[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:yoeD

[Show Plain Result]

#ERROR : Can't open dsspfile "1xx7F.bssp"

## Summary of PDB Search
:76
    2e-04  36%  1xx7F  [a.211.1] OXETANOCIN-LIKE PROTEIN
:76

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxEYTNLSEDYIKSLVLEGKIRAVHDGEQFLIYKEQFKTHLEQLENYKALVQEILNEPIPExx
1xx7F           ---------EYTELFEEYSKALTLEGQLVKIADKLDMIIYEYELSGAKNLSEFWNALISRYLREIIEE--


                         .         .         *         .         .         .         .:140
query           xxxxxx
1xx7F           ------