[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB12237.1

[Show Plain Result]


## Summary of Sequence Search
    1::420
    1::420       0.0 100%  420 aa  YDAM_BACSU RecName: Full=Uncharacterized glycosyltransferase ydaM; 
    8::374     6e-35  29%  412 aa  ICAA_STAAR RecName: Full=Biofilm PIA synthesis
    8::374     6e-35  29%  412 aa  ICAA_STAAN RecName: Full=Biofilm PIA synthesis
    8::374     6e-35  29%  412 aa  ICAA_STAAM RecName: Full=Biofilm PIA synthesis
    8::374     6e-35  29%  412 aa  ICAA_STAAC RecName: Full=Biofilm PIA synthesis
    8::374     6e-35  29%  412 aa  ICAA_STAA8 RecName: Full=Biofilm PIA synthesis
    8::374     8e-35  29%  412 aa  ICAA_STAAW RecName: Full=Biofilm PIA synthesis
    8::374     8e-35  29%  412 aa  ICAA_STAAS RecName: Full=Biofilm PIA synthesis
    8::287     3e-33  30%  412 aa  ICAA_STAEP RecName: Full=Biofilm PIA synthesis
    8::287     1e-32  29%  412 aa  ICAA_STAEQ RecName: Full=Biofilm PIA synthesis
   41::319     2e-23  28%  441 aa  PGAC_ECOLI RecName: Full=Biofilm PGA synthesis
   41::319     3e-23  28%  441 aa  PGAC_ECO57 RecName: Full=Biofilm PGA synthesis
  122::377     1e-20  28%  552 aa  CSLAA_ARATH RecName: Full=Probable mannan synthase 10;       
   85::343     6e-18  23%  526 aa  CSLA1_CYATE RecName: Full=Mannan synthase 1;       
   48::282     8e-18  33%  424 aa  NODC_RHILV RecName: Full=N-acetylglucosaminyltransferase;       
   97::332     8e-18  27%  533 aa  CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9;
   74::368     1e-17  22%  556 aa  CSLA7_ARATH RecName: Full=Probable mannan synthase 7;       
   10::268     2e-17  26%  443 aa  CSLAB_ARATH RecName: Full=Probable mannan synthase 11;       
  118::370     3e-17  28%  570 aa  CSLAB_ORYSJ RecName: Full=Probable mannan synthase 11;       
   46::283     4e-17  31%  426 aa  NODC_RHIME RecName: Full=N-acetylglucosaminyltransferase;       
  235::476     4e-17  26%  699 aa  CSLCC_ARATH RecName: Full=Probable xyloglucan glycosyltransferase
  112::363     6e-17  27%  549 aa  CSLA4_ORYSJ RecName: Full=Probable mannan synthase 4;       
  111::366     7e-17  27%  537 aa  CSLAF_ARATH RecName: Full=Probable mannan synthase 15;       
  147::384     7e-17  30%  585 aa  CSLA7_ORYSJ RecName: Full=Probable mannan synthase 7;       
  134::378     7e-17  27%  574 aa  CSLA5_ORYSJ RecName: Full=Probable mannan synthase 5;       
  225::462     9e-17  26%  690 aa  CSLC8_ARATH RecName: Full=Probable xyloglucan glycosyltransferase
  141::393     2e-16  26%  574 aa  CSLA6_ORYSJ RecName: Full=Probable mannan synthase 6;       
  228::463     3e-16  26%  686 aa  CSLCA_ORYSJ RecName: Full=Putative xyloglucan glycosyltransferase
  228::463     3e-16  26%  686 aa  CSLCA_ORYSI RecName: Full=Putative xyloglucan glycosyltransferase
  225::462     4e-16  25%  692 aa  CSLC5_ARATH RecName: Full=Probable xyloglucan glycosyltransferase
  228::465     5e-16  26%  688 aa  CSLC7_ORYSJ RecName: Full=Probable xyloglucan glycosyltransferase
   82::379     8e-16  25%  553 aa  CSLA1_ARATH RecName: Full=Probable mannan synthase 1;       
   84::339     1e-15  25%  521 aa  CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1;
  231::468     1e-15  26%  690 aa  CSLC1_ORYSJ RecName: Full=Probable xyloglucan glycosyltransferase
   97::351     3e-15  25%  534 aa  CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2;
  158::434     5e-15  27%  673 aa  CSLC4_ARATH RecName: Full=Xyloglucan glycosyltransferase 4;        
   82::344     5e-15  22%  527 aa  CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9;       
   49::283     1e-14  30%  413 aa  NODC_RHISN RecName: Full=N-acetylglucosaminyltransferase;       
  120::372     1e-14  23%  556 aa  CSLA3_ARATH RecName: Full=Probable mannan synthase 3;       
  140::389     1e-14  24%  595 aa  CSLC9_ORYSJ RecName: Full=Probable xyloglucan glycosyltransferase
  115::350     2e-14  27%  551 aa  CSLA3_ORYSJ RecName: Full=Probable mannan synthase 3;       
   49::283     3e-14  32%  450 aa  NODC_RHIS3 RecName: Full=N-acetylglucosaminyltransferase;       
  145::378     3e-14  27%  580 aa  CSLA2_ORYSJ RecName: Full=Probable mannan synthase 2;       
  145::386     3e-14  26%  739 aa  BCSA_PSEFS RecName: Full=Cellulose synthase catalytic subunit
  217::473     4e-14  23%  682 aa  CSLC6_ARATH RecName: Full=Probable xyloglucan glycosyltransferase
  234::500     4e-14  24%  872 aa  BCSA_ECOLI RecName: Full=Cellulose synthase catalytic subunit
  234::500     6e-14  23%  874 aa  BCSA_SALTI RecName: Full=Cellulose synthase catalytic subunit
  234::500     6e-14  24%  872 aa  BCSA_ECO57 RecName: Full=Cellulose synthase catalytic subunit
  233::472     7e-14  24%  698 aa  CSLC2_ORYSJ RecName: Full=Probable xyloglucan glycosyltransferase
  233::472     7e-14  24%  698 aa  CSLC2_ORYSI RecName: Full=Probable xyloglucan glycosyltransferase
  234::500     7e-14  24%  874 aa  BCSA_SALTY RecName: Full=Cellulose synthase catalytic subunit
   49::283     1e-13  28%  424 aa  NODC_RHILO RecName: Full=N-acetylglucosaminyltransferase;       
  261::512     1e-13  22%  745 aa  CSLC3_ORYSJ RecName: Full=Probable xyloglucan glycosyltransferase
   92::344     6e-13  24%  535 aa  CSLAE_ARATH RecName: Full=Probable mannan synthase 14;       
   48::282     1e-12  27%  397 aa  NODC_AZOC5 RecName: Full=N-acetylglucosaminyltransferase;       
  151::376     2e-12  25% 1550 aa  ACSA1_ACEXY RecName: Full=Cellulose synthase 1;Includes:  RecName:
  147::374     2e-12  24% 1596 aa  ACSA2_ACEXY RecName: Full=Cellulose synthase 2;Includes:  RecName:
  144::376     7e-12  22%  745 aa  BCSA3_ACEXY RecName: Full=Cellulose synthase 1 catalytic subunit
  140::373     9e-12  24% 1518 aa  BCSA5_ACEXY RecName: Full=Putative cellulose synthase 3;Includes:
  140::373     9e-12  24% 1518 aa  BCSA4_ACEXY RecName: Full=Putative cellulose synthase 2;Includes:
   48::283     1e-11  28%  433 aa  NODC_RHIGA RecName: Full=N-acetylglucosaminyltransferase;       
    1::125     2e-11  34%  323 aa  ARNC_WIGBR RecName: Full=Undecaprenyl-phosphate
    4::108     2e-11  42%  327 aa  ARNC_PECCP RecName: Full=Undecaprenyl-phosphate
  143::378     5e-11  20%  756 aa  BCSA2_ACEXY RecName: Full=Cellulose synthase catalytic subunit
  143::376     5e-11  21%  754 aa  BCSA1_ACEXY RecName: Full=Cellulose synthase catalytic subunit
    4::108     5e-11  41%  327 aa  ARNC_ERWCT RecName: Full=Undecaprenyl-phosphate
    2::109     6e-11  38%  325 aa  ARNC_PHOLL RecName: Full=Undecaprenyl-phosphate
   56::283     5e-10  31%  485 aa  NODC_BRAJA RecName: Full=N-acetylglucosaminyltransferase;       
    5::110     7e-10  35%  326 aa  ARNC_PROMH RecName: Full=Undecaprenyl-phosphate
    4::110     1e-09  38%  326 aa  ARNC_SERP5 RecName: Full=Undecaprenyl-phosphate
   65::203     1e-09  33%  419 aa  HASA_STRPY RecName: Full=Hyaluronan synthase;       
   65::203     1e-09  33%  419 aa  HASA_STRP8 RecName: Full=Hyaluronan synthase;       
   65::203     1e-09  33%  419 aa  HASA_STRP6 RecName: Full=Hyaluronan synthase;       
   65::203     1e-09  33%  419 aa  HASA_STRP3 RecName: Full=Hyaluronan synthase;       
   65::203     1e-09  33%  419 aa  HASA_STRP1 RecName: Full=Hyaluronan synthase;       
    2::94      1e-09  33%  344 aa  EPSH_BACSU RecName: Full=Putative glycosyltransferase epsH;        
    3::110     2e-09  33%  325 aa  ARNC_EDWI9 RecName: Full=Undecaprenyl-phosphate
   86::384     2e-09  28%  588 aa  HAS1_XENLA RecName: Full=Hyaluronan synthase 1;       
    9::109     3e-09  35%  337 aa  ARNC_PSEU2 RecName: Full=Undecaprenyl-phosphate
    9::109     3e-09  38%  339 aa  ARNC_PSEF5 RecName: Full=Undecaprenyl-phosphate
    5::110     4e-09  36%  327 aa  ARNC_YERE8 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-09  39%  322 aa  ARNC_ECOLU RecName: Full=Undecaprenyl-phosphate
    9::146     7e-09  33%  339 aa  ARNC_PSEAE RecName: Full=Undecaprenyl-phosphate
    9::146     7e-09  33%  339 aa  ARNC_PSEAB RecName: Full=Undecaprenyl-phosphate
    9::146     7e-09  33%  339 aa  ARNC_PSEA8 RecName: Full=Undecaprenyl-phosphate
    9::146     7e-09  32%  339 aa  ARNC_PSEA7 RecName: Full=Undecaprenyl-phosphate
    9::110     7e-09  39%  322 aa  ARNC_ECOSM RecName: Full=Undecaprenyl-phosphate
  132::348     9e-09  23%  513 aa  YTH1_RHOER RecName: Full=Uncharacterized 55.3 kDa protein in thcA
    2::93      9e-09  33%  344 aa  EPSJ_BACSU RecName: Full=Uncharacterized glycosyltransferase epsJ; 
    9::110     9e-09  39%  322 aa  ARNC_ECO5E RecName: Full=Undecaprenyl-phosphate
    9::110     9e-09  39%  322 aa  ARNC_ECO57 RecName: Full=Undecaprenyl-phosphate
    1::126     1e-08  30%  323 aa  Y1578_HAEIN RecName: Full=Uncharacterized glycosyltransferase
  104::380     1e-08  23%  729 aa  BCSA_XANAC RecName: Full=Cellulose synthase catalytic subunit
    9::109     1e-08  37%  337 aa  ARNC_PSE14 RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECO7I RecName: Full=Undecaprenyl-phosphate
   60::180     2e-08  35%  324 aa  ALG5_MOUSE RecName: Full=Dolichyl-phosphate
   60::180     2e-08  37%  324 aa  ALG5_HUMAN RecName: Full=Dolichyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_SHISS RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_SHIFL RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_SHIF8 RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_SHIDS RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_SHIBS RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECOSE RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECOLI RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECOLC RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECOHS RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECODH RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECOBW RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECO8A RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECO55 RecName: Full=Undecaprenyl-phosphate
    9::110     2e-08  38%  322 aa  ARNC_ECO24 RecName: Full=Undecaprenyl-phosphate
    2::96      4e-08  31%  344 aa  YIBD_ECOLI RecName: Full=Uncharacterized glycosyltransferase yibD; 
   11::101     4e-08  32%  900 aa  GGAB_BACSU RecName: Full=Minor teichoic acid biosynthesis protein
    9::109     4e-08  37%  340 aa  ARNC_PSEPF RecName: Full=Undecaprenyl-phosphate
    7::110     4e-08  37%  326 aa  ARNC_ESCF3 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECOUT RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECOL6 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECOL5 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECOK1 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECO81 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECO45 RecName: Full=Undecaprenyl-phosphate
    9::110     4e-08  38%  322 aa  ARNC_ECO27 RecName: Full=Undecaprenyl-phosphate
    2::109     4e-08  34%  325 aa  ARNC_AERS4 RecName: Full=Undecaprenyl-phosphate
    4::110     5e-08  37%  327 aa  ARNC_ENT38 RecName: Full=Undecaprenyl-phosphate
    8::125     6e-08  33%  323 aa  YKCC_BACSU RecName: Full=Uncharacterized glycosyltransferase ykcC; 
    2::97      6e-08  35%  299 aa  Y075_MYCPN RecName: Full=Uncharacterized glycosyltransferase MG060
    7::110     6e-08  36%  327 aa  ARNC_YERPY RecName: Full=Undecaprenyl-phosphate
    7::110     6e-08  36%  327 aa  ARNC_YERPS RecName: Full=Undecaprenyl-phosphate
    7::110     6e-08  36%  327 aa  ARNC_YERPP RecName: Full=Undecaprenyl-phosphate
    7::110     6e-08  36%  327 aa  ARNC_YERPB RecName: Full=Undecaprenyl-phosphate
    4::138     8e-08  34%  229 aa  Y544_METJA RecName: Full=Uncharacterized protein MJ0544;
  160::397     8e-08  26%  972 aa  HAS_PASMU RecName: Full=Hyaluronan synthase;       
  153::390     8e-08  27%  965 aa  CHS_PASMU RecName: Full=Chondroitin synthase;       
    7::109     8e-08  36%  327 aa  ARNC_YERPN RecName: Full=Undecaprenyl-phosphate
    7::109     8e-08  36%  327 aa  ARNC_YERPG RecName: Full=Undecaprenyl-phosphate
    7::109     8e-08  36%  327 aa  ARNC_YERPE RecName: Full=Undecaprenyl-phosphate
    7::109     8e-08  36%  327 aa  ARNC_YERPA RecName: Full=Undecaprenyl-phosphate
   32::237     1e-07  30%  398 aa  YAIP_ECOLI RecName: Full=Uncharacterized protein yaiP;
    9::109     1e-07  35%  341 aa  ARNC_PSEFS RecName: Full=Undecaprenyl-phosphate
  236::386     2e-07  27%  583 aa  HAS1_MOUSE RecName: Full=Hyaluronan synthase 1;       
  231::381     2e-07  27%  578 aa  HAS1_HUMAN RecName: Full=Hyaluronan synthase 1;       
    4::109     2e-07  35%  325 aa  ARNC_ERWT9 RecName: Full=Undecaprenyl-phosphate
   58::178     2e-07  28%  327 aa  ALG5_DICDI RecName: Full=Dolichyl-phosphate
  152::389     3e-07  25%  686 aa  CHS_ECOLX RecName: Full=Chondroitin synthase;       
   94::356     4e-07  28%  443 aa  GLTL5_MACFA RecName: Full=Putative polypeptide
   49::182     7e-07  31%  182 aa  NODC_BRAEL RecName: Full=N-acetylglucosaminyltransferase;       
   43::170     7e-07  31%  322 aa  ALG5_SCHPO RecName: Full=Dolichyl-phosphate
  143::405     1e-06  25%  637 aa  GALT8_HUMAN RecName: Full=Probable polypeptide
   48::182     2e-06  30%  182 aa  NODC_RHILT RecName: Full=N-acetylglucosaminyltransferase;       
   54::149     2e-06  33%  583 aa  HASS_XENLA RecName: Full=Hyaluronan synthase-related protein;      
    3::123     2e-06  29%  357 aa  B3GNL_RAT RecName: Full=UDP-GlcNAc:betaGal
   13::127     2e-06  31%  357 aa  B3GNL_MOUSE RecName: Full=UDP-GlcNAc:betaGal
   20::116     2e-06  28%  361 aa  B3GNL_HUMAN RecName: Full=UDP-GlcNAc:betaGal
  292::380     3e-06  33%  690 aa  Y706_RICBR RecName: Full=Uncharacterized glycosyltransferase
    7::101     3e-06  36%  241 aa  DPM1_DROME RecName: Full=Probable dolichol-phosphate
    2::94      3e-06  32%  310 aa  GTRB_BPP22 RecName: Full=Bactoprenol glucosyl transferase;       
    1::97      3e-06  28%  236 aa  DPM1_SCHPO RecName: Full=Dolichol-phosphate mannosyltransferase;   
   14::131     3e-06  34%  375 aa  CRTQ_STAHJ RecName: Full=4,4'-diaponeurosporenoate
    2::109     4e-06  28%  326 aa  ARNC_AERHH RecName: Full=Undecaprenyl-phosphate
    1::97      6e-06  37%  301 aa  AMSB_ERWAM RecName: Full=Amylovoran biosynthesis
    3::95      7e-06  27%  250 aa  Y868_HAEIN RecName: Full=Uncharacterized glycosyltransferase
    2::94      1e-05  30%  309 aa  GTRB_SHIFL RecName: Full=SfII prophage-derived bactoprenol glucosyl
    2::94      1e-05  30%  307 aa  GTRB_BPSF5 RecName: Full=Bactoprenol glucosyl transferase;       
    2::94      1e-05  30%  309 aa  GTRB_BPSF2 RecName: Full=Bactoprenol glucosyl transferase;       
    7::110     1e-05  33%  327 aa  ARNC_SALCH RecName: Full=Undecaprenyl-phosphate
    4::108     1e-05  28%  318 aa  Y501_SYNY3 RecName: Full=Uncharacterized glycosyltransferase
    8::86      1e-05  37%  318 aa  Y329_RICTY RecName: Full=Uncharacterized glycosyltransferase
    2::94      1e-05  32%  306 aa  GTRB_ECOLI RecName: Full=Bactoprenol glucosyl transferase homolog
    8::85      2e-05  37%  318 aa  Y339_RICPR RecName: Full=Uncharacterized glycosyltransferase RP339;
  115::346     2e-05  27%  590 aa  GALT8_DROME RecName: Full=Polypeptide
    7::110     2e-05  33%  327 aa  ARNC_SALTY RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALTI RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALSV RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALPK RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALPC RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALPB RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALPA RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALNS RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALHS RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALG2 RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALEP RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALDC RecName: Full=Undecaprenyl-phosphate
    7::110     2e-05  33%  327 aa  ARNC_SALA4 RecName: Full=Undecaprenyl-phosphate
    2::94      2e-05  30%  305 aa  GTRB_BPSFX RecName: Full=Bactoprenol glucosyl transferase;       
   14::149     3e-05  29%  602 aa  Y543_RICFE RecName: Full=Uncharacterized glycosyltransferase
   42::356     3e-05  25%  551 aa  HAS2_XENLA RecName: Full=Hyaluronan synthase 2;       
    6::97      3e-05  29%  267 aa  DPM1_YEAST RecName: Full=Dolichol-phosphate mannosyltransferase;   
    6::97      3e-05  30%  329 aa  CSBB_BACSU RecName: Full=Putative glycosyltransferase csbB;        
    2::110     4e-05  27%  392 aa  YFNE_BACSU RecName: Full=Uncharacterized glycosyltransferase yfnE; 
   41::93      4e-05  34%  611 aa  G251B_XENLA RecName: Full=Glycosyltransferase 25 family member 1-B;
   31::93      4e-05  32%  611 aa  G251A_XENLA RecName: Full=Glycosyltransferase 25 family member 1-A;
   32::145     6e-05  29%  294 aa  DPM1_USTMA RecName: Full=Dolichol-phosphate mannosyltransferase;   
    6::73      1e-04  35%  252 aa  TUAG_BACSU RecName: Full=Putative teichuronic acid biosynthesis
   42::356     2e-04  26%  552 aa  HAS2_RAT RecName: Full=Hyaluronan synthase 2;       
  149::376     2e-04  27%  667 aa  GALT3_DROME RecName: Full=Polypeptide
    6::110     2e-04  26%  326 aa  ARNC_SODGM RecName: Full=Undecaprenyl-phosphate
    8::99      2e-04  26%  299 aa  Y028_MYCPN RecName: Full=Uncharacterized glycosyltransferase MG025
    3::112     2e-04  26%  604 aa  GT251_DANRE RecName: Full=Glycosyltransferase 25 family member 1;  
   52::221     2e-04  28%  254 aa  DPM1_DICDI RecName: Full=Dolichol-phosphate mannosyltransferase;   
   10::110     2e-04  29%  331 aa  ARNC_SHESH RecName: Full=Undecaprenyl-phosphate
   39::85      3e-04  32%  190 aa  HAS3_CHICK RecName: Full=Hyaluronan synthase 3;       
  206::356     3e-04  25%  552 aa  HAS2_MOUSE RecName: Full=Hyaluronan synthase 2;       
  206::356     3e-04  25%  552 aa  HAS2_HUMAN RecName: Full=Hyaluronan synthase 2;       
  206::356     3e-04  25%  552 aa  HAS2_BOVIN RecName: Full=Hyaluronan synthase 2;       
    3::80      3e-04  31%  446 aa  GGAA_BACSU RecName: Full=Minor teichoic acid biosynthesis protein
   21::113     4e-04  29%  331 aa  Y1943_SYNY3 RecName: Full=Uncharacterized glycosyltransferase
  116::233     4e-04  28%  601 aa  GLTL6_HUMAN RecName: Full=Polypeptide
   18::103     5e-04  35%  243 aa  Y1222_METJA RecName: Full=Uncharacterized protein MJ1222;
   48::142     5e-04  30%  153 aa  NODC_BRASP RecName: Full=N-acetylglucosaminyltransferase;       
   75::184     5e-04  29%  334 aa  ALG5_YEAST RecName: Full=Dolichyl-phosphate
   16::145     7e-04  24%  238 aa  Y1676_METJA RecName: Full=Uncharacterized protein MJ1676;
 1430::1605    7e-04  25% 2005 aa  CHS8_USTMA RecName: Full=Chitin synthase 8;       
    1::420

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
YDAM_BACSU      MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
ICAA_STAAR      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESETIEDTLSN
ICAA_STAAN      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESETIEDTLSN
ICAA_STAAM      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESETIEDTLSN
ICAA_STAAC      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESETIEDTLSN
ICAA_STAA8      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESETIEDTLSN
ICAA_STAAW      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESDTIEDTLSN
ICAA_STAAS      ----LFYVFMSIYWIVSIYFYFTRE--IRYSLNKKPDI-----NVDELEGITFLLACYNESDTIEDTLSN
ICAA_STAEP      ----LFYIFMSIYWIVSIYYFFIKEKPFNRLLLV-------KSEHQQVEGISFLLACYNESETVQDTLSS
ICAA_STAEQ      ----LFYIFMSIYWIVSIYYFFIKEKPFNRSLLV-------KSEHQQVEGISFLLACYNESETVQDTLSS
PGAC_ECOLI      ---------MSIMWIV---------GGVYFWVYRERHWP-WGENLKDNPSISIIIPCFNEEKNVEETIHA
PGAC_ECO57      ---------MSIMWIV---------GGVYFWVYRERRWP-WGENLKDNPSISIIIPCFNEEKNVEETIHA
CSLAA_ARATH     ------------------------------------------------PMVLVQIPMYNEKEVLQLSIGA
CSLA1_CYATE     ------------------------------------------ERSKKYPMVLIQIPMYNEKEVYKLSIGA
NODC_RHILV      -----------------------------------------------VPSVDVIVPCFNEDIVLSECLAS
CSLA9_ARATH     ------------------------------------------------PMVLIQIPMFNEREVYQLSIGA
CSLA7_ARATH     --SVMFFVEVMYMGIVVLYVKLFKRKPEKFY--------KWEAMEDDVPMVLVQIPMYNEKEVCEQSIAA
CSLAB_ARATH     ---------------------------------------------QNFPMVLVQIPMYNEREVFKLSIGA
CSLAB_ORYSJ     ------------------------------------------------PMVLVQIPMFNEREVYKLSIGA
NODC_RHIME      ---------------------------------------------RPLPAVDVIVPSFNEDPILSACLAS
CSLCC_ARATH     ------------------------------------------DNGAFLPMVLVQIPMCNEKEVYQQSIAA
CSLA4_ORYSJ     ------------------------------------------------PMVLVQIPMYNEKEVYKLSIGA
CSLAF_ARATH     ------------------------------------------------PMVLVQIPMYNEREVFELSIGA
CSLA7_ORYSJ     ----------------------------------------------EYPMVMVQIPMYNELEVYKLSIGA
CSLA5_ORYSJ     ------------------------------------------------PMVMVQIPMYNELEVYKLSIGA
CSLC8_ARATH     ----------------------------------------------EYPMVLVQIPMCNEREVYEQSISA
CSLA6_ORYSJ     ------------------------------------------------PMVLVQIPMYNEKEVYQLSIGA
CSLCA_ORYSJ     ------------------------------------------------PMVLVQIPMCNEKEVYQQSIAA
CSLCA_ORYSI     ------------------------------------------------PMVLVQIPMCNEKEVYQQSIAA
CSLC5_ARATH     ----------------------------------------------EYPMVLVQIPMCNEREVYEQSISA
CSLC7_ORYSJ     ----------------------------------------------DYPMVLVQMPMCNEREVYQQSIGA
CSLA1_ARATH     ----VFFESFYMNFVILFVKLFKRK---------PHKVYKWEAMQEDVPMVLIQIPMYNEKEVFQLSIAA
CSLA1_ORYSJ     ------------------------------------------------PVVLIQIPMFNEREVYQLSIGA
CSLC1_ORYSJ     ----------------------------------------------EFPMVLVQIPMCNEKEVYQQSIGA
CSLA2_ARATH     ------------------------------------------------PVVLVQIPMFNEREVYKLSIGA
CSLC4_ARATH     -----------LFLIQSLDRLVLCLGCF--WIKFKKIEPKLTEESIDLPMVLIQIPMCNEREVYEQSIGA
CSLA9_ORYSJ     --------------------------------------PELADANAAFPMVLIQIPMYNEREVYKLSIGA
NODC_RHISN      ------------------------------------------------PSVDVIVPCYNEDPRALSACLA
CSLA3_ARATH     ------------------------------------------------PMVLIQIPMYNEKEVCQLSIGA
CSLC9_ORYSJ     --------------------------------------------------VLVQIPMCNEKEVYQQSIAA
CSLA3_ORYSJ     ------------------------------------------------PMVLVQIPMYNEREVYKLSIGA
NODC_RHIS3      ------------------------------------------------PSVDVIIPCYNEPLTLSACLDS
CSLA2_ORYSJ     --------------------------------------------------VLVQIPMYNEKEVYKLSIGA
BCSA_PSEFS      -----------------------------------RRTPVWKTEPEEWPTVDVFIPTYNEALIVKLTIFA
CSLC6_ARATH     --------------------------------------------LEDYPMVIVQIPMCNEKEVYQQSIGA
BCSA_ECOLI      ---------LILLFAETYAWIVLVLGYFQVVWPLNRQPVPLPKDMSLWPSVDIFVPTYNEDLVVKNTIYA
BCSA_SALTI      ---------LILLFAETYAWIVLVLGYFQVVWPLNRQPVPLPKEMSQWPTVDIFVPTYNEDLVVKNTIYA
BCSA_ECO57      ---------LILLFAETYAWIVLVLGYFQVVWPLNRQPVPLPKDMSLWPSVDIFVPTYNEDLVVKNTIYA
CSLC2_ORYSJ     ------------------------------------------------PMVLVQIPMCNEKEVYEQSISA
CSLC2_ORYSI     ------------------------------------------------PMVLVQIPMCNEKEVYEQSISA
BCSA_SALTY      ---------LILLFAETYAWIVLVLGYFQVVWPLNRQPVPLPKEMSQWPTVDIFVPTYNEDLVVKNTIYA
NODC_RHILO      ------------------------------------------------PSVDVIIPCYNEAPRTLSDCLA
CSLC3_ORYSJ     ------------------------------------------------PMVLIQMPMCNEKEVYETSISH
CSLAE_ARATH     ------------------------------------------------PMVLIQIPIFNEKEVCQLPIGA
NODC_AZOC5      ------------------------------------------------PRVDVIVPTFNENSSTLLECVA
ACSA1_ACEXY     --------------------------------------------------VDIFVPTYNEELIVRLTVLG
ACSA2_ACEXY     ------------------------------------------------PVVDVYVPSYNEELLVRSTVLG
BCSA3_ACEXY     -------------------------------------------NPDEWPTVDIFIPTYDEALIVRLTVLG
BCSA5_ACEXY     ------------------------------------------EDMAQWPSVDVFVPSYNEELLVRSTVLG
BCSA4_ACEXY     ------------------------------------------EDMAQWPSVDVFVPSYNEELLVRSTVLG
NODC_RHIGA      -----------------------------------------------LPSVDIIVPCFNEDAILSACLSS
ARNC_WIGBR      --------------------------------------------MLNFKKLSIIIPVYNEQDSLIELIKR
ARNC_PECCP      ----------------------------------------------DIKNVSVVIPVYNEEVLIERTLAA
BCSA2_ACEXY     ------------------------------------------DNVDDWPTVDIFIPTYDEQLIVRLTVLG
BCSA1_ACEXY     ------------------------------------------DNVDDWPTVDIFIPTYDEQLIVRLTVLG
ARNC_ERWCT      ----------------------------------------------DIKNVSVVIPVYNEEVLIERTLAA
ARNC_PHOLL      -------------------------------------------SFEQIKKVSVVIPIYNEELLLERTLAA
NODC_BRAJA      -------------------------------------------------------PCFNENPTLAECLES
ARNC_PROMH      ---------------------------------------------EKINKVSVVIPVYNEEESLPQLLER
ARNC_SERP5      --------------------------------------------VEPIKKVSVVIPVYNEQALLERTTAA
HASA_STRPY      -------------------------------------------------KVAAVIPSYNEDAELLETLKS
HASA_STRP8      -------------------------------------------------KVAAVIPSYNEDAELLETLKS
HASA_STRP6      -------------------------------------------------KVAAVIPSYNEDAELLETLKS
HASA_STRP3      -------------------------------------------------KVAAVIPSYNEDAELLETLKS
HASA_STRP1      -------------------------------------------------KVAAVIPSYNEDAELLETLKS
EPSH_BACSU      ----------------------------------------------ETPAVSLLVAVYNTETYIRTCLES
ARNC_EDWI9      -------------------------------------------DFKTIQFVSVVIPVYNEQDSLSELLKR
HAS1_XENLA      -----------------------------------------RVNKSELPTVALTIAGYQEEYLIK-CLES
ARNC_PSEU2      --------------------------------------------------VSIVIPVYNERQSLPELLRR
ARNC_PSEF5      --------------------------------------------------VSIVIPVYNEEQLLRRTEAA
ARNC_YERE8      ---------------------------------------------EKIKKVSIVIPVYNEQILIERTSAA
ARNC_ECOLU      -------------------------------------------------KVSVVIPVYNEQELIRRTTKA
ARNC_PSEAE      --------------------------------------------------VSVVIPVYNEEASLPELLRR
ARNC_PSEAB      --------------------------------------------------VSVVIPVYNEEASLPELLRR
ARNC_PSEA8      --------------------------------------------------VSVVIPVYNEEASLPELLRR
ARNC_PSEA7      --------------------------------------------------VSVVIPVYNEEASLPELLRR
ARNC_ECOSM      -------------------------------------------------KVSVVIPVYNEQELIRRTTKA
YTH1_RHOER      --------------------------------------------------VTVVIPVKDNQAGVERLLPV
EPSJ_BACSU      -----------------------------------------------IPLVSIIVPMYNVEPFIEECIDS
ARNC_ECO5E      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECO57      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
Y1578_HAEIN     --------------------------------------------MENCPLVSVIVCAYNAEQYIDESISS
BCSA_XANAC      VGSAVDFIXXXXXXXAELYFVILVLGYFQVLWPLNRKPVPLPADQRLWPSVDVFIPTYNEPLVVRTTVLA
ARNC_PSE14      --------------------------------------------------VSIVIPVYNERQLLRRTEAA
ARNC_ECO7I      -------------------------------------------------KVSVVIPVYNEQELIRRTTKA
ALG5_MOUSE      ----------------------------------------WDSPTKQL---SVVVPSYNEEKRLPVMMDE
ALG5_HUMAN      ----------------------------------------WDSPTKQL---SVVVPSYNEEVMMDEALSY
ARNC_SHISS      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_SHIFL      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_SHIF8      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_SHIDS      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_SHIBS      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECOSE      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECOLI      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECOLC      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECOHS      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECODH      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECOBW      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECO8A      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECO55      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
ARNC_ECO24      -------------------------------------------------KVSVVIPVYNEQELIRRTTTA
YIBD_ECOLI      --------------------------------------------MNSTNKLSVIIPLYNAGDDFRTCMES
GGAB_BACSU      ---------------------------------------------------SVIMPIYNVELYLTEAIES
ARNC_PSEPF      --------------------------------------------------VSIVIPVYNEEELLRRTEAA
ARNC_ESCF3      -----------------------------------------------IKKVSVVIPVYNEQELINRTTAA
ARNC_ECOUT      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_ECOL6      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_ECOL5      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_ECOK1      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_ECO81      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_ECO45      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_ECO27      -------------------------------------------------KVSVVIPVYNEQELIRRTTAA
ARNC_AERS4      -------------------------------------------NNTDIKLVSVIIPVYNEEAVLLSRVTA
ARNC_ENT38      --------------------------------------------VEAIHKVSVVIPVYNEQELIRRTTAA
YKCC_BACSU      ---------------------------------------------------SIVVPVYNEELVIHETYQR
Y075_MYCPN      -------------------------------------------------KISVIISTYNCGALIVKALCS
ARNC_YERPY      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
ARNC_YERPS      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
ARNC_YERPP      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
ARNC_YERPB      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
Y544_METJA      -----------------------------------------------------IIPAFNEEKNILKVLKD
HAS_PASMU       --------------------------------------------------LSIIVTTFNRPAILSITLAC
CHS_PASMU       --------------------------------------------------LSIIIPTFNRSRILDITLAC
ARNC_YERPN      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
ARNC_YERPG      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
ARNC_YERPE      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
ARNC_YERPA      -----------------------------------------------IKKVSIVIPVYNEQ----ESLPA
YAIP_ECOLI      --------------------------------------------------IDAIIPAYNEGPCLAQSLDN
ARNC_PSEFS      --------------------------------------------------VSIVIPVYNEQELLRRTTAA
HAS1_MOUSE      ----------------------------------------------------------------------
HAS1_HUMAN      ----------------------------------------------------------------------
ARNC_ERWT9      ---------------------------------------------QSIKKVSVVIPVYNEQQSLPELMRA
ALG5_DICDI      ----------------------------------QHQFPSLVENKNPIDNISVIVPAYNEQIRLPSMLDD
CHS_ECOLX       --------------------------------------------------LSIVIPTYNRAKILAITLAC
GLTL5_MACFA     -------------------HNELLKYGFNVIISIEREVPDTRNKMARLPTASIVICFHNEEFALFRTVSS
NODC_BRAEL      -----------------------------------------------LPSVDVIVPCFNEDPTLSECLAS
ALG5_SCHPO      -----------------------IENGQKKSLTLE----KW--STSDNIQITVIVPAYNESKRIGNMLQE
GALT8_HUMAN     -----------------LFRKFGYNAYLSNQLPLNRTIPDTRDYRSQLPSLSVILIFVNEALIIQRAITS
NODC_RHILT      -----------------------------------------------LPSVDIIVPSFNESPARPVRLPG
HASS_XENLA      -------ITFGLYGAAMLLHL-LMQGIFANLEI--RRIEK-RDGVCSFKKVALTITGYQENPYLRQCLES
B3GNL_RAT       -------------------------------------LPEDATKRAPLALVSIILPVHNAEQWLDECLMS
B3GNL_MOUSE     -----------------------------------------------LALVSIILPVHNAEQWLDECLMS
B3GNL_HUMAN     --------------------------------------------------VSIILPVHNAEPWLDECLRS
Y706_RICBR      -------------------------------------------------KVSVIIPVYNRINWTIQSIES
DPM1_DROME      -------------------------------------------------KYSILMPTYNEKIIIWLIVKY
GTRB_BPP22      -------------------------------------------------KISLVVPVFNEEDTIPIFYKT
DPM1_SCHPO      -----------------------------------------------MSKYSVLLPTYNERKNL-PIITY
CRTQ_STAHJ      ---------LSLISGYLMYNR-------RYLLSFDKK----REG-ETTQSISVIIPARNEE---KRLPXX
ARNC_AERHH      -------------------------------------------NNTDIKLVSVVIPVYNEEASLPALLSR
AMSB_ERWAM      --------------------------------------------MKDI-SFSVVIPAYNASESIITTLDC
Y868_HAEIN      -----------------------------------------------MPLISIIMPVYNAECYLNQGILS
GTRB_SHIFL      -------------------------------------------------KISLVVPVFNEEEAIPVFYKT
GTRB_BPSF5      -------------------------------------------------KISLVVPVFNEEEAIPVFYKT
GTRB_BPSF2      -------------------------------------------------KISLVVPVFNEEEAIPVFYKT
ARNC_SALCH      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
Y501_SYNY3      -------------------------------------------------ELSIVIPMYNEEDNLEHLFAR
Y329_RICTY      ------------------------------------------------PLVSIIIPVYNGANYMREAIDS
GTRB_ECOLI      -------------------------------------------------KISLVVPVFNEEEAIPIFYKT
Y339_RICPR      ------------------------------------------------PLVSIIIPVYNGANYMREAIDS
GALT8_DROME     -----------------------------------RSCKKLKYPMEKLPSVSVVITYHNEEASVXXXXXX
ARNC_SALTY      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALTI      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALSV      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALPK      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTAA
ARNC_SALPC      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALPB      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALPA      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTAA
ARNC_SALNS      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALHS      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
ARNC_SALG2      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTAA
ARNC_SALEP      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTAA
ARNC_SALDC      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTAA
ARNC_SALA4      -----------------------------------------------IKKVSVVIPVYNEQELIRRTTTA
GTRB_BPSFX      -------------------------------------------------KISLVVPVFNEEEAIPIFYKT
Y543_RICFE      ------------------------------------------------PLVSIIIPVYNGANYMREAIDS
HAS2_XENLA      -----YYFSFGLYGAILALHLIIQSFAFLEHRKMKRSL---ETPIKLNKSVALCIAAYQEEDYLRKCLLS
DPM1_YEAST      ---------------------------------------------------SVIVPAYHEKLNIKPLTTR
CSBB_BACSU      --------------------------------------------------ISIIIPSYNEKLIHESLKKE
YFNE_BACSU      -------------------------------------------------KASVIIPAYNSKERLYNSLLS
G251B_XENLA     ------------------------------------------------PTVLIAVLARNSEGSLPEVLGA
G251A_XENLA     ---------------------------------------RWNESSLRNPTVLIALLARNSEGSLPEVLGA
DPM1_USTMA      ----------------------------------------------------VIVPAFRENLNLRPLVTR
TUAG_BACSU      ------------------------------------------------PLVSVITPSYNARDYIEDTVHS
HAS2_RAT        -----YYFSFGLYGAFLASHL-IIQSLFAFLE--HRKMKKSLETPIKLNKVALCIAAYQEDPYLRKCLQS
GALT3_DROME     -----------------------------------------------LPSTSVIIVFHNEASVLLRTITS
ARNC_SODGM      ----------------------------------------------KIDKVSIVIPVYNEQESLPELMRR
Y028_MYCPN      ---------------------------------------------------TVIIPTYNCGQYIPKALDS
GT251_DANRE     --------------LLCFFFLLLWTGPARSYFPEERWSP---ESXXXXXXXXXXXXCRNSAHSLPHVLGA
DPM1_DICDI      ----------------------------------------------------------------------
ARNC_SHESH      --------------------------------------------------VSIVIPVYNEEASLPELLRT
HAS3_CHICK      ----------------------------------------------------------------------
HAS2_MOUSE      ----------------------------------------------------------------------
HAS2_HUMAN      ----------------------------------------------------------------------
HAS2_BOVIN      ----------------------------------------------------------------------
GGAA_BACSU      ---------------------------------------------------SIIIPIYNSENYLRYSIES
Y1943_SYNY3     ------------------------------------------------PMYSLIVPIYNEEPVLYERLKA
GLTL6_HUMAN     -------------------------------IALERSLPKHKMYLERLPNTSIIIPFHNEGTSLLRTIHS
Y1222_METJA     -------------------------------------------------EIFVVVPAFNEEKMIGETLKN
NODC_BRASP      -----------------------------------------------LPSVDVIVPSFNEDPTLSECLAS
ALG5_YEAST      --------------------------------------------------LSVVIPSYNETGRILLMLTD
Y1676_METJA     -------------------------------------------DVKTNPKVNELVNKEIKKRLSKLGIKA
CHS8_USTMA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
YDAM_BACSU      MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
ICAA_STAAR      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAAN      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAAM      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAAC      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAA8      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAAW      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAAS      VLALKYEKK--EIIIINDGSSDNTAELIYKIKENNDFIFVDLQE----NRGKANALNQGIKQASYDYVMC
ICAA_STAEP      VLSLEYPEK--EIIIINDGSSDNTAEIIYEFKKNHDF-KFVDLE---VNRGKANALNEGIKQASYEYVMC
ICAA_STAEQ      VLSLEYPEK--EIIIINDGSSDNTAEIIYDFKKNHDF-KFVDLE---VNRGKANALNEGIKQASYEYVMC
PGAC_ECOLI      ALAQRY--ENIEVIAVNDGSTDKTRAILDRMAAQIPHLR-VIHLAQNQGXXXXXXXXXXXXXSEY-LVCI
PGAC_ECO57      ALAQRY--ENIEVIAVNDGSTDKTRAILDRMAAQIPHLR-VIHLAQNQGXXXXXXXXXXXXXSEY-LVCI
CSLAA_ARATH     ACRLIWPLDRLIVQVLDDSTDQTIKELVNTECAKWESVNIKCERRDNRNGYKAGALKEGMKHNYVKLVVI
CSLA1_CYATE     VCGLSWPADRFIVQVLDDSTNPVLRELVEMECQKWKGVNVKYENRRNRNGYKAGALKEGLEKQDCEFVAI
NODC_RHILV      LAEQDYA-GKLRIYVVDDGSKNRDAVVAQRAAERFNFTIL----PKNVGKRKAIA---AITQSSGDLILN
CSLA9_ARATH     ACGLSWPSDRIVIQVLDDSTDPTIKDLVSRWASKGVNIKYEIRD--NRNGYKAGALKEGMKKSSCDYVAI
CSLA7_ARATH     ACKISWPSNRIIIQVLDDSTDPASKELVKKECDRWEGVNITFEIRDNRNGYKAGALREGMRHSQCDYVAI
CSLAB_ARATH     ACRLIWPLDRLIVQVLDDSTDPTIMEMVSTECGKWATINIKCERRDNRNGYKAGALKQGMRHSTCTYIAI
CSLAB_ORYSJ     ACSLDWPSDRVVIQVLDDSTDLVVKDLVEKECQKWQG-KGVNIKYEVRGKGKAGALKEGLKHDECEYIAM
NODC_RHIME      IADQDYPGE-LRVYVVDDGSRNREAIVVRAFYSRDPRFSFILL-PENVGKRKAQIAAIG--QSSGDLVLN
CSLCC_ARATH     VCNLDWPKGKILIQILDDSDDPITQSLIKEEVHKWQYRHRVNREGYKAGNLK-SAMNCSYVK-DYEFVAI
CSLA4_ORYSJ     ACALTWPPDRIIIQVLDDSTDPAIKDLVEDWARKEINIKYEIRD--NRKGYKAGALKKGMEHQQCDFVAI
CSLAF_ARATH     ACRLTWPSDRLIVQVLDDSTDPAIMELVSMECTKWDXXXXXXXXXXXXGY-KAGALKHGMRHSQCQYLAI
CSLA7_ORYSJ     ACELKWPKDKLIVQVLDDSTDPFIKNLVESWASKGVNIKYVTR---SSRKGKAGALKKGMETKQCEYIAI
CSLA5_ORYSJ     VCGLKWPKERLIIQVLDDSTDAFIKNLVELECEDWASKGLNIKYATRSGRKKAGALKKGMEAKQCEYVAI
CSLC8_ARATH     VCQLDWPKDRLLVQVLDDSDDESIQELIRDEVTKWSYRHRLVRTGYKAGNLK-SAMSCDYVEAY-EFVAI
CSLA6_ORYSJ     ACRLTWPADRLIVQVLDDSTDAIVKELVRKECERWGKKGINVTRKDRAGY-KAGNLREGMRRGGCEFVAM
CSLCA_ORYSJ     VCNLDWPRSNILVQVLDDSDDPITQSLIKEEVEKWRYRHRVLREGYKAGNLK-SAMSCSYVK-DYEYVAI
CSLCA_ORYSI     VCNLDWPRSNILVQVLDDSDDPITQSLIKEEVEKWRYRHRVLREGYKAGNLK-SAMSCSYVK-DYEYVAI
CSLC5_ARATH     VCQLDWPKDRILVQVLDDSNDESIQQLIKAEVAKWSYRHRLVRTGYKAGNLK-SAMSCDYVEAY-EYVAI
CSLC7_ORYSJ     VCNLDWPKSNFLVQVLDDSDDATTSALIKEEVEKWQYRHRVIRDGYKAGNLK-SAMNCSYVK-DYEFVVI
CSLA1_ARATH     ICSLVWPSSRLVVQVVDDSTDPAVREGVDVEIAKWQSINIRCERRDNRNGYKAGAMKEALTQSQCDFVAV
CSLA1_ORYSJ     VCGLSWPSDRLVVQVLDDSTDPVIKEMVRIECERWAHKGVNITYQENRKGYKAGALKEGMKHGECEYVAI
CSLC1_ORYSJ     VCNLDWPRSNFLVQVLXXXXXXXXXXLIKEEVEKWQYRHRVIRDGYKAGNLK-SAMNCSYVK-DYEFVVI
CSLA2_ARATH     ACGLSWPSDRLVIQVLDDSTDPTVKQMVEVECQRWASINIRYQIRENRVGYKAGALKEGLKRSHCEYVVI
CSLC4_ARATH     ASQLDWPKDRILIQVLDDSDDPNLQLLIKEWAEKIIYRHRLIRTGYKAGNLK-SAMTCDYVK-DYEFVTI
CSLA9_ORYSJ     ACGLSWPSDRVIVQVLDDSTDPVIKEMVQVECKRWESVRIKYEIRDNRVGYKAGALREGMKHGDCDYVAI
NODC_RHISN      SIAKQDYAGELRVYVVDDGSGNRNAIIPVHDHYACDPRFRFILMPKNVGKRKAQIV--AIRESSGDLVLN
CSLA3_ARATH     ACRLSWPLDRMIVQVLDDSTDPASKELVNAECDKWKGINIMSEIRDNRIGYKAGALKAGMMHNQCEFVAI
CSLC9_ORYSJ     VCNLDWPRSNFLVQVLDDSDDPTTQTLIREEVLKWQYRHRVLRDGYKAGNLK-SAMSCSYVK-DYEFVAI
CSLA3_ORYSJ     ACGLSWPSDRL-IVQVLDDSTDPTGLVELECKSWGNKGKNVKYEVRNTRKGKAGALKEGLLRDQCNYVAI
NODC_RHIS3      IANQEYA-GKLRVYVVDDGSGNR--DAVIPIHDNYDFILL----PENVGKRKAQI--AAIRRSSGDLVLN
CSLA2_ORYSJ     ACALTWPPDRIIIQVLDDSTDPFVKELVEEWASKKINIKYEVR---NNRKGKAGALRKGMEHTYADFVAI
BCSA_PSEFS      AQAMDWPKDKLRVHVLDDGRRDDFREFCRKVGVNY-------IRRDNNFHAKAGNLNEALKVTDGEYIAL
CSLC6_ARATH     VCMLDWPRERMLVQVLDDSSELDVQQLIKAEVQKWQYRHRLIRTGYKAGNLK-AAMNCEYVK-DYEFVAI
BCSA_ECOLI      SLGIDWPKDKLNIWILDDGGREEFRQFAQNVGVKY----IARTTHEHA---KAGNINNALKYAKGEFVSI
BCSA_SALTI      SLGIDWPKDKLNIWILDDGGRESFRQFARHVGVHY------IARATHE-HAKAGNINNALKHAKGEFVAI
BCSA_ECO57      SLGIDWPKDKLNIWILDDGGREEFRQFAQNVGVKY----IARTTHEHA---KAGNINNALKYAKGEFVSI
CSLC2_ORYSJ     ACQLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSYRHRVLRTGYKAGNLKS-AMSCDYVKDY-EFVAI
CSLC2_ORYSI     ACQLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSYRHRVLRTGYKAGNLKS-AMSCDYVKDY-EFVAI
BCSA_SALTY      SLGIDWPKDKLNIWILDDGGRESFRHFARHVGVHY----IARTTHEHA---KAGNINNALKHAKGEFVAI
NODC_RHILO      SIASQDYAGKLQVYVVDDGSANRDAGVHEEYAPRFNFVAL----PKNVGKRKAQI--AAIRRSCGDLVLN
CSLC3_ORYSJ     VCQIDWPRERMLVQVLDDSDDETCQMLIKAEVTKWSQVNIIYRHRLNRTGYKAGNLKSAMSVRDYEFVAI
CSLAE_ARATH     ACKLSWPLDRMIIQVLDDSTEEESQKLVRLECKKWESEGITIKSEVRGGEGKAGALTAGMKHSYVDFVVI
NODC_AZOC5      SICAQDYRGPITIVVVDDGSTNKTS--FHAVCDKYASDERFIFVELDQNKGKRAAQMEAIRRTDGDLILN
ACSA1_ACEXY     SLGIDWPPEKVRVHILDDGRRPEFAAFAAECGANY------IARPTNE-HAKAGNLNYAIGHTDGDYILI
ACSA2_ACEXY     ALAIDWPADKLNVYILDDGRRKSFHAFAMEAGAGY------IIRDQN-NHAKAGNLNHALRVTEGEYVVI
BCSA3_ACEXY     ALGIDWPPDKVNVYILDDGRREEFARFAEACGARY------IARPDNA-HAKAGNLNYAIKHTTGDHILI
BCSA5_ACEXY     ALDLDWPADRLNVYILDDGRRKAFHDFAVEAGAGY------IIRAEN-NHAKAGNLNHALAVTDSPFAVI
BCSA4_ACEXY     ALDLDWPADRLNVYILDDGRRKAFHDFAVEAGAGY------IIRAEN-NHAKAGNLNHALAVTDSPFAVI
NODC_RHIGA      LAGQDYG-GKLRIYMVDDGSCNREAILVHDFDPRFEFLLL------SKNVGKRKAQIAAIERSCGDLILN
ARNC_WIGBR      TVNTCSKKIKYEIIIIDDGSNDKSINILEKEALKQNSKIVAIFLKKNYGQ--HSAIMAGFKHSSGDLVIT
ARNC_PECCP      CRQIGKP---WEIILVDDGSSDRSAELLTEAAS--DPEKHIIAVLLNRNYGQHSAIMAGFQQAVGDVVIT
BCSA2_ACEXY     ALGIDWPPDKVNVYILDDGVRPEFEQFAKDCGALY-----IGRVDVDSAHAKAGNLNHAIKRTSGDYILI
BCSA1_ACEXY     ALGIDWPPDKVNVYILDDG-------VRPEFEQFAKDCGALYIGRVDSSHAKAGNLNHAIKRTSGDYILI
ARNC_ERWCT      CRKIGKP---WEIILVDDGSNDRSAELLTEAAS--DPEKHIIAVLLNRNYGQHSAIMAGFQQAVGDVVIT
ARNC_PHOLL      CKQL---TQEYELILVDDGSSDKSAEILIQAAEQPE--NHIIAILLNRNYGQHSAIMAGFNQVNGDLIIT
NODC_BRAJA      IASQDYA-GKMQVYVVDDGSANR--DVVAPVHRIYDPRFSFILLANNVGKRKAQI--AAIRSSSGDLVLN
ARNC_PROMH      TISCKQLEQEYELILVDDGSSDNSAKMLEEAANIED--NHVIAIILNRNYGQHSAIMAGFNQADGDLVIT
ARNC_SERP5      CKQLTQP---YEIILVDDGSSDNSADMLTAAAEQPG--SCVIAVLLNRNYGQHSAIMAGFNQVSGDLVIT
HASA_STRPY      VLAQTYPLS--EIYIVDDGSSNTDAQLIEEYNREVDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLT
HASA_STRP8      VLAQTYPLS--EIYIVDDGSSNTDAQLIEEYNREVDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLT
HASA_STRP6      VLAQTYPLS--EIYIVDDGSSNTDAQLIEEYNREVDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLT
HASA_STRP3      VLAQTYPLS--EIYIVDDGSSNTDAQLIEEYNREVDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLT
HASA_STRP1      VLAQTYPLS--EIYIVDDGSSNTDAQLIEEYNREVDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLT
EPSH_BACSU      LRN--QTMDNIEIIIVNDGSADASPDIAEEYAKMDNRFKVI----HQENQGLGAVRNKGIEAARGEFIAF
ARNC_EDWI9      TIAACDSMGKYEIVLVDDGSSDRSAEILREAAQRPG--SRVVAVLLNRNYGQHSAIMAGFNHIKGDLVIT
HAS1_XENLA      CKYVKYPKDKLKIILVIDGNTEDDAYMMEMFKDVFHGEDVTVKKPEETNKGSCPEVSKPLNEDEGDYVQV
ARNC_PSEU2      TEAACEQLDRFEIVLVDDGSRDDSTDILQRAAERADFVAVIL----NRNYGQHAAIMAGFEQCQGDVVIT
ARNC_PSEF5      CRQL---KHEFEIVLVDDGSRDESANILQAAAERED--SPVVAVILNRNYGQHAAIMAGFEQCRGDVVIT
ARNC_YERE8      CKLLTQP---YEIILVDDGSSDNSAELLTAAANEPE--SHIIAVLLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_ECOLU      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_PSEAE      TEAACLELGRFEIVLVDDGSRDRSAELLQAAAERDG--SAVVAVILNRNYGQHAAILAGFEQSRGDLVIT
ARNC_PSEAB      TEAACLELGRFEIVLVDDGSRDRSAELLQAAAERDG--SAVVAVILNRNYGQHAAILAGFEQSRGDLVIT
ARNC_PSEA8      TEAACLELGRFEIVLVDDGSRDRSAELLQAAAERDG--SAVVAVILNRNYGQHAAILAGFEQSRGDLVIT
ARNC_PSEA7      TEAACRSLGRFEIVLVDDGSRDRSAELLQAAAERDGCAVVAVIL--NRNYGQHAAILAGFEQSRGDLVIT
ARNC_ECOSM      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
YTH1_RHOER      L------KD-LTVIVVDDGS-----EVPVEPRRACPGTGTITVVRHESARGPSAARNSGLRSAQTRFVAF
EPSJ_BACSU      L--LRQTLSDIEIILVNDGTPDRSGEIAEDYAKRDARIRVI----HQANGGLSSARNTGIKAARGTYIGF
ARNC_ECO5E      CESL---GKEYEILLIDDGSSDNSAHILVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO57      CESL---GKEYEILLIDDGSSDNSAHILVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
Y1578_HAEIN     IINQTY--ENLEIIVINDGSTDLTLSHLEEISKLDKRIKIISNK---YNLGFINSLNIGLGCFSGKYFAR
BCSA_XANAC      ASVIDWPAGKITIHLLDDGRRDEFRAFCAEVGINY------VTRTNNA-HAKAGNINAALKKCSGDYVAI
ARNC_PSE14      CKHLNH---RFEIVLVDDGSRDDSAEILQQAAERSPFVAVIL----NRNYGQHAAIMAGFEQCKGDVVIT
ARNC_ECO7I      CESL---GKEYEILLIDDGSSDNSAHMLVDASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ALG5_MOUSE      ALNYLEKRQKYEVIVVDDGSEDQTSKVALKYCQKYGSDKVVITLVRNRGKG--GAVRMGVFSSRGEKILM
ALG5_HUMAN      LEKRQKPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVVITLVKNRGKG--GAIRMGIFSSRGEKILM
ARNC_SHISS      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_SHIFL      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILINRNYGQHSAIMAGFSHVTGDLIIT
ARNC_SHIF8      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_SHIDS      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_SHIBS      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOSE      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOLI      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOLC      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOHS      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECODH      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOBW      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO8A      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO55      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO24      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEN--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
YIBD_ECOLI      LITQTWTA--LEIIIINDGSTDNSVEIAKYYAENYPHVRLL----HQANAGASVARNRGIEVATGKYVAF
GGAB_BACSU      IINQTIGFENIQLILVNDDSPDKSEIICKEYAQKYP-NNIVYAKKQNG--GVSSARNYGLKYAEGRYIQF
ARNC_PSEPF      CKQLRHD---YEIVLVDDGSRDASAQLLEEAASVVDFVAVIL----NRNYGQHAAIMAGFEQCKGDVVIT
ARNC_ESCF3      CESL---GKEYEILLIDDGSSDASAQMLVEASQAPD--SHIVSILLNRNYGQHSAIMAGFSYVTGDLIIT
ARNC_ECOUT      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOL6      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOL5      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECOK1      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO81      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO45      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_ECO27      CESL---GKEYEILLIDDGSSDNSAHMLVEASQAEG--SHIVSILLNRNYGQHSAIMAGFSHVTGDLIIT
ARNC_AERS4      ACELL-PQD-YEVILIDDGSHDGSTEIISEAAANSD--SKLVGVLLNRNYGQHAAIMAGFETAKGDLVIT
ARNC_ENT38      CELL--GKD-YEILLVDDGSSDESASMLSDAAEEPG--SHIVAVLLNRNYGQHNAIMAGFSHVTGDLIVT
YKCC_BACSU      LKEVMQTKENYELLFVNDGSKDRSIEILREHSLIDPRVKII---DFSRNFGHQIAITAGMDYAQGNAIVV
Y075_MYCPN      LVSNQTPACELEVLVIDDGSIDNTRQIIKKFQAKVSFLKYFYKKNGNWGSVINYVKENRLA--NGDWITV
ARNC_YERPY      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_YERPS      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_YERPP      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_YERPB      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
Y544_METJA      LEKL-----RVDAVVVDDGSKDNTSKIVEEFAKKAKINVYLIRNEKNEGKAKAIEKGTKFALSXXXXXXX
HAS_PASMU       LVNTHYP---FEVIVTDDGSQEDLSPIIRQYENKLD-IRYVRQK--DNGFQASAARNMGLRLAKYDFIGL
CHS_PASMU       LVNTNYP---FEVVVADDGSKENLLTIVQKYEQKLD-IKYVRQK--DYGYQLCAVRNLGLRTAKYDFVSI
ARNC_YERPN      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_YERPG      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_YERPE      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
ARNC_YERPA      LIDRTTAACKLEIILVDDGSSDNSTELLTAAANDPD--SHIIAILLNRNYGQHSAIMAGFNQVSGDLIIT
YAIP_ECOLI      LLNPYFCR----VICVNDGSTDNTEAVMAEVKRKWGDRFVAVTQ-KNTGKG--GALMNGLNYATCDQVFL
ARNC_PSEFS      CKQLAY---EYEIILVDDGSRDNSAQLLEDAAAEDG--SNVVAVILNRNYGQHAAIMAGFEQCRGDVVIT
HAS1_MOUSE      -----------------------------------------------------------------DYVQV
HAS1_HUMAN      -----------------------------------------------------------------DYVQV
ARNC_ERWT9      QLALDY-----EILLVDDGSSDDSAAMLVAAAEAPD--SHIVAVLLNRNYGQHSAIMAGFSHVSGDLVIT
ALG5_DICDI      AIKFLNEKSKYEIIIIDDGSKDSTAKLVTSYIEKQPSSNIRLLK-LKQNRGKGGAVKRGILCSRGKYCLM
CHS_ECOLX       LCNQKTIYD-YEVIVADDGSKENIEEIVREFE---SLLNIKYVRQKDYGYQLCAVRNLGLRAAKYNYVAI
GLTL5_MACFA     VMNLTPHYFLEEIILVDDMSE------VDDLKEKLDFXXXXXXXXXXXXEGLIRARLIGASHASGDVLVI
NODC_BRAEL      IASQDY-AGKLRVIVVDDGSANR--DLLGPVHKIYDPRFRIILMAKNVGKRKAQI--AAIRSSSGDLVLN
ALG5_SCHPO      TVDKYYRSSRWEILIVDDESKDTTVNAVLEFSNKLDLRDHLRVCSLKRNRGKGGAVTWGMLYARGQYAIF
GALT8_HUMAN     IINRTPSRLLKEIILVDDFSSNHLDEKIKLYNQKYPGLLKIIRHPER--KGLAQARNTGWEAATADVVAI
NODC_RHILT      IPPRSYP-GMLRVYVADDGSRNRDAVVAEQLAYAGDARFEFIMLPRNVGKRKAQI--AAISRSSGDLILN
HASS_XENLA      CKGMKYPKDKLKIILVIDGNNEEDVYMMEIFKEVF---------------GKREVMYTAFRATSVDFILV
B3GNL_RAT       VLQQDF-EGTMELSVFNDASKDKSRAIIEKWKVKLEGISVVIDSPSPRGVGYSK--NQAIAQSTGSYLCF
B3GNL_MOUSE     VLQQDF-EGAMELSVFNDASKDKSRAIIEKWKVKLEGISVVIDSPSPRGVGYSK--NQAVAQSTGSYLCF
B3GNL_HUMAN     VLQQDF-EGTMELSVFNDASKDKSGAIIEKWRVKLEDVHVIIGGHDSPSRGVGYAKNQAVAQSSGSYLCF
Y706_RICBR      VLNQTH--ENFEVIVINDGSTEDISELI-KFCKKDKRIQYFHKK----NEGPASARNLGIKKSSGKYIAF
DPM1_DROME      MKGLEY-----EVIVIDDGSPDGTLDVAKDLQKIYGEDKIVL-RPRGSKLGLGTAYIHGIKHATGDFIVI
GTRB_BPP22      VREFNELKEEIEIVFINDGSKDATESIINKIAAS---DPLVIPLSFTRNFGKEPALFAGLDHATGDAVIP
DPM1_SCHPO      LIAKTFDQEKLEIVIIDDASPDGTQEVAKELQKIYGEDKILL-KPRSGKLGLGTAYIHGLKFATGDFVII
CRTQ_STAHJ      XXXXXXXXMRVECIVMDDDSNDRTAEIAREMGAK--VYNVTYDNNGNTWIGKSYACYLGASYTVSDILIF
ARNC_AERHH      VTAACDQSQNYEVILIDDGSHDGSTELIRDAAEGSKLVGVLL----NRNYGQHAAIMAGFETAKGDLVIT
AMSB_ERWAM      LNEQSYKN--FDVIIVDDKSADKLAEVVS--SERYSGLKLVLSETKLNGAG---ARNRGIDLATGDYVCF
Y868_HAEIN      CLNQSY--QNIELILIDDGSTXXXXXXXXXXXXXXXRVKLFFT-PTN--QGPAAARNIGLEKAQGDYITF
GTRB_SHIFL      VREFQELKPEVEIVFINDGSKDATESIINALAVS---DPLVVPLSFTRNFGKEPALFAGLDHASGDAVIP
GTRB_BPSF5      VREFQELKPEVEIVFINDGSKDATESIINALAVS---DPLVVPLSFTRNFGKEPALFAGLDHASGDAVIP
GTRB_BPSF2      VREFQELKPEVEIVFINDGSKDATESIINALAVS---DPLVVPLSFTRNFGKEPALFAGLDHASGDAVIP
ARNC_SALCH      CESL---SKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
Y501_SYNY3      LLEVLTPKITYEIICVNDGSKDKT---LKQLIDCYQSNRQIKIVNLSRNFGKEIALSAGIDYAQGNAVIP
Y329_RICTY      ALAQTYKN--IEIIVVNDGSKDKTETIALSYGDKICYF-----YKENGGCG--SALNYGIKNMKGE----
GTRB_ECOLI      VREFEELKSEVEIVFINDGSKDATESIINALAVS---DPLVVPLSFTRNFGKEPALFAGLDHATGDAIIP
Y339_RICPR      ALAQTYKN--IEIIVVNDGSKDETETIALSYGDKICYL-----YKENGGCG--SALNCGIKNMKG-----
GALT8_DROME     XXXXXXPIQLLREVILVDDGSTQADEKLNDFI-KIKFLNMVQHRRITTQVGLMHARVVGAELALADVLVF
ARNC_SALTY      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALTI      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALSV      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALPK      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALPC      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALPB      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALPA      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALNS      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALHS      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALG2      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALEP      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALDC      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
ARNC_SALA4      CESL---GKAWEILLIXXXXXXXXAELMVKASQEAD--SHIISILLNRNYGQHAAIMAGFSHVSGDLIIT
GTRB_BPSFX      VREFEELKPEVEIVFINDGSKDATESIINALAVS---DPLVVPLSFTRNFGKEPALFAGLDHTTGDAVIP
Y543_RICFE      ALAQTY--ENIEIVVVNDGSKDETENVALSYGDKIRYF-----HKENGGCG--SALNYGIKNMKGEYFSW
HAS2_XENLA      VKRLTYPG--MKVIMVIDGNSDDDLYMMNIFRETYVWKNNFHMKGPNETNGKREVMYTAFKARSVDYVQV
DPM1_YEAST      LFAGMSPEKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNE---RGLSSAVLKGFYEAKGQYLVC
CSBB_BACSU      FKNIHYD---YEIFFINDGSVDDTLQQIKDLAATCSRVKYISF---SRNFGKEAAILAGFEHVQGEAVIV
YFNE_BACSU      L-NQQECDEEFEVIVADNGSEDGTLSMLESFQADFPLIFTRIKENRGIAYGRNQALRN----ARGDILIF
G251B_XENLA     LDRLHYPKERISLWVATDHNFDNTSQILREW---------------------------------------
G251A_XENLA     LDTLHYPKERISLWVATDHNLDNTTEILREW---------------------------------------
DPM1_USTMA      LXXXXXXXXNTEIIIVDDNSRDGSVETVSALQSEGYNVRIIVR---TSERGLSSAVVRGFREARGQRMIC
TUAG_BACSU      VLDQSHP--HWEMIIVDDCSTDGTRDILQQY-EKIDERIHVVYLEENSG---------------------
HAS2_RAT        VKRLTYPG--IKVVMVIDGNSDDDLYMMDIFSEVMGRDKSVVTQLVLSNKGKREVMYTAFRARSVDYVQV
GALT3_DROME     VIN-RSPRHLLKEIILVDDASDRS--YLKRQLESYVKVLAVPTRIFRMKKGLVPARLLGAENARGDVLTF
ARNC_SODGM      TVAACEQLDAAEILLVXXXXXXXXAAVLTAAAEAPG--SHIVAVLLNRNYGQHSAIMAGFSHVTGDLVVT
Y028_MYCPN      LLLQGEYFTKTQVLIVNDGSTDNTKQIVEPYTQQYSNIEYL--EKPNGNWGSVVNFVKQNQLAKGQYITV
GT251_DANRE     IDRLNYPKDRMAVWVATDHNSDNTTEILREWQNFYHYVEWRPQDEPSVYEGES-----------------
DPM1_DICDI      -----------EVVIVEDNSPDGTLEVAQQLQKIYGEEKIILSRPGKMGLG--SAYMDGIKKSTGNWVIL
ARNC_SHESH      LAAADSMGKHYELVLIDDGSRDXXXXXXXXXXXXPD--SHVVGIILNRNYGQHNAIMAGFEHVRGDLIIT
HAS3_CHICK      ----------------------------------------------------------------------
HAS2_MOUSE      -----------------------------------------------------------------DYVQV
HAS2_HUMAN      -----------------------------------------------------------------DYVQV
HAS2_BOVIN      -----------------------------------------------------------------DYVQV
GGAA_BACSU      VLNQSIGKENIELILIDDGSVDSSPQICESFKNLYP-NNIKIMKIENS--GPSAARNCGLS---------
Y1943_SYNY3     VMDQLAST---ELVLINDGSGDRSLEMIRAL---HDQDKRVCYLSFARNFGHQVAVTAGLNFARGQAVII
GLTL6_HUMAN     IINRTPGSLIAEIILVDDFSEEHLKDKLEEYMARFSKVRIVRTK-KREGLIRTRLLGASMA--RGEVLTF
Y1222_METJA     LKKEGYK----NIVVVDDGSMDKTSEIAKK--------EGVIVCRHILNRGLGGALGTGIKCAKPKIIIT
NODC_BRASP      IASQDY-AGKLQVHVVDDGSANRVGPVHKIFANDPRFRIILLAK--NVGKRKAQI--AAIRSSSGDLVLN
ALG5_YEAST      AISFLKEKSRWEIVIVDDGSTDNTTQYCEQFKLNYEQFRII---KFSQNRGKGGAVRQGFLHIRGKYGLF
Y1676_METJA     TISNITGDDIVITSFVPENLIEKNNEVLNKYAEGFDDLRGISEDKDKAGEGLSYAIAESISEYGDAIIIA
CHS8_USTMA      -----------------------------------------------------------------EYILQ


                         +         .         .         .         .         *         .:210
query           YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
YDAM_BACSU      YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
ICAA_STAAR      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAAN      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAAM      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAAC      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAA8      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAAW      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAAS      LDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKS-SILGKIQTIEYASLIGCIKRSQTLAGAVNTI
ICAA_STAEP      LDADTVIDDDAPFYMIEDFKKNPKLGAVTGNPRIRNKS-SILGKIQTIEYASIIGCIKRSQSLAGAINTI
ICAA_STAEQ      LDADTVIDDDAPFYMIEDFKKNPKLGAVTGNPRIRNKS-SILGKIQTIEYASIIGCIKRSQSLAGAINTI
PGAC_ECOLI      XXXXXXXXXXXXY-IVEPMLYNPRVGAVTGNPR-IRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTV
PGAC_ECO57      XXXXXXXXXXXXY-IVEPMLYNPRVGAVTGNPR-IRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTV
CSLAA_ARATH     FDADFQPEPDYLQHSVPFLVHNPEVALVQARWRFMNANKCLMTRMQEM-SLNYHFMAESTRHAFF---SF
CSLA1_CYATE     FDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSEECMMTRLQEMSLDYHFSVEQEVGSSTYSFFGF
NODC_RHILV      VDSDTTIAPDVVSKLA-HKMRDPAVGAAMGQMKASNQADTWLTRLIDME----YWLARAAQARFGAVMCC
CSLA9_ARATH     FDADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGF
CSLA7_ARATH     FDADFQPDPDFLHRTVPFLIHNPKLALVQGRWEFVNAGQCMMTRLQEMSLSYHFTIEQQVXXXXXXXXXX
CSLAB_ARATH     FDADFQPEPDYLERTVPFLIHNPELALVQARWKFVNAKKCLMTRMQEMSLNYHFTAEQESGSTRHAFFGF
CSLAB_ORYSJ     FDADFQPESDFLLRTVPFLVHNSEIALVQTRWKFVNANECLLTRFQEMSLYHFKYEQEAGS-SVYSFFGF
NODC_RHIME      VDSDSTIAFDVVSKLA-SKMRDPEVGAVMGQLTASNSGDTWLTKLIDME----YWLARAAQSRFGAVMCC
CSLCC_ARATH     FDADFQPLPDFLKKTIPHFKDNEEIGLVQARWSFVNKEENLLTRLQNINLAFHFEVEQQVNSVFLNFFGF
CSLA4_ORYSJ     FDADFQPESDFLLKTIPFLVHNPKIGLVQTRWEFVNYDVCLMTRIQKMSLDYHFKVEQESGSSMHSFFGF
CSLAF_ARATH     FDADFQPEPDYLQRAIPFLIHNPEVALVQARWRFVNANTCLMTRMQEM-SLNYHFMAQSGSTR-HAFFGF
CSLA7_ORYSJ     FDADFQPEPNFLLRTVPFLMHNPNVALVQARWAFVNDTTSLLTR---VQKMFFDYVEQEAGSATFAFFSF
CSLA5_ORYSJ     FDADFQPEPDFLLRTVPFLMHNQNVALVQARWVFVNDRVSLLTR-IQKTFLDYHFKAQEAGSATFAFFSF
CSLC8_ARATH     FDADFQPNSDFLKLTVPHFKEKPELGLVQARWAFVNKDENLLTRLQNI-NLCFHFVEQQXXXXXXXXXXX
CSLA6_ORYSJ     LDADFQPPPDFLLKTVPFLVHNPRLALVQTRWEFVNANDCLLTRMQEMSMDYHFKVEQEAGSSLCNFFGY
CSLCA_ORYSJ     FDADFQPYPDFLKRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQNI-NLCFHFVEQQVXXXXXXXXXX
CSLCA_ORYSI     FDADFQPYPDFLKRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQNI-NLCFHFVEQQVXXXXXXXXXX
CSLC5_ARATH     FDADFQPTPDFLKLTVPHFKDNPELGLVQARWTFVNKDENLLTRLQNI-NLCFHFVEQQXXXXXXXXXXX
CSLC7_ORYSJ     FDADFQPQADFLKRTVPHFKGKDDVGLVQARWSFVNKDENLLTRLQNV-NLCFHFVEQQVXXXXXXXXXX
CSLA1_ARATH     FDADFQPEPDYLIRAVPFLVHNPDVALVQARWIFVNANKCLMTRMQEMSLNYHFKVEQESGSTRHAFFGF
CSLA1_ORYSJ     FDADFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGF
CSLC1_ORYSJ     FDADFQPQADFLKRTVPHFKGNEDVGLVQARWSFVNKDENLLTRLQNI-NLCFHFVEQQXXXXXXXXXXX
CSLA2_ARATH     FDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGF
CSLC4_ARATH     FDADFTPNPDFLKKTVPHFKGNPELGLVQARWSFVNKDENLLTRLQNI-NLCFHFVEQQXXXXXXXXXXX
CSLA9_ORYSJ     FDADFQPDPDFLARTIPFLVHNPDIALVQARWKFVNANECLMTRMQEMSLDYHFKVEQEVGSSTHAFFGF
NODC_RHISN      VDSDTTIAPDVVTKLALK-MYSPAVGAAMGQLTASNRSDTWLTRLIDME----YWLARAAQARFGAVMCC
CSLA3_ARATH     FDADFQPDPDFLERTIPFLIHNHEISLVQCRWKFVNANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGF
CSLC9_ORYSJ     FDADFQPNPDFLKRTVPHFKDNDELGLVQARWSFVNKDENLLTRLQNI-NLCFHFVEQQVXXXXXXXXXX
CSLA3_ORYSJ     FDADFQPEPDFLLRTIPYLVRNPQIGLVQAHWEFVNTSECLMTRIQKMTLHYHFKVEQEXXXXXXXXXXX
NODC_RHIS3      VDSDTTLASDVIRKLARK-MQDPAIGAAMGQLTASNRSDTWLTRLIDMELACNEERAAQARFGAVMCCCG
CSLA2_ORYSJ     FDADFEPESDFLLKTMPYLLHNPKIALVQTRWEFVNYNVCLMTRIQKMSLDYHFKVEQESGSFMHAFFGF
BCSA_PSEFS      FDADHVPTRSFLQVSLGWFLKDPKLAMLQTPFSPDPFEKNLDTRAVPNEGELFYGLVQDGNDLW-NATFF
CSLC6_ARATH     FDADFQPPADFLKKTVPHFKGNEELALVQTRWAFVNKDENLLTRLQNINLSFHFEVEQQXXXXXXXXXXX
BCSA_ECOLI      FDCDHVPTR-SFLQMTMGWFLKEKQLAMMHHFFSPDPFERNLGRFRKTEGTLFYGLVQDGNDMW-DATFF
BCSA_SALTI      FDCDHVPTR-SFLQMTMGWFLKEKQLAMMQTFFSPDPFERNLGRFRKTEGTLFYGLVQDGNDMW-DATFF
BCSA_ECO57      FDCDHVPTR-SFLQMTVGWFLKEKQLAMMHHFFSPDPFERNLGRFRKTEGTLFYGLVQDGNDMW-DATFF
CSLC2_ORYSJ     FDADFQPTPDFLKKTIPHFEGNPELGLVQARWSFVNKDENLLTRLQNIN-LCFHFVEQQXXXXXXXXXXX
CSLC2_ORYSI     FDADFQPTPDFLKKTIPHFEGNPELGLVQARWSFVNKDENLLTRLQNIN-LCFHFVEQQXXXXXXXXXXX
BCSA_SALTY      FDCDHVPTR-SFLQMTMGWFLKEKQLAMMQTFFSPDPFERNLGRFRKTEGTLFYGLVQDGNDMW-DATFF
NODC_RHILO      VDSDTILAPDVITRLALK-MQDQAVGAAMGQLAASNRSETWLTRLIDME----YWLARAAQARFGAVMCC
CSLC3_ORYSJ     FDADFQPNPDFLKLTVPHFKGNPELGLVQARWSFVNKDENLLTRLQNIN-LCFHFVEQQVNGVYLSFFGF
CSLAE_ARATH     FDADFQPEPDFLERTVPFLVHNPEIALVQAGWKYGNADECCMTRIQEMSLNYHFAVEQKSGSSILGFFGF
NODC_AZOC5      VDSDTVIDKDVVTKLASS-MRAPNVGGVMGQLVAKNRERSWLTRLIDME----YWLACNAQSRFGSVMCC
ACSA1_ACEXY     FDCDHVPTR-AFLQLTMGWMVEDPKIALMHHFYSPDPFQRNLSAGYRTEGNLFYGVVQDGNDFW-DATFF
ACSA2_ACEXY     FDCDHIPTRGFLKKTIGWMMADPKLALLQTPHHFYSPQRNLATQNVPPEGNMFYGLVQDGNDFW-DATFF
BCSA3_ACEXY     LDCDHIPTRAFLQISMGWMVSDSNIALLQTPHHFYSPDPFQRNLAVGYRTPLFYGVIQDGNDFW-DATFF
BCSA5_ACEXY     FDCDHVPTRGFLRRTIGWMMADPNLALLPHHFYAPDPFQRNLAGGMHVEGNMFYGLVQDGNDFW-DATFF
BCSA4_ACEXY     FDCDHVPTRGFLRRTIGWMMADPNLALLPHHFYAPDPFQRNLAGGMHVEGNMFYGLVQDGNDFW-DATFF
NODC_RHIGA      VDSD-TSIASDVVTLLVEKMRDSDVGAAMGQLKASNRDKNLLTRLIDMELACNDERAAQARFGAVMCCCG
ARNC_WIGBR      MDADNPPEEIPKL-----ILNAEKGYDVIGTFR-------------------------------------
ARNC_PECCP      LDADNPPEEI------------------------------------------------------------
BCSA2_ACEXY     LDCDHIPTRAFLQIAMGWMVADRKIALMQTPHHFYSPDPFQRNLAVGYRTPLFYGVIQDGNDFW-DATFF
BCSA1_ACEXY     LDCDHIPTRAFLQIAMGWMVADRKIALMQTPHHFYSPDPFQRNLAVGYRTPLFYGVIQDGNDFW-DATFF
ARNC_ERWCT      LDADNPPEEI------------------------------------------------------------
ARNC_PHOLL      LDADNPPEEI------------------------------------------------------------
NODC_BRAJA      VDSDTILAADVVTKLVLK-MHDPGIGAAMGQLIASNRNQTWLTRLIDME----YWLARAAQARFGAVMCC
ARNC_PROMH      LDADNPPEEI------------------------------------------------------------
ARNC_SERP5      LDADNPPEEI------------------------------------------------------------
HASA_STRPY      VDSDTYIYPNALEEL-LKSFNDETVYAATGHLNARNRQTNLLTRLTDI----------------------
HASA_STRP8      VDSDTYIYPNALEEL-LKSFNDETVYAATGHLNARNRQTNLLTRLTDI----------------------
HASA_STRP6      VDSDTYIYPNALEEL-LKSFNDETVYAATGHLNARNRQTNLLTRLTDI----------------------
HASA_STRP3      VDSDTYIYPNALEEL-LKSFNDETVYAATGHLNARNRQTNLLTRLTDI----------------------
HASA_STRP1      VDSDTYIYPNALEEL-LKSFNDETVYAATGHLNARNRQTNLLTRLTDI----------------------
EPSH_BACSU      IDSDD-----------------------------------------------------------------
ARNC_EDWI9      LDADNPPEEI------------------------------------------------------------
HAS1_XENLA      CDSDTKLDELATVEMVKVLESNDMYGAVGGDVRILNPYDS----FISFMSSLRYWMAERACQSYFDVSCI
ARNC_PSEU2      LDADNPPEEI------------------------------------------------------------
ARNC_PSEF5      LDADNPPEEI------------------------------------------------------------
ARNC_YERE8      LDADNPPEEI------------------------------------------------------------
ARNC_ECOLU      LDADNPPEEI------------------------------------------------------------
ARNC_PSEAE      LDADNPPEEIAQGYDVVGSIRAERQDSAWRRWRLVNLA--------------------------------
ARNC_PSEAB      LDADNPPEEIAQGYDVVGSIRAERQDSAWRRWRLVNLA--------------------------------
ARNC_PSEA8      LDADNPPEEIAQGYDVVGSIRAERQDSAWRRWRLVNLA--------------------------------
ARNC_PSEA7      LDADNPPEEIAQGYDVVGSIRDNRRDSAWRRWRLVNLA--------------------------------
ARNC_ECOSM      LDADNPPEEI------------------------------------------------------------
YTH1_RHOER      LDSDVIP-RAGWLELMLGHFSDPGVALVAPRIVALDPYGTALARYENMRSSLDLGRKEAAVKSGSPVAYV
EPSJ_BACSU      VDGDD-----------------------------------------------------------------
ARNC_ECO5E      LDADNPPEEI------------------------------------------------------------
ARNC_ECO57      LDADNPPEEI------------------------------------------------------------
Y1578_HAEIN     MDADDIAKPSWIEKIVTYLEKNDHITAMGSYLEII-----------------------------------
BCSA_XANAC      FDCDHIPTRSFLQVAMGWFLHDTKLALVQMPFSPDPFERNLDTHKVPNEGELFYGLLQDGNDQW-NATFF
ARNC_PSE14      LDADNPPEEI------------------------------------------------------------
ARNC_ECO7I      LDADNPPEEI------------------------------------------------------------
ALG5_MOUSE      ADADGATKFPDVEKLEKGL---------------------------------------------------
ALG5_HUMAN      ADADGATKFPDVEKLEKGL---------------------------------------------------
ARNC_SHISS      LDADNPPEEI------------------------------------------------------------
ARNC_SHIFL      LDADNPPEEI------------------------------------------------------------
ARNC_SHIF8      LDADNPPEEI------------------------------------------------------------
ARNC_SHIDS      LDADNPPEEI------------------------------------------------------------
ARNC_SHIBS      LDADNPPEEI------------------------------------------------------------
ARNC_ECOSE      LDADNPPEEI------------------------------------------------------------
ARNC_ECOLI      LDADNPPEEI------------------------------------------------------------
ARNC_ECOLC      LDADNPPEEI------------------------------------------------------------
ARNC_ECOHS      LDADNPPEEI------------------------------------------------------------
ARNC_ECODH      LDADNPPEEI------------------------------------------------------------
ARNC_ECOBW      LDADNPPEEI------------------------------------------------------------
ARNC_ECO8A      LDADNPPEEI------------------------------------------------------------
ARNC_ECO55      LDADNPPEEI------------------------------------------------------------
ARNC_ECO24      LDADNPPEEI------------------------------------------------------------
YIBD_ECOLI      VDADD-----------------------------------------------------------------
GGAB_BACSU      LDPDD-----------------------------------------------------------------
ARNC_PSEPF      LDADNPPEEI------------------------------------------------------------
ARNC_ESCF3      LDADNPPEEI------------------------------------------------------------
ARNC_ECOUT      LDADNPPEEI------------------------------------------------------------
ARNC_ECOL6      LDADNPPEEI------------------------------------------------------------
ARNC_ECOL5      LDADNPPEEI------------------------------------------------------------
ARNC_ECOK1      LDADNPPEEI------------------------------------------------------------
ARNC_ECO81      LDADNPPEEI------------------------------------------------------------
ARNC_ECO45      LDADNPPEEI------------------------------------------------------------
ARNC_ECO27      LDADNPPEEI------------------------------------------------------------
ARNC_AERS4      LDADNPPEEI------------------------------------------------------------
ARNC_ENT38      LDADNPPEEI------------------------------------------------------------
YKCC_BACSU      IDADDPPE------LILEMIEKWKEG-----YEVVYAVRT------------------------------
Y075_MYCPN      LDSDDT----------------------------------------------------------------
ARNC_YERPY      LDADNPPEEI------------------------------------------------------------
ARNC_YERPS      LDADNPPEEI------------------------------------------------------------
ARNC_YERPP      LDADNPPEEI------------------------------------------------------------
ARNC_YERPB      LDADNPPEEI------------------------------------------------------------
Y544_METJA      XDGDYQHKPMDIPKL-LKKLEDTNADAVFGKYKHIPLHRQISNFFASILT--------------------
HAS_PASMU       LDCDMAPNPLWVHSYVAELLEDDDL-TIIGPRKYIDTQHIDPKDFLNNATVSLDWLEQFEKTENLRLSDS
CHS_PASMU       LDCDMAPQQLWVHSYLTELLEDNDI-VLIGPRKYVDTHNITAEQFLNIESISLDWRLEDSPFRYFSCG--
ARNC_YERPN      LDADNPPEE-------------------------------------------------------------
ARNC_YERPG      LDADNPPEE-------------------------------------------------------------
ARNC_YERPE      LDADNPPEE-------------------------------------------------------------
ARNC_YERPA      LDADNPPEE-------------------------------------------------------------
YAIP_ECOLI      SDADTPPDQDGMGYMLAEI--ERGADAVGGIPSTALKGAGLLPHIVKLPMIVMKRTLQGG-----APFII
ARNC_PSEFS      LDADNPPEEI------------------------------------------------------------
HAS1_MOUSE      CDSDTRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLFNVERACQSY--------FHCVSCI
HAS1_HUMAN      CDSDTRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLFNVERACQSY--------FHCVSCI
ARNC_ERWT9      LDADNPPEEI------------------------------------------------------------
ALG5_DICDI      VDADGATE--------------------------------------------------------------
CHS_ECOLX       LDCDMAPNPLWVQYMELLAVDDNV--ALIGPRKYIDTSKHTYLDFLSQKSLINEKVEQNKSVDWLRLCNT
GLTL5_MACFA     LDSHCEVNRVWLEPLLHAIAKDPK--MVVRPLIDVIDDRTLEYKPSPVVRGAFDWNLQEGPTKPIRSPAM
NODC_BRAEL      VDSD-TILAVDVVTKLVSKMQDPDVGAAMGQLVASNRNETWLTK--------------------------
ALG5_SCHPO      ADADGASQ--------------------------------------------------------------
GALT8_HUMAN     LDA-HIEVNVGWAEPILARIQEDRTVIVSPVFDNI--------RFDTFKLDKYELAVDGFNWEWCRYDAL
NODC_RHILT      VDSDTTLASDVVSKL-SQKMRDPAVGAVMGQLVASNQSDSWLTR--------------------------
HASS_XENLA      CNSDIKLDKMATVELVKVLEDDDKNGAVGGDVRVWNRRDS----FISFMSSLRYWMVEIACQSYFDSVTI
B3GNL_RAT       LDSDDVPQRVRMQY--------------------------------------------------------
B3GNL_MOUSE     LDSDDVPQRVRMQYEAAG----------------------------------------------------
B3GNL_HUMAN     LDSDD-----------------------------------------------------------------
Y706_RICBR      LDSDD-----------------------------------------------------------------
DPM1_DROME      IDAD------------------------------------------------------------------
GTRB_BPP22      IDVD------------------------------------------------------------------
DPM1_SCHPO      MDAD------------------------------------------------------------------
CRTQ_STAHJ      MDAD------------------------------------------------------------------
ARNC_AERHH      LDADNPPEEI------------------------------------------------------------
AMSB_ERWAM      LDADD-----------------------------------------------------------------
Y868_HAEIN      LDSDD-----------------------------------------------------------------
GTRB_SHIFL      IDVD------------------------------------------------------------------
GTRB_BPSF5      IDVD------------------------------------------------------------------
GTRB_BPSF2      IDVD------------------------------------------------------------------
ARNC_SALCH      LDADNPPEEI------------------------------------------------------------
Y501_SYNY3      IDADLQDPPELIHELV------------------------------------------------------
Y329_RICTY      ----------------------------------------------------------------------
GTRB_ECOLI      IDVD------------------------------------------------------------------
Y339_RICPR      ----------------------------------------------------------------------
GALT8_DROME     LDSHVEVTKGWLEPLIAPILEDNR------------TCTTPIIDTIDFDNFAYRGKPSRGFFNWFNYIQL
ARNC_SALTY      LDADNPPEEI------------------------------------------------------------
ARNC_SALTI      LDADNPPEEI------------------------------------------------------------
ARNC_SALSV      LDADNPPEEI------------------------------------------------------------
ARNC_SALPK      LDADNPPEEI------------------------------------------------------------
ARNC_SALPC      LDADNPPEEI------------------------------------------------------------
ARNC_SALPB      LDADNPPEEI------------------------------------------------------------
ARNC_SALPA      LDADNPPEEI------------------------------------------------------------
ARNC_SALNS      LDADNPPEEI------------------------------------------------------------
ARNC_SALHS      LDADNPPEEI------------------------------------------------------------
ARNC_SALG2      LDADNPPEEI------------------------------------------------------------
ARNC_SALEP      LDADNPPEEI------------------------------------------------------------
ARNC_SALDC      LDADNPPEEI------------------------------------------------------------
ARNC_SALA4      LDADNPPEEI------------------------------------------------------------
GTRB_BPSFX      IDVD------------------------------------------------------------------
Y543_RICFE      LSHDDIPNKIEHQVNILNKL-DNKDTIIYGGYELIDEKGSSL-RYIKPDSV-------------------
HAS2_XENLA      CDSDTVLDPASSVEMVKVLEEDIMVGGVGGDVQILNKYDSWISFLSSVR----YWMAERACQSYFGVQCI
DPM1_YEAST      MDAD------------------------------------------------------------------
CSBB_BACSU      MDAD------------------------------------------------------------------
YFNE_BACSU      HDSDMLAAKDLVAKHIKAHENEE-----------------------------------------------
G251B_XENLA     ----------------------------------------------------------------------
G251A_XENLA     ----------------------------------------------------------------------
DPM1_USTMA      MDADLQHPPEAVPSLLLAL-NGQKS---------------------------------------------
TUAG_BACSU      ----------------------------------------------------------------------
HAS2_RAT        CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVR----YWMAERACQSYFGVQCI
GALT3_DROME     LDAHCECSRGWLEPL-LSRIKESRKVVICPVIDIISDDNFSYTKTFENHWGAFNWQLS---FRWFSIATM
ARNC_SODGM      LDADNPPEEI------------------------------------------------------------
Y028_MYCPN      LDSDD-----------------------------------------------------------------
GT251_DANRE     ----------------------------------------------------------------------
DPM1_DICDI      MDADHHPKFIPQFIEKQKKLNCESGGGVFG----WNLYRKLTSRVANY--IASVLLTPG-------VSDL
ARNC_SHESH      LDADNPPEEI------------------------------------------------------------
HAS3_CHICK      ----------------------------------------------------------------------
HAS2_MOUSE      CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVR----YWMAERACQSYFGVQCI
HAS2_HUMAN      CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVR----YWMAERACQSYFGVQCI
HAS2_BOVIN      CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVR----YWMAERACQSYFGVQCI
GGAA_BACSU      ----------------------------------------------------------------------
Y1943_SYNY3     LDAD------------------------------------------------------------------
GLTL6_HUMAN     LDS-------------------------------------------------------------------
Y1222_METJA     FDAD------------------------------------------------------------------
NODC_BRASP      VDSD------------------------------------------------------------------
ALG5_YEAST      ADADGASKFSDVEKLI------------------------------------------------------
Y1676_METJA     FDGESFVDEMALFVKEIG----EKFGYDVG----------------------------------------
CHS8_USTMA      VDADTEVEAMSLNRFISAFIRDKKVIGLCGETALSNAKASIITMLQVYEYYISHYLAKAFESLFGSVTCL


                         .         .         .         +         .         .         .:280
query           PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGN
YDAM_BACSU      PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGN
ICAA_STAAR      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAAN      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAAM      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAAC      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAA8      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAAW      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAAS      SGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYRIKYEPLAMCWMLVPETLGGLWKQRVRWAQGG
ICAA_STAEP      SGVFTLFKKSALKDVGYWDTDMITEDIAVSWKLHLFDYEIKYEPRALCWMLVPETIGGLWKQRVRWAQGG
ICAA_STAEQ      SGVFTLFKKSALKDVGYWDTDMITEDIAVSWKLHLFDYEIKYEPRALCWMLVPETIGGLWKQRVRWAQGG
PGAC_ECOLI      SGVIAAFRRSALAEVGYWSDDMITEDIDISWKLQLNQWTIFYEPRALCWILMPETLKGLWKQRLRWAQGG
PGAC_ECO57      SGVIAAFRRSALAEVGYWSDDMITEDIDISWKLQLNQWTIFYEPRALCWILMPETLKGLWKQRLRWAQGG
CSLAA_ARATH     NGTAGVWRMAAMEEAGGWHDRTTVEDMDLAVRAGLLGWKFVFLNDLTVKSELPSKFKAFRFQQHRWSCGP
CSLA1_CYATE     NGTAGVWRIQAIKDAGGWKDRTTVEDMDLAVRASLHGWEFVFVGDVKVKNELPSTFKAYRFQQHRWSCGP
NODC_RHILV      CGPCAMYRRSAMLSLLDQYETQLGEDRHLTILMLSAGFRTEYVPSAIAATVVPDTMGVYLRQQLRWAR--
CSLA9_ARATH     NGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCG-
CSLA7_ARATH     XXXXXVWRISALNESGGWNDQTTVEDMDLAVRATLRGWKFLYIDDLKVKSELPCSFKALRSQQHRWTCGP
CSLAB_ARATH     NGTAGVWRLAAMEEAGGWKDRTTVEDMDLAVRVGLHGWKFVFVNDVSVKSELPSQFKAFRFQQHRWSCGP
CSLAB_ORYSJ     NGTAGVWRIAAIDDAGGWKDRTTVEDMDLAVRATLQGWKFVYVGDVKVKSELPSTFKAYRFQQHRWSCGP
NODC_RHIME      CGPCAMYRRSALASLLDQYETQLGEDRHLTILMLKAGFRTEYVPDAIVATVVPDTLKPYLRQQLRWAR--
CSLCC_ARATH     NGTAGVWRIKALEDSGGWLERTTVEDMDIAVRAHLHGWKFVFLNDVECQCELPESYEAYRKQQHRWHSG-
CSLA4_ORYSJ     NGTAGVWRVSAINEAGGWKDRTTVEDMDLAVRASLKGWQFLYVGDIRVKSELPSTFKAYRHQQHRWTCGA
CSLAF_ARATH     NGTAGVWRMVAMEEAGGWKDRTTVEDMDLAVRVGLLGWKFIFVNDLEVKSELPSQFKAFRFQQHRWSCGP
CSLA7_ORYSJ     NGTAGVWRTTAINEAGGWKDRTTVEDMDLAVRASLNGWKFIYVGDIRVKSELPSTYGAYCRQQFRWACG-
CSLA5_ORYSJ     NGTAGVWRTEAINDAGGWKDRTTVEDMDLAVRATLKGWKFIYLGDLRVKSELPSTYKAYCRQQFRWSCGG
CSLC8_ARATH     XXTAGVWRIKALEESGGWLERTTVEDMDIAVRAHLHGWKFIYLNDVKVLCEVPESYEAYKKQQHRWHSG-
CSLA6_ORYSJ     NGTAGVWRRQVIDESGGWEDRTTAEDMDLALRAGLLGWEFVYVGSIKVKSELPSTLKAYRSQQHRWSCGP
CSLCA_ORYSJ     XXTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFVFLNDVECQCELPESYEAYRKQQHRWHSG-
CSLCA_ORYSI     XXTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFVFLNDVECQCELPESYEAYRKQQHRWHSG-
CSLC5_ARATH     XXTAGVWRIKALEESGGWLERTTVEDMDIAVRAHLHGWKFIYLNDVKVLCEVPESYEAYKKQQHRWHSG-
CSLC7_ORYSJ     XXXXXVWRIKALEDSGGWMERTTVEDMDIAVRAHLKGWKFVFLNDVECQCELPESYEAYRKQQHRWHSG-
CSLA1_ARATH     NGTAGVWRISAMEAAGGWKSRTTVEDMDLAVRVGLHGWKFVYLNDLTVRNELPSKFKAYRFQQHRWSCGP
CSLA1_ORYSJ     NGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQHRWSCGP
CSLC1_ORYSJ     XXTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLKGWKFLYINDVECQCELPESYEAYRKQQHRWHSG-
CSLA2_ARATH     NGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGP
CSLC4_ARATH     XXTAGVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIYLNDVEVTCELPESYEAYKKQQHRWHSG-
CSLA9_ORYSJ     NGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLMVKSELPSTFKAFRYQQHRWSCGP
NODC_RHISN      CGPCAMYRRSALLLLLDKYETQLGEDRHLTILMLNAGFRTEYVPEAIAATVVPNSMGAYLRQQLRWAR--
CSLA3_ARATH     NGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQQHRWSCGP
CSLC9_ORYSJ     XXTAGVWRIKALDDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGP
CSLA3_ORYSJ     XXXXXVWRISALEEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLADVKVKSELPSNLKTYRHQQHRWTCG-
NODC_RHIS3      PCAMYR-RSSLLSLLDQYETQMFGEDRHLTILMLEAGFRTEYVPDAIAVTVVPDRLGPYLRQQLRWAR--
CSLA2_ORYSJ     NGTAGVWRVSAINQSGGWKDRTTVEDMDLAVRASLKGWEFLYVGDIRVKSELPSTFQAYRHQQHRWTCG-
BCSA_PSEFS      CGSCAVIRREPLLEIGGVAVETVTEDAHTALKLNRLGYNTAYLAIPQAAGLATESLSRHINQRIRWARG-
CSLC6_ARATH     XXTAGVWRIKALEDCGGWLERTTVEDMDIAVRAHLCGWKFIYLNDVKCLCELPESYEAYKKQQYRWHSGP
BCSA_ECOLI      CGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAAGLATESLSAHIGQRIRWARG-
BCSA_SALTI      CGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQSAGLATESLSAHIGQRIRWARG-
BCSA_ECO57      CGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAAGLATESLSAHIGQRIRWARG-
CSLC2_ORYSJ     XXTAGVWRIQALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGP
CSLC2_ORYSI     XXTAGVWRIQALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGP
BCSA_SALTY      CGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAAGLATESLSAHIGQRIRWARG-
NODC_RHILO      CGPCAMYRRSLVSLLDQYETQRFGEDRHLTILMLKAGFRTEYVPEAVAATVVPNSMGPYLRQQLRWAR--
CSLC3_ORYSJ     NGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYQAYRKQQHRWHSGP
CSLAE_ARATH     NGTAGVWRIKALNEAEGWKDRTIVEDMDLAVRAYLRGSKFVYVDDVKVKNELPSSFQAYRFQQHRWSCGP
NODC_AZOC5      CGPCAMYRRSAITPLAEYEHQTFGEDRHLTILMLKAGFRTGYVPGAVARTLVPDGLAPYLRQQLRWAR--
ACSA1_ACEXY     CGSCAILRRTAIEQIGGFATQTVTEDAHTALKMQRLGWSTAYLRIPLAGGLATERLILHIGQRVRWARG-
ACSA2_ACEXY     CGSCAAIRRSAVLGIGGFATETVTEDAHTALKMQREGWHTAYLRQPLAAGLSTERLMLHIGQRVRWARG-
BCSA3_ACEXY     CGSCAILRRKAIEEIGGFATETVTEDAHTALRMQRKGWSTAYLRIPLASGLATERLITHIGQRMRWARG-
BCSA5_ACEXY     CGSCAIIRREAVMGIGGFATETVTEDAHTALKMQRRGWGTAYLREPLAAGLATERLILHIGQRVRWARG-
BCSA4_ACEXY     CGSCAIIRREAVMGIGGFATETVTEDAHTALKMQRRGWGTAYLREPLAAGLATERLILHIGQRVRWARG-
NODC_RHIGA      PXXXXXXXXXXXXXXXXGKPSDFGEDRHLTILMLSAGFRTEYVPEAIAKTVVPDRMGSYLRQQLRWAR--
ARNC_WIGBR      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
BCSA2_ACEXY     CGSCAILRREAIESIGGFAVETVTEDAHTALRMQRRGWSTAYLRIPVASGLATERLTTHIGQRMRWARG-
BCSA1_ACEXY     CGSCAILRREAIESIGGFAVETVTEDAHTALRMQRRGWSTAYLRIPVASGLATERLTTHIGQRMRWARG-
ARNC_ERWCT      ----------------------------------------------------------------------
ARNC_PHOLL      ----------------------------------------------------------------------
NODC_BRAJA      CGPCAMYRRSALALLGKPSD--FGEDRHLTILMLKAGFRTEYVPDAIAATVVPHSLRPYLRQQLRWAR--
ARNC_PROMH      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
HASA_STRPY      ----------------------------------------------------------------------
HASA_STRP8      ----------------------------------------------------------------------
HASA_STRP6      ----------------------------------------------------------------------
HASA_STRP3      ----------------------------------------------------------------------
HASA_STRP1      ----------------------------------------------------------------------
EPSH_BACSU      ----------------------------------------------------------------------
ARNC_EDWI9      ----------------------------------------------------------------------
HAS1_XENLA      SGPLGMYRNNILQVLEAWYRQTLGDDRHLTNRVLSMGYRTKYTHKSRAFSETPSLYLRWLNQQTRWTK--
ARNC_PSEU2      ----------------------------------------------------------------------
ARNC_PSEF5      ----------------------------------------------------------------------
ARNC_YERE8      ----------------------------------------------------------------------
ARNC_ECOLU      ----------------------------------------------------------------------
ARNC_PSEAE      ----------------------------------------------------------------------
ARNC_PSEAB      ----------------------------------------------------------------------
ARNC_PSEA8      ----------------------------------------------------------------------
ARNC_PSEA7      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
YTH1_RHOER      PSAAVIVRRDVALECNGFDESLVAEDVDFCWRLQAAGWRLRYEPVAHVAHDHRVQFDKWFARRAFYGTG-
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
Y1578_HAEIN     ----------------------------------------------------------------------
BCSA_XANAC      CGSCAVIKRTALXXXXXXXXXXXXXDAHTALKLQRRGYRTAYLAVPQAAGLATESLSGHVAQRIRWARG-
ARNC_PSE14      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
ALG5_MOUSE      ----------------------------------------------------------------------
ALG5_HUMAN      ----------------------------------------------------------------------
ARNC_SHISS      ----------------------------------------------------------------------
ARNC_SHIFL      ----------------------------------------------------------------------
ARNC_SHIF8      ----------------------------------------------------------------------
ARNC_SHIDS      ----------------------------------------------------------------------
ARNC_SHIBS      ----------------------------------------------------------------------
ARNC_ECOSE      ----------------------------------------------------------------------
ARNC_ECOLI      ----------------------------------------------------------------------
ARNC_ECOLC      ----------------------------------------------------------------------
ARNC_ECOHS      ----------------------------------------------------------------------
ARNC_ECODH      ----------------------------------------------------------------------
ARNC_ECOBW      ----------------------------------------------------------------------
ARNC_ECO8A      ----------------------------------------------------------------------
ARNC_ECO55      ----------------------------------------------------------------------
ARNC_ECO24      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
GGAB_BACSU      ----------------------------------------------------------------------
ARNC_PSEPF      ----------------------------------------------------------------------
ARNC_ESCF3      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
ARNC_AERS4      ----------------------------------------------------------------------
ARNC_ENT38      ----------------------------------------------------------------------
YKCC_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
ARNC_YERPY      ----------------------------------------------------------------------
ARNC_YERPS      ----------------------------------------------------------------------
ARNC_YERPP      ----------------------------------------------------------------------
ARNC_YERPB      ----------------------------------------------------------------------
Y544_METJA      ----------------------------------------------------------------------
HAS_PASMU       PAGNVAFAKKWLNKSGFFDEEFNGEDVEFGYRLFRYGSFFKTIDGIMAYHQEP-----------------
CHS_PASMU       ---NVAFSKEWLNKVGWFDEEFNGEDVEFGYRLFAKGCFFRVIDGGMAYHQEP-----------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------
YAIP_ECOLI      SGACGMFRTDVLRKF-GFSDRTKVEDLDLTWTLVANGYRIRQANRCIVYPQE------------------
ARNC_PSEFS      ----------------------------------------------------------------------
HAS1_MOUSE      SGPLGLYRNNLLQQLEAWYNQTFGDDRHLTNRMLSMGYATKYTSRSRCYSETPSSFLRWLSQQTRWSK--
HAS1_HUMAN      SGPLGLYRNNLLQQLEAWYNQTFGDDRHLTNRMLSMGYATKYTSRSRCYSETPSSFLRWLSQQTRWSK--
ARNC_ERWT9      ----------------------------------------------------------------------
ALG5_DICDI      ----------------------------------------------------------------------
CHS_ECOLX       PGGNVAFAKKWLFRAGWFDEEFTGEDNEFGYRLYREGCYFRSVEGAMAYHQEP-----------------
GLTL5_MACFA     SGGIFAIRRHYFNEIGQYDDFWGGENLELSLRIWMCGGQLFIIPCS------------------------
NODC_BRAEL      ----------------------------------------------------------------------
ALG5_SCHPO      ----------------------------------------------------------------------
GALT8_HUMAN     PQAILAANRHFLGEIGSLDGGMLGENVELSLRVWQCGGKVEILPCS------------------------
NODC_RHILT      ----------------------------------------------------------------------
HASS_XENLA      RGSLGMYRNDILQALEFWYNKTIGDDRFLTNRVLSMGYRTKYSHKSCAY--APCQYLRWLNQQTPWAR--
B3GNL_RAT       ----------------------------------------------------------------------
B3GNL_MOUSE     ----------------------------------------------------------------------
B3GNL_HUMAN     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
GTRB_BPP22      ----------------------------------------------------------------------
DPM1_SCHPO      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
GTRB_SHIFL      ----------------------------------------------------------------------
GTRB_BPSF5      ----------------------------------------------------------------------
GTRB_BPSF2      ----------------------------------------------------------------------
ARNC_SALCH      ----------------------------------------------------------------------
Y501_SYNY3      ----------------------------------------------------------------------
Y329_RICTY      ----------------------------------------------------------------------
GTRB_ECOLI      ----------------------------------------------------------------------
Y339_RICPR      ----------------------------------------------------------------------
GALT8_DROME     PGGLFAIGREWFSELGGY-DKGLAEQFELSLKLWLCGGQILEVPCS------------------------
ARNC_SALTY      ----------------------------------------------------------------------
ARNC_SALTI      ----------------------------------------------------------------------
ARNC_SALSV      ----------------------------------------------------------------------
ARNC_SALPK      ----------------------------------------------------------------------
ARNC_SALPC      ----------------------------------------------------------------------
ARNC_SALPB      ----------------------------------------------------------------------
ARNC_SALPA      ----------------------------------------------------------------------
ARNC_SALNS      ----------------------------------------------------------------------
ARNC_SALHS      ----------------------------------------------------------------------
ARNC_SALG2      ----------------------------------------------------------------------
ARNC_SALEP      ----------------------------------------------------------------------
ARNC_SALDC      ----------------------------------------------------------------------
ARNC_SALA4      ----------------------------------------------------------------------
GTRB_BPSFX      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
HAS2_XENLA      SGPLGMYRNSLLEFIEDWYNQSFGDDRHLTNRVLSLGYATKYTARSKCLTETPTEYLRWLNQQTRWSK--
DPM1_YEAST      ----------------------------------------------------------------------
CSBB_BACSU      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
G251B_XENLA     ----------------------------------------------------------------------
G251A_XENLA     ----------------------------------------------------------------------
DPM1_USTMA      ----------------------------------------------------------------------
TUAG_BACSU      ----------------------------------------------------------------------
HAS2_RAT        SGPLGMYRNSLLEFVEDWYNQSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSK--
GALT3_DROME     AGGLFAIDRKYFYEMGSYDSNMRGENVEMSFRIWQCGGRVEISPCS------------------------
ARNC_SODGM      ----------------------------------------------------------------------
Y028_MYCPN      ----------------------------------------------------------------------
GT251_DANRE     ----------------------------------------------------------------------
DPM1_DICDI      TGSFRLYRKDVLEKLITQNSKGYVFQVEMMVRANQLGYQVGEVP--------------------------
ARNC_SHESH      ----------------------------------------------------------------------
HAS3_CHICK      ---------------------SFGDDRHLTNRVLSLGYQTKYTPRSRCLTETPTRYLRWLNQQTRWSK--
HAS2_MOUSE      SGPLGMYRNSLLEFVEDWYNQSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSK--
HAS2_HUMAN      SGPLGMYRNSLLEFVEDWYNQSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSK--
HAS2_BOVIN      SGPLGMYRNSLLEFVEDWYNQSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSK--
GGAA_BACSU      ----------------------------------------------------------------------
Y1943_SYNY3     ----------------------------------------------------------------------
GLTL6_HUMAN     ----------------------------------------------------------------------
Y1222_METJA     ----------------------------------------------------------------------
NODC_BRASP      ----------------------------------------------------------------------
ALG5_YEAST      ----------------------------------------------------------------------
Y1676_METJA     ----------------------------------------------------------------------
CHS8_USTMA      PGSMFRIRENRVDTLHTKNLLHLGEDRYLTTLVLHFGYKTIFVRDCKAWTVAPDDWKVLLSQRRRWINST


                         .         *         .         .         .         .         +:350
query           QYVVLKFLAQFFKLKRKRIIXXXXXXXXXXXXXXXGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFL
YDAM_BACSU      QYVVLKFLAQFFKLKRKRIIXXXXXXXXXXXXXXXGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFL
ICAA_STAAR      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAAN      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAAM      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAAC      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAA8      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAAW      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAAS      HEVLLRDFFSTMKTKRFPLY----------------ILMFEQII----------------SILWVYIVLL
ICAA_STAEP      HEVLLRDFWSTIKTKK------------------------------------------------------
ICAA_STAEQ      HEVLLRDFWPTIKTKK------------------------------------------------------
PGAC_ECOLI      AEVFLKNMTRLWRKENFRM---------------------------------------------------
PGAC_ECO57      AEVFLKNMTRLWRKENFRM---------------------------------------------------
CSLAA_ARATH     ANLFRKMIMEIIRNKRVTI---------------------------------------------------
CSLA1_CYATE     ANLFKKMTKEIICCKR------------------------------------------------------
NODC_RHILV      ----------------------------------------------------------------------
CSLA9_ARATH     ----------------------------------------------------------------------
CSLA7_ARATH     ANLLRKMAGQIIR---------------------------------------------------------
CSLAB_ARATH     ANLFRKMTMEIIRNKRVTI---------------------------------------------------
CSLAB_ORYSJ     ANLFKKMMVEILENKK------------------------------------------------------
NODC_RHIME      ----------------------------------------------------------------------
CSLCC_ARATH     ----------------------------------------------------------------------
CSLA4_ORYSJ     ANLFRKMATEIAKNK-------------------------------------------------------
CSLAF_ARATH     ANLIRKMTMEIIHNKRVKI---------------------------------------------------
CSLA7_ORYSJ     ----------------------------------------------------------------------
CSLA5_ORYSJ     ANLFRKMI--------------------------------------------------------------
CSLC8_ARATH     ----------------------------------------------------------------------
CSLA6_ORYSJ     ALLFKKMFWEILAAKK------------------------------------------------------
CSLCA_ORYSJ     ----------------------------------------------------------------------
CSLCA_ORYSI     ----------------------------------------------------------------------
CSLC5_ARATH     ----------------------------------------------------------------------
CSLC7_ORYSJ     ----------------------------------------------------------------------
CSLA1_ARATH     ANLFRKMTMEIIFNKRVSI---------------------------------------------------
CSLA1_ORYSJ     ANLFRKMLMEIVRNKKVTI---------------------------------------------------
CSLC1_ORYSJ     ----------------------------------------------------------------------
CSLA2_ARATH     ANLFRKMVMEIVRNKKVR----------------------------------------------------
CSLC4_ARATH     ----------------------------------------------------------------------
CSLA9_ORYSJ     ANLFRKMLVEIATNKK------------------------------------------------------
NODC_RHISN      ----------------------------------------------------------------------
CSLA3_ARATH     ANLWRKMTMEILQNKK------------------------------------------------------
CSLC9_ORYSJ     MQLFRLCLPDIIKCK-------------------------------------------------------
CSLA3_ORYSJ     ----------------------------------------------------------------------
NODC_RHIS3      ----------------------------------------------------------------------
CSLA2_ORYSJ     ----------------------------------------------------------------------
BCSA_PSEFS      ----------------------------------------------------------------------
CSLC6_ARATH     MQL---FRLCFFDILRSKV---------------------------------------------------
BCSA_ECOLI      ----------------------------------------------------------------------
BCSA_SALTI      ----------------------------------------------------------------------
BCSA_ECO57      ----------------------------------------------------------------------
CSLC2_ORYSJ     MHL-------------------------------------------------------------------
CSLC2_ORYSI     MHL-------------------------------------------------------------------
BCSA_SALTY      ----------------------------------------------------------------------
NODC_RHILO      ----------------------------------------------------------------------
CSLC3_ORYSJ     MQLFRLCLPAVFKSK-------------------------------------------------------
CSLAE_ARATH     ANLFKKIAMEIIK---------------------------------------------------------
NODC_AZOC5      ----------------------------------------------------------------------
ACSA1_ACEXY     ----------------------------------------------------------------------
ACSA2_ACEXY     ----------------------------------------------------------------------
BCSA3_ACEXY     ----------------------------------------------------------------------
BCSA5_ACEXY     ----------------------------------------------------------------------
BCSA4_ACEXY     ----------------------------------------------------------------------
NODC_RHIGA      ----------------------------------------------------------------------
ARNC_WIGBR      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
BCSA2_ACEXY     ----------------------------------------------------------------------
BCSA1_ACEXY     ----------------------------------------------------------------------
ARNC_ERWCT      ----------------------------------------------------------------------
ARNC_PHOLL      ----------------------------------------------------------------------
NODC_BRAJA      ----------------------------------------------------------------------
ARNC_PROMH      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
HASA_STRPY      ----------------------------------------------------------------------
HASA_STRP8      ----------------------------------------------------------------------
HASA_STRP6      ----------------------------------------------------------------------
HASA_STRP3      ----------------------------------------------------------------------
HASA_STRP1      ----------------------------------------------------------------------
EPSH_BACSU      ----------------------------------------------------------------------
ARNC_EDWI9      ----------------------------------------------------------------------
HAS1_XENLA      ----------------------------------------------------------------------
ARNC_PSEU2      ----------------------------------------------------------------------
ARNC_PSEF5      ----------------------------------------------------------------------
ARNC_YERE8      ----------------------------------------------------------------------
ARNC_ECOLU      ----------------------------------------------------------------------
ARNC_PSEAE      ----------------------------------------------------------------------
ARNC_PSEAB      ----------------------------------------------------------------------
ARNC_PSEA8      ----------------------------------------------------------------------
ARNC_PSEA7      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
YTH1_RHOER      ----------------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
Y1578_HAEIN     ----------------------------------------------------------------------
BCSA_XANAC      ----------------------------------------------------------------------
ARNC_PSE14      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
ALG5_MOUSE      ----------------------------------------------------------------------
ALG5_HUMAN      ----------------------------------------------------------------------
ARNC_SHISS      ----------------------------------------------------------------------
ARNC_SHIFL      ----------------------------------------------------------------------
ARNC_SHIF8      ----------------------------------------------------------------------
ARNC_SHIDS      ----------------------------------------------------------------------
ARNC_SHIBS      ----------------------------------------------------------------------
ARNC_ECOSE      ----------------------------------------------------------------------
ARNC_ECOLI      ----------------------------------------------------------------------
ARNC_ECOLC      ----------------------------------------------------------------------
ARNC_ECOHS      ----------------------------------------------------------------------
ARNC_ECODH      ----------------------------------------------------------------------
ARNC_ECOBW      ----------------------------------------------------------------------
ARNC_ECO8A      ----------------------------------------------------------------------
ARNC_ECO55      ----------------------------------------------------------------------
ARNC_ECO24      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
GGAB_BACSU      ----------------------------------------------------------------------
ARNC_PSEPF      ----------------------------------------------------------------------
ARNC_ESCF3      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
ARNC_AERS4      ----------------------------------------------------------------------
ARNC_ENT38      ----------------------------------------------------------------------
YKCC_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
ARNC_YERPY      ----------------------------------------------------------------------
ARNC_YERPS      ----------------------------------------------------------------------
ARNC_YERPP      ----------------------------------------------------------------------
ARNC_YERPB      ----------------------------------------------------------------------
Y544_METJA      ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------
YAIP_ECOLI      ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
HAS1_MOUSE      ----------------------------------------------------------------------
HAS1_HUMAN      ----------------------------------------------------------------------
ARNC_ERWT9      ----------------------------------------------------------------------
ALG5_DICDI      ----------------------------------------------------------------------
CHS_ECOLX       ----------------------------------------------------------------------
GLTL5_MACFA     ----------------------------------------------------------------------
NODC_BRAEL      ----------------------------------------------------------------------
ALG5_SCHPO      ----------------------------------------------------------------------
GALT8_HUMAN     ----------------------------------------------------------------------
NODC_RHILT      ----------------------------------------------------------------------
HASS_XENLA      ----------------------------------------------------------------------
B3GNL_RAT       ----------------------------------------------------------------------
B3GNL_MOUSE     ----------------------------------------------------------------------
B3GNL_HUMAN     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
GTRB_BPP22      ----------------------------------------------------------------------
DPM1_SCHPO      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
GTRB_SHIFL      ----------------------------------------------------------------------
GTRB_BPSF5      ----------------------------------------------------------------------
GTRB_BPSF2      ----------------------------------------------------------------------
ARNC_SALCH      ----------------------------------------------------------------------
Y501_SYNY3      ----------------------------------------------------------------------
Y329_RICTY      ----------------------------------------------------------------------
GTRB_ECOLI      ----------------------------------------------------------------------
Y339_RICPR      ----------------------------------------------------------------------
GALT8_DROME     ----------------------------------------------------------------------
ARNC_SALTY      ----------------------------------------------------------------------
ARNC_SALTI      ----------------------------------------------------------------------
ARNC_SALSV      ----------------------------------------------------------------------
ARNC_SALPK      ----------------------------------------------------------------------
ARNC_SALPC      ----------------------------------------------------------------------
ARNC_SALPB      ----------------------------------------------------------------------
ARNC_SALPA      ----------------------------------------------------------------------
ARNC_SALNS      ----------------------------------------------------------------------
ARNC_SALHS      ----------------------------------------------------------------------
ARNC_SALG2      ----------------------------------------------------------------------
ARNC_SALEP      ----------------------------------------------------------------------
ARNC_SALDC      ----------------------------------------------------------------------
ARNC_SALA4      ----------------------------------------------------------------------
GTRB_BPSFX      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
HAS2_XENLA      ----------------------------------------------------------------------
DPM1_YEAST      ----------------------------------------------------------------------
CSBB_BACSU      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
G251B_XENLA     ----------------------------------------------------------------------
G251A_XENLA     ----------------------------------------------------------------------
DPM1_USTMA      ----------------------------------------------------------------------
TUAG_BACSU      ----------------------------------------------------------------------
HAS2_RAT        ----------------------------------------------------------------------
GALT3_DROME     ----------------------------------------------------------------------
ARNC_SODGM      ----------------------------------------------------------------------
Y028_MYCPN      ----------------------------------------------------------------------
GT251_DANRE     ----------------------------------------------------------------------
DPM1_DICDI      ----------------------------------------------------------------------
ARNC_SHESH      ----------------------------------------------------------------------
HAS3_CHICK      ----------------------------------------------------------------------
HAS2_MOUSE      ----------------------------------------------------------------------
HAS2_HUMAN      ----------------------------------------------------------------------
HAS2_BOVIN      ----------------------------------------------------------------------
GGAA_BACSU      ----------------------------------------------------------------------
Y1943_SYNY3     ----------------------------------------------------------------------
GLTL6_HUMAN     ----------------------------------------------------------------------
Y1222_METJA     ----------------------------------------------------------------------
NODC_BRASP      ----------------------------------------------------------------------
ALG5_YEAST      ----------------------------------------------------------------------
Y1676_METJA     ----------------------------------------------------------------------
CHS8_USTMA      VHNLVELI--------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG
YDAM_BACSU      FMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG
ICAA_STAAR      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAAN      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAAM      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAAC      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAA8      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAAW      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAAS      YLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEKKNMAVSWYPT---------
ICAA_STAEP      ----------------------------------------------------------------------
ICAA_STAEQ      ----------------------------------------------------------------------
PGAC_ECOLI      ----------------------------------------------------------------------
PGAC_ECO57      ----------------------------------------------------------------------
CSLAA_ARATH     ----------------------------------------------------------------------
CSLA1_CYATE     ----------------------------------------------------------------------
NODC_RHILV      ----------------------------------------------------------------------
CSLA9_ARATH     ----------------------------------------------------------------------
CSLA7_ARATH     ----------------------------------------------------------------------
CSLAB_ARATH     ----------------------------------------------------------------------
CSLAB_ORYSJ     ----------------------------------------------------------------------
NODC_RHIME      ----------------------------------------------------------------------
CSLCC_ARATH     ----------------------------------------------------------------------
CSLA4_ORYSJ     ----------------------------------------------------------------------
CSLAF_ARATH     ----------------------------------------------------------------------
CSLA7_ORYSJ     ----------------------------------------------------------------------
CSLA5_ORYSJ     ----------------------------------------------------------------------
CSLC8_ARATH     ----------------------------------------------------------------------
CSLA6_ORYSJ     ----------------------------------------------------------------------
CSLCA_ORYSJ     ----------------------------------------------------------------------
CSLCA_ORYSI     ----------------------------------------------------------------------
CSLC5_ARATH     ----------------------------------------------------------------------
CSLC7_ORYSJ     ----------------------------------------------------------------------
CSLA1_ARATH     ----------------------------------------------------------------------
CSLA1_ORYSJ     ----------------------------------------------------------------------
CSLC1_ORYSJ     ----------------------------------------------------------------------
CSLA2_ARATH     ----------------------------------------------------------------------
CSLC4_ARATH     ----------------------------------------------------------------------
CSLA9_ORYSJ     ----------------------------------------------------------------------
NODC_RHISN      ----------------------------------------------------------------------
CSLA3_ARATH     ----------------------------------------------------------------------
CSLC9_ORYSJ     ----------------------------------------------------------------------
CSLA3_ORYSJ     ----------------------------------------------------------------------
NODC_RHIS3      ----------------------------------------------------------------------
CSLA2_ORYSJ     ----------------------------------------------------------------------
BCSA_PSEFS      ----------------------------------------------------------------------
CSLC6_ARATH     ----------------------------------------------------------------------
BCSA_ECOLI      ----------------------------------------------------------------------
BCSA_SALTI      ----------------------------------------------------------------------
BCSA_ECO57      ----------------------------------------------------------------------
CSLC2_ORYSJ     ----------------------------------------------------------------------
CSLC2_ORYSI     ----------------------------------------------------------------------
BCSA_SALTY      ----------------------------------------------------------------------
NODC_RHILO      ----------------------------------------------------------------------
CSLC3_ORYSJ     ----------------------------------------------------------------------
CSLAE_ARATH     ----------------------------------------------------------------------
NODC_AZOC5      ----------------------------------------------------------------------
ACSA1_ACEXY     ----------------------------------------------------------------------
ACSA2_ACEXY     ----------------------------------------------------------------------
BCSA3_ACEXY     ----------------------------------------------------------------------
BCSA5_ACEXY     ----------------------------------------------------------------------
BCSA4_ACEXY     ----------------------------------------------------------------------
NODC_RHIGA      ----------------------------------------------------------------------
ARNC_WIGBR      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
BCSA2_ACEXY     ----------------------------------------------------------------------
BCSA1_ACEXY     ----------------------------------------------------------------------
ARNC_ERWCT      ----------------------------------------------------------------------
ARNC_PHOLL      ----------------------------------------------------------------------
NODC_BRAJA      ----------------------------------------------------------------------
ARNC_PROMH      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
HASA_STRPY      ----------------------------------------------------------------------
HASA_STRP8      ----------------------------------------------------------------------
HASA_STRP6      ----------------------------------------------------------------------
HASA_STRP3      ----------------------------------------------------------------------
HASA_STRP1      ----------------------------------------------------------------------
EPSH_BACSU      ----------------------------------------------------------------------
ARNC_EDWI9      ----------------------------------------------------------------------
HAS1_XENLA      ----------------------------------------------------------------------
ARNC_PSEU2      ----------------------------------------------------------------------
ARNC_PSEF5      ----------------------------------------------------------------------
ARNC_YERE8      ----------------------------------------------------------------------
ARNC_ECOLU      ----------------------------------------------------------------------
ARNC_PSEAE      ----------------------------------------------------------------------
ARNC_PSEAB      ----------------------------------------------------------------------
ARNC_PSEA8      ----------------------------------------------------------------------
ARNC_PSEA7      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
YTH1_RHOER      ----------------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
Y1578_HAEIN     ----------------------------------------------------------------------
BCSA_XANAC      ----------------------------------------------------------------------
ARNC_PSE14      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
ALG5_MOUSE      ----------------------------------------------------------------------
ALG5_HUMAN      ----------------------------------------------------------------------
ARNC_SHISS      ----------------------------------------------------------------------
ARNC_SHIFL      ----------------------------------------------------------------------
ARNC_SHIF8      ----------------------------------------------------------------------
ARNC_SHIDS      ----------------------------------------------------------------------
ARNC_SHIBS      ----------------------------------------------------------------------
ARNC_ECOSE      ----------------------------------------------------------------------
ARNC_ECOLI      ----------------------------------------------------------------------
ARNC_ECOLC      ----------------------------------------------------------------------
ARNC_ECOHS      ----------------------------------------------------------------------
ARNC_ECODH      ----------------------------------------------------------------------
ARNC_ECOBW      ----------------------------------------------------------------------
ARNC_ECO8A      ----------------------------------------------------------------------
ARNC_ECO55      ----------------------------------------------------------------------
ARNC_ECO24      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
GGAB_BACSU      ----------------------------------------------------------------------
ARNC_PSEPF      ----------------------------------------------------------------------
ARNC_ESCF3      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
ARNC_AERS4      ----------------------------------------------------------------------
ARNC_ENT38      ----------------------------------------------------------------------
YKCC_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
ARNC_YERPY      ----------------------------------------------------------------------
ARNC_YERPS      ----------------------------------------------------------------------
ARNC_YERPP      ----------------------------------------------------------------------
ARNC_YERPB      ----------------------------------------------------------------------
Y544_METJA      ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------
YAIP_ECOLI      ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
HAS1_MOUSE      ----------------------------------------------------------------------
HAS1_HUMAN      ----------------------------------------------------------------------
ARNC_ERWT9      ----------------------------------------------------------------------
ALG5_DICDI      ----------------------------------------------------------------------
CHS_ECOLX       ----------------------------------------------------------------------
GLTL5_MACFA     ----------------------------------------------------------------------
NODC_BRAEL      ----------------------------------------------------------------------
ALG5_SCHPO      ----------------------------------------------------------------------
GALT8_HUMAN     ----------------------------------------------------------------------
NODC_RHILT      ----------------------------------------------------------------------
HASS_XENLA      ----------------------------------------------------------------------
B3GNL_RAT       ----------------------------------------------------------------------
B3GNL_MOUSE     ----------------------------------------------------------------------
B3GNL_HUMAN     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
GTRB_BPP22      ----------------------------------------------------------------------
DPM1_SCHPO      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
GTRB_SHIFL      ----------------------------------------------------------------------
GTRB_BPSF5      ----------------------------------------------------------------------
GTRB_BPSF2      ----------------------------------------------------------------------
ARNC_SALCH      ----------------------------------------------------------------------
Y501_SYNY3      ----------------------------------------------------------------------
Y329_RICTY      ----------------------------------------------------------------------
GTRB_ECOLI      ----------------------------------------------------------------------
Y339_RICPR      ----------------------------------------------------------------------
GALT8_DROME     ----------------------------------------------------------------------
ARNC_SALTY      ----------------------------------------------------------------------
ARNC_SALTI      ----------------------------------------------------------------------
ARNC_SALSV      ----------------------------------------------------------------------
ARNC_SALPK      ----------------------------------------------------------------------
ARNC_SALPC      ----------------------------------------------------------------------
ARNC_SALPB      ----------------------------------------------------------------------
ARNC_SALPA      ----------------------------------------------------------------------
ARNC_SALNS      ----------------------------------------------------------------------
ARNC_SALHS      ----------------------------------------------------------------------
ARNC_SALG2      ----------------------------------------------------------------------
ARNC_SALEP      ----------------------------------------------------------------------
ARNC_SALDC      ----------------------------------------------------------------------
ARNC_SALA4      ----------------------------------------------------------------------
GTRB_BPSFX      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
HAS2_XENLA      ----------------------------------------------------------------------
DPM1_YEAST      ----------------------------------------------------------------------
CSBB_BACSU      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
G251B_XENLA     ----------------------------------------------------------------------
G251A_XENLA     ----------------------------------------------------------------------
DPM1_USTMA      ----------------------------------------------------------------------
TUAG_BACSU      ----------------------------------------------------------------------
HAS2_RAT        ----------------------------------------------------------------------
GALT3_DROME     ----------------------------------------------------------------------
ARNC_SODGM      ----------------------------------------------------------------------
Y028_MYCPN      ----------------------------------------------------------------------
GT251_DANRE     ----------------------------------------------------------------------
DPM1_DICDI      ----------------------------------------------------------------------
ARNC_SHESH      ----------------------------------------------------------------------
HAS3_CHICK      ----------------------------------------------------------------------
HAS2_MOUSE      ----------------------------------------------------------------------
HAS2_HUMAN      ----------------------------------------------------------------------
HAS2_BOVIN      ----------------------------------------------------------------------
GGAA_BACSU      ----------------------------------------------------------------------
Y1943_SYNY3     ----------------------------------------------------------------------
GLTL6_HUMAN     ----------------------------------------------------------------------
Y1222_METJA     ----------------------------------------------------------------------
NODC_BRASP      ----------------------------------------------------------------------
ALG5_YEAST      ----------------------------------------------------------------------
Y1676_METJA     ----------------------------------------------------------------------
CHS8_USTMA      ----------------------------------------------------------------------