudA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2zlfA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2cvxA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2cvwA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2cvuA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
1zyzB           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVGEFQVVNPLPNVPQELKDLYKTVW
1zyzA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVGEFQVVNPLPNVPQELKDLYKTVW
2cvsA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2zlgA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
1zzdA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
4r1rA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
2r1rA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
1rlrA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
7r1rA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
6r1rA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
1r1rA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
5r1rA           LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
1xjeB           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjeA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjnB           NVAL-----------LTIAPTGSISNIADTSSGLEPLREKLNEKELIEKGSLKDIPDVPEKIKKVFVVAL
1xjfB           NVAL-----------LTIAPTGSISNIADTSSGLEPNFLLAYTRLYVNQGSLKDIPDVPEKIKKVFVVAL
1xjnC           NVAL-----------LTIAPTGSISNIADTSSGLEPLAYTREPLLYVNQGSLKDIPDVPEKIKKVFVVAL
1xjfA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjnD           NVAL-----------LTIAPTGSISNIADTSSGLEPLNPEILEKELIEKGSLKDIPDVPEKIKKVFVVAL
1xjjB           NVAL-----------LTIAPTGSISNIADTSSGLEPNFLLAYTRFYVNQGSLKDIPDVPEKIKKVFVVAL
1xjkA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjnA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjmB           NVAL-----------LTIAPTGSISNIADTSSGLEPVNQVLREKXXXXXGSLKDIPDVPEKIKKVFVVAL
1xjkB           NVAL-----------LTIAPTGSISNIADTSSGLEPVNQVLREKXXXXXGSLKDIPDVPEKIKKVFVVAL
1xjjA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjgA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjmA           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1xjgB           NVAL-----------LTIAPTGSISNIADTSSGLEP----------------------------------
1rp5B           --SLLGTSGMESSLNSILAGTGIITYEKDRLGNIVPGTEQVSQQTVDGKDVY------------------
1rp5A           --SLLGTSGMESSLNSILAGTGIITYEKDRLGNIVPGTEQVSQQTVDGKDVY------------------


                         .         +         .         .         .         .         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDxxxxxxx
1peuA           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLR------------
1peoA           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLR------------
1pemA           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLR------------
2bq1F           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLR------------
1peqA           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLR------------
2bq1E           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLR------------
2wghA           EISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGK-LTSMHFYGWKQGLKTMYYLRTR------------
2wghB           EISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGK-LTSMHFYGWKQGLKTMYYLRTR------------
2cvtA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2eudA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2zlfA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2cvxA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2cvwA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2cvuA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
1zyzB           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
1zyzA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2cvsA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
2zlgA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
1zzdA           EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
4r1rA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRD-----------
2r1rA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRD-----------
1rlrA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRDDIDD-------
7r1rA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRD-----------
6r1rA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRD-----------
1r1rA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLFYQNTRD-----------
5r1rA           EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRD-----------
1xjeB           ----------------------------------------------------------------------
1xjeA           ----------------------------------------------------------------------
1xjnB           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjfB           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjnC           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjfA           ----------------------------------------------------------------------
1xjnD           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjjB           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjkA           ----------------------------------------------------------------------
1xjnA           ----------------------------------------------------------------------
1xjmB           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjkB           DIDPMDHLLMQDAFQRYVDNNISKTINMPQSATVDDVLNVYLEALRTNVRGI------------------
1xjjA           ----------------------------------------------------------------------
1xjgA           ----------------------------------------------------------------------
1xjmA           ----------------------------------------------------------------------
1xjgB           ----------------------------------------------------------------------
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------