[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB11952.2

[Show Plain Result]


## Summary of Sequence Search
    1::483
    1::410       0.0 100%  483 aa  YBBR_BACSU RecName: Full=YbbR-like domain-containing protein
   79::235     7e-05  27%  584 aa  OMP7_STAAE RecName: Full=65 kDa membrane protein;AltName:
   79::235     7e-05  27%  684 aa  OMP7_STAAC RecName: Full=77 kDa membrane protein;Flags: Precursor;
   72::180     7e-05  29%  689 aa  MAP1_STAAU RecName: Full=Protein map;AltName: Full=MHC class II
   72::180     7e-05  29%  689 aa  MAP1_STAAR RecName: Full=Protein map;AltName: Full=MHC class II
 1513::1561    3e-04  50% 2151 aa  RRPL_HANTV RecName: Full=RNA-directed RNA polymerase;       
  576::661     8e-04  27% 1001 aa  RPGR_MOUSE RecName: Full=X-linked retinitis pigmentosa GTPase
  101::154     8e-04  30%  253 aa  KDSB_NEIG2 RecName: Full=3-deoxy-manno-octulosonate
  101::154     8e-04  30%  253 aa  KDSB_NEIG1 RecName: Full=3-deoxy-manno-octulosonate
    1::483

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDKFLNNRWAVKXXXXXXXXXXYVAVNSNQAPTPKKPGESFFPTSTTDEATLTDIPVKAYYDDENYVVTG
YBBR_BACSU      MDKFLNNRWAVKXXXXXXXXXXYVAVNSNQAPTPKKPGESFFPTSTTDEATLTDIPVKAYYDDENYVVTG
OMP7_STAAE      ----------------------------------------------------------------------
OMP7_STAAC      ----------------------------------------------------------------------
MAP1_STAAU      ----------------------------------------------------------------------
MAP1_STAAR      ----------------------------------------------------------------------
RRPL_HANTV      ----------------------------------------------------------------------
RPGR_MOUSE      ----------------------------------------------------------------------
KDSB_NEIG2      ----------------------------------------------------------------------
KDSB_NEIG1      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHLKTGTHKVELKAKNVSDGLTISINPSVTTVTIQERTT
YBBR_BACSU      VPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHLKTGTHKVELKAKNVSDGLTISINPSVTTVTIQERTT
OMP7_STAAE      ----------------------------------------------------------------------
OMP7_STAAC      ----------------------------------------------------------------------
MAP1_STAAU      ----------------------------------------------------------------------
MAP1_STAAR      ----------------------------------------------------------------------
RRPL_HANTV      ----------------------------------------------------------------------
RPGR_MOUSE      ----------------------------------------------------------------------
KDSB_NEIG2      ----------------------------------------------------------------------
KDSB_NEIG1      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKNVIDNISLVKASVNLENADETIEKEAKVTVYDK
YBBR_BACSU      KSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKNVIDNISLVKASVNLENADETIEKEAKVTVYDK
OMP7_STAAE      ------------------------------------KDLEDRVSVLKSDRGISDIDLRLSKQAKYTVYFK
OMP7_STAAC      ------------------------------------KDLEDRVSVLKSDRGISDIDLRLSKQAKYTVYFK
MAP1_STAAU      ----------------------------KNQQIS-YKDIENKVSVLYFNRGISDIDLRLSKQAKYTVHFK
MAP1_STAAR      ----------------------------KNQQIS-YKDIENKVSVLYFNRGISDIDLRLSKQAKYTVHFK
RRPL_HANTV      ----------------------------------------------------------------------
RPGR_MOUSE      ----------------------------------------------------------------------
KDSB_NEIG2      ---------------------DEPLIAPELIDRTAEVLVENNVQMATAGHELHDFDELMNPNAVKVVLDK
KDSB_NEIG1      ---------------------DEPLIAPELIDRTAEVLVENNVQMATAGHELHDFDELMNPNAVKVVLDK


                         .         .         .         +         .         .         .:280
query           DGNALPVDVEPSVIKITVPVTSPSKKVPFKIERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDG
YBBR_BACSU      DGNALPVDVEPSVIKITVPVTSPSKKVPFKIERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDG
OMP7_STAAE      NGTKKVIDLKAGIYTADLINTSEIKAININVXXXXXXXXXXXXXANYQVPYTITVNGSQNILSNLTF---
OMP7_STAAC      NGTKKVIDLKAGIYTADLINTSEIKAININVXXXXXXXXXXXXXANYQVPYTITVNGSQNILSNLTF---
MAP1_STAAU      NGTKRVVDLKAGIHTADLINTSDIKAISVNVDTKKQVKDKEAKANVQ-VPYTITVNGSQNILSNLTF---
MAP1_STAAR      NGTKRVVDLKAGIHTADLINTSDIKAISVNVDTKKQVKDKEAKANVQ-VPYTITVNGSQNILSNLTF---
RRPL_HANTV      ----------------------------------------------------VTVEEMSDVLDTAKFPDS
RPGR_MOUSE      ---------------------------------------------LEAFSDEEVGNGLDQVEEPRVFTDG
KDSB_NEIG2      NGNAI-----------------------------------------------------------------
KDSB_NEIG1      NGNAI-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VSLDLSKINKDSDIEADIPLPDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQNIEFLDPESQ
YBBR_BACSU      VSLDLSKINKDSDIEADIPLPDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQNIEFLDPESQ
OMP7_STAAE      --------NKNQNISYK-DLEDKVKSVLESNVDLRLSKQAKYTVNFKNGTKKVIDLKS------------
OMP7_STAAC      --------NKNQNISYK-DLEDKVKSVLESNVDLRLSKQAKYTVNFKNGTKKVIDLKS------------
MAP1_STAAU      ----------------------------------------------------------------------
MAP1_STAAR      ----------------------------------------------------------------------
RRPL_HANTV      LSVDL-KTMKDGELGLDISLPDVMKRIAP-----------------------------------------
RPGR_MOUSE      KGLQSRQVGKESDEEIVSEKKTEVMEVADVKKIRESEENSKSDSLFDDLPDKTMNSESEDN---------
KDSB_NEIG2      ----------------------------------------------------------------------
KDSB_NEIG1      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIDVTAKGSPTNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTWSLGRKNAKIKLxxxxxxxxxx
YBBR_BACSU      AIDVTAKGSPTNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTWSLGRKNAKIKL----------
OMP7_STAAE      ----------------------------------------------------------------------
OMP7_STAAC      ----------------------------------------------------------------------
MAP1_STAAU      ----------------------------------------------------------------------
MAP1_STAAR      ----------------------------------------------------------------------
RRPL_HANTV      ----------------------------------------------------------------------
RPGR_MOUSE      ----------------------------------------------------------------------
KDSB_NEIG2      ----------------------------------------------------------------------
KDSB_NEIG1      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YBBR_BACSU      ---------------------------------------------------------------
OMP7_STAAE      ---------------------------------------------------------------
OMP7_STAAC      ---------------------------------------------------------------
MAP1_STAAU      ---------------------------------------------------------------
MAP1_STAAR      ---------------------------------------------------------------
RRPL_HANTV      ---------------------------------------------------------------
RPGR_MOUSE      ---------------------------------------------------------------
KDSB_NEIG2      ---------------------------------------------------------------
KDSB_NEIG1      ---------------------------------------------------------------