[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:menH

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh0B.bssp"
#ERROR : Can't open dsspfile "3dh0A.bssp"
#ERROR : Can't open dsspfile "1vl5A.bssp"
#ERROR : Can't open dsspfile "1ve3B.bssp"
#ERROR : Can't open dsspfile "1ve3A.bssp"
#ERROR : Can't open dsspfile "1wznA.bssp"
#ERROR : Can't open dsspfile "1vl5C.bssp"
#ERROR : Can't open dsspfile "1xxlA.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "3e7pA.bssp"
#ERROR : Can't open dsspfile "1kr5A.bssp"
#ERROR : Can't open dsspfile "1i1nA.bssp"
#ERROR : Can't open dsspfile "2o57D.bssp"
#ERROR : Can't open dsspfile "2o57C.bssp"
#ERROR : Can't open dsspfile "2o57B.bssp"
#ERROR : Can't open dsspfile "2o57A.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "3eeyG.bssp"
#ERROR : Can't open dsspfile "3eeyF.bssp"
#ERROR : Can't open dsspfile "3eeyC.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "3busB.bssp"
#ERROR : Can't open dsspfile "3busA.bssp"
#ERROR : Can't open dsspfile "2p8jB.bssp"
#ERROR : Can't open dsspfile "2p8jA.bssp"
#ERROR : Can't open dsspfile "3bkxA.bssp"
#ERROR : Can't open dsspfile "2yr0A.bssp"
#ERROR : Can't open dsspfile "2yqzA.bssp"
#ERROR : Can't open dsspfile "2h1rB.bssp"
#ERROR : Can't open dsspfile "1p91B.bssp"
#ERROR : Can't open dsspfile "1l3iA.bssp"
#ERROR : Can't open dsspfile "1p91A.bssp"

## Summary of PDB Search
:233
    2e-14  27%  3dh0B  [x.x.x] SAM DEPENDENT METHYLTRANSFERASE
    2e-14  27%  3dh0A  [x.x.x] SAM DEPENDENT METHYLTRANSFERASE
    3e-13  30%  1vl5A  [c.66.1] UNKNOWN CONSERVED PROTEIN BH2331
    9e-11  30%  1ve3B  [x.x.x] HYPOTHETICAL PROTEIN PH0226
    9e-11  30%  1ve3A  [x.x.x] HYPOTHETICAL PROTEIN PH0226
    1e-09  32%  1wznA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    9e-09  32%  1vl5C  [c.66.1] UNKNOWN CONSERVED PROTEIN BH2331
    1e-07  26%  1xxlA  [c.66.1] YCGJ PROTEIN
    1e-05  25%  1o54A  [c.66.1] SAM-DEPENDENT O-METHYLTRANSFERASE
    2e-05  26%  3e7pA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    3e-05  28%  1kr5A  [c.66.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    3e-05  28%  1i1nA  [c.66.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    4e-05  31%  2o57D  [x.x.x] PUTATIVE SARCOSINE DIMETHYLGLYCINE
    4e-05  31%  2o57C  [x.x.x] PUTATIVE SARCOSINE DIMETHYLGLYCINE
    4e-05  31%  2o57B  [x.x.x] PUTATIVE SARCOSINE DIMETHYLGLYCINE
    4e-05  31%  2o57A  [x.x.x] PUTATIVE SARCOSINE DIMETHYLGLYCINE
    1e-04  33%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  33%  3eeyG  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  33%  3eeyF  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  33%  3eeyC  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  33%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  33%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-04  30%  3busB  [x.x.x] METHYLTRANSFERASE
    1e-04  30%  3busA  [x.x.x] METHYLTRANSFERASE
    2e-04  27%  2p8jB  [x.x.x] S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE
    2e-04  27%  2p8jA  [x.x.x] S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE
    2e-04  41%  3bkxA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    3e-04  32%  2yr0A  [x.x.x] HYPOTHETICAL PROTEIN TTHA0223
    3e-04  32%  2yqzA  [x.x.x] HYPOTHETICAL PROTEIN TTHA0223
    4e-04  26%  2h1rB  [x.x.x] DIMETHYLADENOSINE TRANSFERASE, PUTATIVE
    5e-04  29%  1p91B  [c.66.1] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A
    5e-04  28%  1l3iA  [c.66.1] PRECORRIN-6Y METHYLTRANSFERASE/PUTATIVE
    6e-04  29%  1p91A  [c.66.1] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
3dh0B           ------------------------------------EKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVG
3dh0A           ------------------------------------EKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVG
1vl5A           ---------------------------------------LQIAALKGNEEVLDVATGGGHVANAFAPFVK
1ve3B           ------------YYRVFPTYTDINS----QEYRSRIETLEPLLKYKKRGKVLDLACGVGGFSFLLEDYGF
1ve3A           ------------YYRVFPTYTDINS----QEYRSRIETLEPLLKYKKRGKVLDLACGVGGFSFLLEDYGF
1wznA           ---------------------------------------------REVRRVLDLACGTGIPTLELAE---
1vl5C           ----------------------------------------------------------------------
1xxlA           -------------------------------------------------RVLDIGAGAGHTALAFSPYVQ
1o54A           -----------------------------------------MLDVKEGDRIIDTGVGSGAMCAVLARAVG
3e7pA           -----------------------------------------IDNLTNKSLIADLGCGTGGQTMILAQHV-
1kr5A           ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
1i1nA           ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
2o57D           ----------------------------------------------------------------------
2o57C           ----------------------------------------------------------------------
2o57B           ----------------------------------------------------------------------
2o57A           ----------------------------------------------------------------------
3eeyI           ------------------------------------------MFVKEGDTVVDATCGNGNDTAFLASLVG
3eeyG           ------------------------------------------MFVKEGDTVVDATCGNGNDTAFLASLVG
3eeyF           ------------------------------------------MFVKEGDTVVDATCGNGNDTAFLASLVG
3eeyC           ------------------------------------------MFVKEGDTVVDATCGNGNDTAFLASLVG
3eeyB           ------------------------------------------MFVKEGDTVVDATCGNGNDTAFLASLVG
3eeyA           ------------------------------------------MFVKEGDTVVDATCGNGNDTAFLASLVG
3busB           -----------------------------------------LLDVRSGDRVLDVGCGIGKPAVRLATA--
3busA           -----------------------------------------LLDVRSGDRVLDVGCGIGKPAVRLATA--
2p8jB           ----------------------------------------------------------------------
2p8jA           ----------------------------------------------------------------------
3bkxA           --------------------------------------------VKPGEKILEIGCGQGDLSAVLADQVG
2yr0A           ----------------------------------------------------------------------
2yqzA           ----------------------------------------------------------------------
2h1rB           ------------------------------------DKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK
1p91B           LPDSAEQARRAFLDA--GHYQPLRDAIVAQLRERLDDKATAV---------LDIGCGEGYYTHAFADALP
1l3iA           --------------------------------------------------AVDVGCGTGGVTLEL---AG
1p91A           ------------------HYQPLRDAIVAQLRERLDDKATAV---------LDIGCGEGYYTHAFADALP


                         .         .         *         .         .         .         .:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
3dh0B           EKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELK
3dh0A           EKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELK
1vl5A           K---VVAFDLTEDILKVARAFIEGNGHQQVEYVQGDA-EQPFTDERFHIVTCRIAAHHFPNPASFVSEAY
1ve3B           ---EVVGVDISEDIRKAREYKSRE---SNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEELNQVFKEVR
1ve3A           ---EVVGVDISEDIRKAREYKSRE---SNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEELNQVFKEVR
1wznA           RGYEVVGLDLHEEMLRVARRKAKERNL-KIEFLQGDVLEIAFKNE-FDAVTMFFSYFDEEDLRKLFSKVA
1vl5C           ----------------------------QVEYVQGDA-EQPFTDERFHIVTCRIAAHHFPNPASFVSEAY
1xxlA           ---ECIGVDATKEV-EVASSFAQEKGVENVRFQQGTAESLPFPDDSFDIITCRYAAHHFSDVRKAVREVA
1o54A           SSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGFDEKDVDALFL-----DVPDPWNYIDKCW
3e7pA           -PGKITGIDFFPGFIERFNKNAEKLNLNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNI-GFERGLKEWR
1kr5A           CTGKVIGIDHIKELVDDSVNNVRKDSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALI------
1i1nA           CTGKVIGIDHIKELVDDSVNNVRKDSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALI------
2o57D           -----------------------------ITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECA
2o57C           -----------------------------ITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECA
2o57B           -----------------------------ITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECA
2o57A           -----------------------------ITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECA
3eeyI           ENGRVFGFDIQDKAIANTTKKLTD----------------------------------------------
3eeyG           ENGRVFGFDIQDKAIANTTKKLTD----------------------------------------------
3eeyF           ENGRVFGFDIQDKAIANTTKKLTD----------------------------------------------
3eeyC           ENGRVFGFDIQDKAIANTTKKLTD----------------------------------------------
3eeyB           ENGRVFGFDIQDKAIANTTKKLTD----------------------------------------------
3eeyA           ENGRVFGFDIQDKAIANTTKKLTD----------------------------------------------
3busB           RDVRVTGISISRQVXXXXXXXXXXXXXXRVTFSYADA-DLPFEDASFDAVWALESLHH-PDRGRALRE-A
3busA           RDVRVTGISISRQVXXXXXXXXXXXXXXRVTFSYADA-DLPFEDASFDAVWALESLHH-PDRGRALRE-A
2p8jB           ------GIEISDLQLKKAENFSRENNF-KLNISKGDIRKLPFKDESSFVYSYGTIFHRKNDVKEAIDEIK
2p8jA           ------GIEISDLQLKKAENFSRENNF-KLNISKGDIRKLPFKDESSFVYSYGTIFHRKNDVKEAIDEIK
3bkxA           SSGHVTGIDIA-----------------------------------------------------------
2yr0A           --------------LEVFRQKIA-GVDRKVQVVQADARAIPLPDESVHGVIVVHLWHLVPDWPKVLAEAI
2yqzA           --------------LEVFRQKIA-GVDRKVQVVQADARAIPLPDESVHGVIVVHLWHLVPDWPKVLAEAI
2h1rB           K---VITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVF----------------------------
1p91B           EITTF-GLDVSKVAIKAAAKR-----YPQVTFCVASSHRLPFSDTSDAIIRIYAPCK--------AEELA
1l3iA           RVRRVYAIDRNPEAISTTE-NLQRHGLGDNVTLEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDK-
1p91A           EITTF-GLDVSKVAIKAAAKR-----YPQVTFCVASSHRLPFSDTSDAIIRIYAPCK--------AEELA


                         +         .         .         .         .         *         .:210
query           RVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEE
3dh0B           RVAKPFAYLAIIDWKKEE----------------------------------------------------
3dh0A           RVAKPFAYLAIIDWKKEE----------------------------------------------------
1vl5A           RVLKKGGQLLLVDNSAPE----NDAFDVFYNYVEKERDYSHHRAWKKSDWLK---------------LEE
1ve3B           RVLKPSGKFI------------------------------------------------------------
1ve3A           RVLKPSGKFI------------------------------------------------------------
1wznA           EALKPGGVFICGPVVWNEQKGEEKLVIMDWREVEPAVQKL------------------------------
1vl5C           RVLKKGGQLLLVDNSAPE----NDAFDVFYNYVEKERDYSHHRAWKKSDWLK---------------LEE
1xxlA           RVLKQDGRFLLVDHYAPE----------------------------------------------------
1o54A           EALKGGGRTVCPTTNQ------------------------------------------------------
3e7pA           NYLKPGGYLAVSES--------------------------------------------------------
1kr5A           DQLKPGGRLI------------------------------------------------------------
1i1nA           DQLKPGGRLI------------------------------------------------------------
2o57D           RVLKPRGVAI------------------------------------------------------------
2o57C           RVLKPRGVAI------------------------------------------------------------
2o57B           RVLKPRGVAI------------------------------------------------------------
2o57A           RVLKPRGVAI------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
3eeyG           ----------------------------------------------------------------------
3eeyF           ----------------------------------------------------------------------
3eeyC           ----------------------------------------------------------------------
3eeyB           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
3busB           RVLRPGGTV-------------------------------------------------------------
3busA           RVLRPGGTV-------------------------------------------------------------
2p8jB           RVLKPGG---------------------------------------------------------------
2p8jA           RVLKPGG---------------------------------------------------------------
3bkxA           ----------------------------------------------------------------------
2yr0A           RVLKPGGALL------------------------------------------------------------
2yqzA           RVLKPGGALL------------------------------------------------------------
2h1rB           ----------------------------------------------------------------------
1p91B           RVVKPGGWVI------------------------------------------------------------
1l3iA           --LKPGGRII------------------------------------------------------------
1p91A           RVVKPGGWVI------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGLKNVKYHSFxxxxxxxxxxxx
3dh0B           -----------------------
3dh0A           -----------------------
1vl5A           AGFELEELHCF------------
1ve3B           -----------------------
1ve3A           -----------------------
1wznA           -----------------------
1vl5C           AGFELEELHCF------------
1xxlA           -----------------------
1o54A           -----------------------
3e7pA           -----------------------
1kr5A           -----------------------
1i1nA           -----------------------
2o57D           -----------------------
2o57C           -----------------------
2o57B           -----------------------
2o57A           -----------------------
3eeyI           -----------------------
3eeyG           -----------------------
3eeyF           -----------------------
3eeyC           -----------------------
3eeyB           -----------------------
3eeyA           -----------------------
3busB           -----------------------
3busA           -----------------------
2p8jB           -----------------------
2p8jA           -----------------------
3bkxA           -----------------------
2yr0A           -----------------------
2yqzA           -----------------------
2h1rB           -----------------------
1p91B           -----------------------
1l3iA           -----------------------
1p91A           -----------------------