[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bsub0:ureC

[Show Plain Result]

#ERROR : Can't open dsspfile "1ubpC.bssp"
#ERROR : Can't open dsspfile "1ie7C.bssp"
#ERROR : Can't open dsspfile "1kraC.bssp"
#ERROR : Can't open dsspfile "1a5kC.bssp"
#ERROR : Can't open dsspfile "1a5mC.bssp"
#ERROR : Can't open dsspfile "1a5oC.bssp"
#ERROR : Can't open dsspfile "1krcC.bssp"
#ERROR : Can't open dsspfile "1ejwC.bssp"
#ERROR : Can't open dsspfile "1ejsC.bssp"
#ERROR : Can't open dsspfile "1ejtC.bssp"
#ERROR : Can't open dsspfile "1fwaC.bssp"
#ERROR : Can't open dsspfile "1krbC.bssp"
#ERROR : Can't open dsspfile "1fwgC.bssp"
#ERROR : Can't open dsspfile "1fwhC.bssp"
#ERROR : Can't open dsspfile "1ejxC.bssp"
#ERROR : Can't open dsspfile "1a5nC.bssp"
#ERROR : Can't open dsspfile "1ejuC.bssp"
#ERROR : Can't open dsspfile "1fweC.bssp"
#ERROR : Can't open dsspfile "1ejrC.bssp"
#ERROR : Can't open dsspfile "1fwfC.bssp"
#ERROR : Can't open dsspfile "1fwiC.bssp"
#ERROR : Can't open dsspfile "1e9zB.bssp"
#ERROR : Can't open dsspfile "1a5lC.bssp"
#ERROR : Can't open dsspfile "1e9yB.bssp"
#ERROR : Can't open dsspfile "2fvkD.bssp"
#ERROR : Can't open dsspfile "2ftyD.bssp"
#ERROR : Can't open dsspfile "2ftyC.bssp"
#ERROR : Can't open dsspfile "2ftyA.bssp"
#ERROR : Can't open dsspfile "1nfgA.bssp"
#ERROR : Can't open dsspfile "1gkrA.bssp"
#ERROR : Can't open dsspfile "3gipA.bssp"
#ERROR : Can't open dsspfile "3hm7C.bssp"
#ERROR : Can't open dsspfile "3hm7B.bssp"
#ERROR : Can't open dsspfile "3hm7A.bssp"
#ERROR : Can't open dsspfile "2ftwA.bssp"

## Summary of PDB Search
:569
      0.0  60%  1ubpC  [b.92.1 - c.1.9] UREASE
      0.0  60%  1ie7C  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  66%  1kraC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1a5kC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
      0.0  65%  1a5mC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
      0.0  65%  1a5oC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
      0.0  65%  1krcC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1ejwC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  65%  1ejsC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  65%  1ejtC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  65%  1fwaC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1krbC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1fwgC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1fwhC  [b.92.1 - c.1.9] UREASE
      0.0  66%  1ejxC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  65%  1a5nC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
      0.0  65%  1ejuC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  65%  1fweC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1ejrC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
      0.0  65%  1fwfC  [b.92.1 - c.1.9] UREASE
      0.0  65%  1fwiC  [b.92.1 - c.1.9] UREASE
      0.0  56%  1e9zB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
      0.0  65%  1a5lC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
      0.0  56%  1e9yB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    4e-07  37%  2fvkD  [x.x.x] DIHYDROPYRIMIDINASE
    4e-07  37%  2ftyD  [x.x.x] DIHYDROPYRIMIDINASE
    4e-07  37%  2ftyC  [x.x.x] DIHYDROPYRIMIDINASE
    4e-07  37%  2ftyA  [x.x.x] DIHYDROPYRIMIDINASE
    1e-06  36%  1nfgA  [b.92.1 - c.1.9] D-HYDANTOINASE
    2e-05  40%  1gkrA  [b.92.1 - c.1.9] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE
    2e-04  42%  3gipA  [x.x.x] N-ACYL-D-GLUTAMATE DEACYLASE
    2e-04  33%  3hm7C  [x.x.x] ALLANTOINASE
    2e-04  33%  3hm7B  [x.x.x] ALLANTOINASE
    2e-04  33%  3hm7A  [x.x.x] ALLANTOINASE
    2e-04  35%  2ftwA  [x.x.x] DIHYDROPYRIMIDINE AMIDOHYDROLASE
:569

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
1ubpC           MKINRQQYAESYGPTVGDEVRLADTDLWIEVEKDYTTYGDEVNFGGGKVLREGMGENGTYTRTENVXXXX
1ie7C           MKINRQQYAESYGPTVGDEVRLADTDLWIEVEKDYTTYGDEVNFGGGKVLREGMGENGTYTRTENVXXXX
1kraC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1a5kC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1a5mC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1a5oC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1krcC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1ejwC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1ejsC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1ejtC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1fwaC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1krbC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1fwgC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1fwhC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1ejxC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1a5nC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1ejuC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1fweC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1ejrC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1fwfC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1fwiC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1e9zB           -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
1a5lC           --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
1e9yB           -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
2fvkD           -------------------------------------------------------------------DLI
2ftyD           -------------------------------------------------------------------DLI
2ftyC           -------------------------------------------------------------------DLI
2ftyA           -------------------------------------------------------------------DLI
1nfgA           ------------------------------------------------------------------MDII
1gkrA           -------------------------------------------------------------------DVI
3gipA           ------------------------------------------------------------------LDFK
3hm7C           -------------------------------------------------------------------DLI
3hm7B           -------------------------------------------------------------------DLI
3hm7A           -------------------------------------------------------------------DLI
2ftwA           --------------------------------------------------------------------IL


                         .         .         *         .         .         .         .:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
1ubpC           XXXXXXXDYTGIYKADIGVKDGYIVGIGKGGNPDIMDGVTPNMIVGTATEVIAAEGKIVTAGGIDTHVHF
1ie7C           XXXXXXXDYTGIYKADIGVKDGYIVGIGKGGNPDIMDGVTPNMIVGTATEVIAAEGKIVTAGGIDTHVHF
1kraC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1a5kC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1a5mC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1a5oC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1krcC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejwC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejsC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejtC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1fwaC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1krbC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1fwgC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1fwhC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejxC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1a5nC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejuC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1fweC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejrC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1fwfC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1fwiC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTAIHW
1e9zB           ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
1a5lC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1e9yB           ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
2fvkD           IKNGIICTASDIYAAEIAVNNGKVQLIAASIDPSL------------GSEVIDAEGAFITPGGIDAHVH-
2ftyD           IKNGIICTASDIYAAEIAVNNGKVQLIAASIDPSL------------GSEVIDAEGAFITPGGIDAHVH-
2ftyC           IKNGIICTASDIYAAEIAVNNGKVQLIAASIDPSL------------GSEVIDAEGAFITPGGIDAHVH-
2ftyA           IKNGIICTASDIYAAEIAVNNGKVQLIAASIDPSL------------GSEVIDAEGAFITPGGIDAHVH-
1nfgA           IKNGTIVTADGISRADLGIKDGKITQIGGA--------------LGPAERTIDAAGRYVFPGGIDVHTH-
1gkrA           VKNCRLVSSDGITEADILVKDGKVAAI----SADTSD-VEASRTIDAG-------GKFVMPGVVDEHVHI
3gipA           ITGGWIIDGTGAPRADLGVRDGRIAAIGELGAHPARHAWD-------------ASGKIVAPGFIDVHGH-
3hm7C           IRSSTVVTETTTYRADVAIRNGIVSAITEPGSISSDDG-----------PAIDGTGLHLFPGMVDVHVHF
3hm7B           IRSSTVVTETTTYRADVAIRNGIVSAITEPGSISSDDG-----------PAIDGTGLHLFPGMVDVHVHF
3hm7A           IRSSTVVTETTTYRADVAIRNGIVSAITEPGSISSDDG-----------PAIDGTGLHLFPGMVDVHVHF
2ftwA           IKNGTVVNDDRYFKSDVLVENGIIKEISKNIEPK------------EGIKVVDATDKLLLPGGIDTHTHF


                         +         .         .         .         .         *         .:210
query           ICPQQMEVXXXXXXXXXXXXXXXXXXXXXXXXCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
1ubpC           INPDQVDVALANGITTLFGGGTGPAEGSKATTVTPGPWNIEKMLKSTEGLPINVGILGKGHGSSIAPIME
1ie7C           INPDQVDVALANGITTLFGGGTGPAEGSKATTVTPGPWNIEKMLKSTEGLPINVGILGKGHGSSIAPIME
1kraC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5kC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5mC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5oC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1krcC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejwC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejsC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejtC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1fwaC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1krbC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1fwgC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1fwhC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejxC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5nC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejuC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1fweC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejrC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1fwfC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1fwiC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1e9zB           ISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLAD
1a5lC           ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1e9yB           ISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLAD
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
1gkrA           I---------------------------------------------------------------------
3gipA           ----------------------------------------------------------------------
3hm7C           NEPGRTE---------------------------------------------------------------
3hm7B           NEPGRTE---------------------------------------------------------------
3hm7A           NEPGRTE---------------------------------------------------------------
2ftwA           QLP-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QVEAGAIGLKLHEDWGTTPSAIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAG
1ubpC           QIDAGAAGL-IHEDWGATPASIDRSLTVADEADVQVAIHSDTLNEAGFLEDTLRAINGRVIHSFHVEGAG
1ie7C           QIDAGAAGL-IHEDWGATPASIDRSLTVADEADVQVAIHSDTLNEAGFLEDTLRAINGRVIHSFHVEGAG
1kraC           QVAAGVIGLKIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5kC           QVAAGVIGLEIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5mC           QVAAGVIGLAIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5oC           QVAAGVIGLCIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1krcC           QVAAGVIGLKIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejwC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejsC           QVAAGVIGL-INEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejtC           QVAAGVIGL-IQEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1fwaC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1krbC           QVAAGVIGL-IAEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1fwgC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1fwhC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejxC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5nC           QVAAGVIGLAIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejuC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1fweC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejrC           QVAAGVIGL-IHEAWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1fwfC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1fwiC           QVAAGVIGL-IHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1e9zB           QIEAGAIGF-IHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAG
1a5lC           QVAAGVIGLCIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1e9yB           QIEAGAIGF-IHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAG
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3gipA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GGHAPDIMKLASYANILPSSTTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDI
1ubpC           GGHAPDIMAMAGHPNVLPSSTNPTRPFTVNTIDEHLDMLMVCHHLKQNIPEDVAFADSRIRPETIAAEDI
1ie7C           GGHAPDIMAMAGHPNVLPSSTNPTRPFTVNTIDEHLDMLMVCHHLKNNIPEDVAFADSRIRPETIAAEDI
1kraC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1a5kC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1a5mC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1a5oC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1krcC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCAHLDPDIAEDVAFAESRIRRETIAAEDV
1ejwC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1ejsC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1ejtC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1fwaC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVAHHLDPDIAEDVAFAESRIRRETIAAEDV
1krbC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1fwgC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVSHHLDPDIAEDVAFAESRIRRETIAAEDV
1fwhC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVYHHLDPDIAEDVAFAESRIRRETIAAEDV
1ejxC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVC----------VAFAESRIRRETIAAEDV
1a5nC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDM---------------AFAESRIRRETIAAEDV
1ejuC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLM-------------AFAESRIRRETIAAEDV
1fweC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLM--------------FAESRIRRETIAAEDV
1ejrC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLM-------------AFAESRIRRETIAAEDV
1fwfC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDML---------------FAESRIRRETIAAEDV
1fwiC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDML---------------FAESRIRRETIAAEDV
1e9zB           GGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDT
1a5lC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTRE------------------------------TIAAEDV
1e9yB           GGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHKDKSIKEDVQFADSRIRPQTIAAEDT
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3gipA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LHDIGAISMTSSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
1ubpC           LHDLGIISMMSTDALAMGRAGEMVLRTWQTADKMKKQRGPLAEENGSDNFRLKRYVSKYTINPAIAQGIA
1ie7C           LHDLGIISMMSTDALAMGRAGEMVLRTWQTADKMKKQRGPLAEENGSDNFRLKRYVSKYTINPAIAQGIA
1kraC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1a5kC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1a5mC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1a5oC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1krcC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejwC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejsC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejtC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1fwaC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1krbC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1fwgC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1fwhC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejxC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1a5nC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejuC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1fweC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejrC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1fwfC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1fwiC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1e9zB           LHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGNDNFRIKRYLSKYTINPAIAHGIS
1a5lC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1e9yB           LHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGNDNFRIKRYLSKYTINPAIAHGIS
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3gipA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYASYGKANRSTS
1ubpC           HEVGSIEEGKFADLVLWEPKFFGVKADRVIKGGIIAYAQIGDPSASIPTPQPVMGRRMYGTVGDLIHDTN
1ie7C           HEVGSIEEGKFADLVLWEPKFFGVKADRVIKGGIIAYAQIGDPSASIPTPQPVMGRRMYGTVGDLIHDTN
1kraC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5kC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5mC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5oC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1krcC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejwC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejsC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejtC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1fwaC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1krbC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1fwgC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1fwhC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejxC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5nC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejuC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1fweC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejrC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1fwfC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1fwiC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1e9zB           EYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDAN
1a5lC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1e9yB           EYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDAN
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3gipA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDPKTYQVFADGEELSCQPVDYV
1ubpC           ITFMSKSSIQQGVPAKLGLKRRIGTVKNCRNIGKKDMKWNDVTTDIDINPETYEVKVDGEVLTCEPVKEL
1ie7C           ITFMSKSSIQQGVPAKLGLKRRIGTVKNCRNIGKKDMKWNDVTTDIDINPETYEVKVDGEVLTCEPVKEL
1kraC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5kC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5mC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5oC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1krcC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejwC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejsC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejtC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1fwaC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1krbC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1fwgC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1fwhC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejxC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5nC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejuC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1fweC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejrC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1fwfC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1fwiC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1e9zB           ITFVSQAAYDKGIKEELGLERQVLPVKNCRNVTKKDMQFNNTTAHIEVNPETYHVFVDGKEVTSKPANKV
1a5lC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1e9yB           ITFVSQAAYDKGIKEELGLERQVLPVKNCRNVTKKDMQFNNTTAHIEVNPETYHVFVDGKEVTSKPANKV
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3gipA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PLGQRYFLF
1ubpC           PMAQRYFLF
1ie7C           PMAQRYFLF
1kraC           PMAQRYFLF
1a5kC           PMAQRYFLF
1a5mC           PMAQRYFLF
1a5oC           PMAQRYFLF
1krcC           PMAQRYFLF
1ejwC           PMAQRYFLF
1ejsC           PMAQRYFLF
1ejtC           PMAQRYFLF
1fwaC           PMAQRYFLF
1krbC           PMAQRYFLF
1fwgC           PMAQRYFLF
1fwhC           PMAQRYFLF
1ejxC           PMAQRYFLF
1a5nC           PMAQRYFLF
1ejuC           PMAQRYFLF
1fweC           PMAQRYFLF
1ejrC           PMAQRYFLF
1fwfC           PMAQRYFLF
1fwiC           PMAQRYFLF
1e9zB           SLAQLFSIF
1a5lC           PMAQRYFLF
1e9yB           SLAQLFSIF
2fvkD           ---------
2ftyD           ---------
2ftyC           ---------
2ftyA           ---------
1nfgA           ---------
1gkrA           ---------
3gipA           ---------
3hm7C           ---------
3hm7B           ---------
3hm7A           ---------
2ftwA           ---------