[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB12450.2

[Show Plain Result]


## Summary of Sequence Search
    1::469
    1::469       0.0 100%  469 aa  GABP_BACSU RecName: Full=GABA permease;AltName: Full=4-amino
   14::454     e-105  45%  466 aa  GABP_ECOLI RecName: Full=GABA permease;AltName: Full=4-amino
    1::442     8e-89  36%  463 aa  YTNA_BACSU RecName: Full=Uncharacterized amino acid permease ytnA;
    6::468     2e-86  37%  475 aa  HUTM_BACSU RecName: Full=Putative histidine permease;
    6::464     6e-83  36%  470 aa  YBGF_BACSU RecName: Full=Uncharacterized amino acid permease ybgF;
    1::447     2e-81  41%  463 aa  AROP_CORGL RecName: Full=Aromatic amino acid transport protein
    1::470     7e-80  34%  470 aa  ROCC_BACSU RecName: Full=Amino-acid permease rocC;
    6::459     3e-76  36%  462 aa  YBXG_BACSU RecName: Full=Uncharacterized transporter ybxG;
   12::398     3e-76  39%  489 aa  LYSP_ECOLI RecName: Full=Lysine-specific permease;
    5::433     5e-74  36%  467 aa  MMUP_ECOLI RecName: Full=Probable S-methylmethionine permease;
   19::487     1e-72  33%  499 aa  ANSP_ECOLI RecName: Full=L-asparagine permease;AltName:
    1::448     6e-71  35%  461 aa  YIFK_ECOLI RecName: Full=Probable transport protein yifK;
   19::482     6e-70  33%  497 aa  ANSP_SALTY RecName: Full=L-asparagine permease;AltName:
   15::467     3e-69  34%  470 aa  CYCA_ECOLI RecName: Full=D-serine/D-alanine/glycine transporter;
   15::467     3e-69  34%  470 aa  CYCA_ECO57 RecName: Full=D-serine/D-alanine/glycine transporter;
   11::450     8e-68  33%  487 aa  ANSP2_MYCTU RecName: Full=L-asparagine permease 2;AltName:
   11::450     8e-68  33%  487 aa  ANSP2_MYCBO RecName: Full=L-asparagine permease 2;AltName:
    1::448     2e-67  33%  461 aa  YIFK_SALTY RecName: Full=Probable transport protein yifK;
    1::448     2e-67  33%  461 aa  YIFK_SALTI RecName: Full=Probable transport protein yifK;
   10::455     5e-67  31%  456 aa  AROP_ECOL6 RecName: Full=Aromatic amino acid transport protein
   11::456     6e-67  31%  457 aa  AROP_SHIFL RecName: Full=Aromatic amino acid transport protein
   11::456     1e-66  31%  457 aa  AROP_ECOLI RecName: Full=Aromatic amino acid transport protein
    1::463     1e-66  32%  467 aa  ROCE_BACSU RecName: Full=Amino-acid permease rocE;
    2::456     3e-66  34%  457 aa  AROP_SALTY RecName: Full=Aromatic amino acid transport protein
    2::456     3e-66  34%  457 aa  AROP_SALTI RecName: Full=Aromatic amino acid transport protein
   11::456     5e-66  31%  457 aa  AROP_ECO57 RecName: Full=Aromatic amino acid transport protein
   14::418     5e-66  35%  489 aa  ANSP1_MYCTU RecName: Full=L-asparagine permease 1;AltName:
   14::418     3e-65  34%  489 aa  ANSP1_MYCBO RecName: Full=L-asparagine permease 1;AltName:
   49::458     4e-65  35%  458 aa  PHEP_ECOLI RecName: Full=Phenylalanine-specific permease;
   13::457     5e-65  34%  462 aa  AAPA_BACSU RecName: Full=Amino-acid permease aapA;
    2::456     2e-64  31%  456 aa  PROY_SALTY RecName: Full=Proline-specific permease proY;
    2::398     1e-63  33%  457 aa  PROY_ECOLI RecName: Full=Proline-specific permease proY;
    2::398     1e-63  33%  457 aa  PROY_ECOL6 RecName: Full=Proline-specific permease proY;
    2::398     1e-63  33%  457 aa  PROY_ECO57 RecName: Full=Proline-specific permease proY;
   28::489     2e-60  33%  489 aa  ANSP_STRCO RecName: Full=L-asparagine permease;AltName:
    9::456     8e-60  32%  458 aa  YDGF_BACSU RecName: Full=Uncharacterized transporter ydgF;
    1::441     7e-58  34%  447 aa  YVBW_BACSU RecName: Full=Uncharacterized amino acid permease yvbW;
  106::537     8e-54  31%  611 aa  LYP1_YEAST RecName: Full=Lysine-specific permease;
   84::515     5e-53  30%  590 aa  CAN1_YEAST RecName: Full=Arginine permease;
   53::483     3e-51  30%  571 aa  CAN1_CANAL RecName: Full=Lysine/arginine permease;AltName:
   58::472     1e-50  31%  574 aa  MEU22_SCHPO RecName: Full=Probable amino-acid permease
   61::498     2e-50  28%  573 aa  ALP1_YEAST RecName: Full=Basic amino-acid permease;
   76::457     3e-46  34%  592 aa  TAT2_YEAST RecName: Full=Tryptophan permease;AltName:
   80::468     2e-44  31%  583 aa  YI26_SCHPO RecName: Full=Uncharacterized amino-acid permease
   36::438     2e-43  29%  537 aa  YCUB_SCHPO RecName: Full=Uncharacterized amino-acid permease
   46::460     2e-43  27%  558 aa  AGP3_YEAST RecName: Full=General amino acid permease AGP3;
   42::463     1e-40  26%  521 aa  YCV4_SCHPO RecName: Full=Uncharacterized amino-acid permease
   71::464     4e-40  30%  580 aa  YI0B_SCHPO RecName: Full=Uncharacterized amino-acid permease
   79::465     2e-39  32%  580 aa  ISP5_SCHPO RecName: Full=Sexual differentiation process putative
   87::484     7e-39  27%  609 aa  BAP2_YEAST RecName: Full=Leu/Val/Ile amino-acid permease;AltName:
   70::501     1e-38  30%  585 aa  YHE1_SCHPO RecName: Full=Uncharacterized amino-acid permease
  106::545     2e-38  27%  627 aa  PUT4_YEAST RecName: Full=Proline-specific permease;
  101::450     7e-37  30%  573 aa  INDA1_TRIAT RecName: Full=Amino-acid permease inda1;
   47::491     9e-37  29%  505 aa  YQD2_SCHPO RecName: Full=Probable amino-acid permease PB1C11.02;
  149::538     3e-36  31%  663 aa  GNP1_YEAST RecName: Full=High-affinity glutamine permease;
  116::509     3e-36  28%  633 aa  AGP1_SACBA RecName: Full=General amino acid permease AGP1;AltName:
   39::441     5e-36  27%  552 aa  PUT4_SCHPO RecName: Full=Probable proline-specific permease put4;
   82::479     1e-35  25%  603 aa  HIP1_YEAST RecName: Full=Histidine permease;
   32::492     4e-35  27%  550 aa  PUTX_EMENI RecName: Full=Proline-specific permease;AltName:
   82::478     7e-35  26%  602 aa  GAP1_YEAST RecName: Full=General amino-acid permease GAP1;
   73::464     3e-34  28%  579 aa  YH83_SCHPO RecName: Full=Uncharacterized amino-acid permease
   73::464     7e-34  26%  581 aa  YH81_SCHPO RecName: Full=Uncharacterized amino-acid permease
   84::479     5e-33  27%  619 aa  VAL1_YEAST RecName: Full=Valine/tyrosine/tryptophan amino-acid
   85::522     1e-31  22%  596 aa  AGP2_YEAST RecName: Full=General amino acid permease AGP2;
  116::509     3e-31  26%  633 aa  AGP1_YEAST RecName: Full=General amino acid permease AGP1;AltName:
  116::509     3e-31  27%  633 aa  AGP1_YEAS7 RecName: Full=General amino acid permease AGP1;AltName:
   10::446     1e-30  22%  446 aa  YCGH_BACSU RecName: Full=Uncharacterized transporter ycgH;
   82::472     8e-30  29%  608 aa  DIP5_YEAST RecName: Full=Dicarboxylic amino acid permease;
   81::479     9e-29  29%  604 aa  BAP3_YEAST RecName: Full=Valine amino-acid permease;AltName:
   69::486     2e-28  23%  594 aa  AAP1_SCHPO RecName: Full=Amino-acid permease 1;
  104::463     7e-26  23%  587 aa  SAM3_YEAST RecName: Full=S-adenosylmethionine permease
  100::459     7e-18  21%  583 aa  MMP1_YEAST RecName: Full=S-methylmethionine permease 1;
  277::770     1e-17  28%  852 aa  SSY1_YEAST RecName: Full=SPS-sensor component SSY1;AltName:
    1::379     8e-14  27%  539 aa  YBEC_BACSU RecName: Full=Probable amino acid-proton symporter ybeC;
    9::174     1e-13  28%  175 aa  YPEV_LACDL RecName: Full=Uncharacterized transporter in pepV
   40::402     3e-12  24%  486 aa  AAXC_CHLAB RecName: Full=Arginine/agmatine antiporter;
  215::430     9e-10  29%  511 aa  GADC_SHIFL RecName: Full=Probable glutamate/gamma-aminobutyrate
  215::430     9e-10  29%  511 aa  GADC_ECOLI RecName: Full=Probable glutamate/gamma-aminobutyrate
  215::430     9e-10  29%  511 aa  GADC_ECOL6 RecName: Full=Probable glutamate/gamma-aminobutyrate
  215::430     9e-10  29%  511 aa  GADC_ECO57 RecName: Full=Probable glutamate/gamma-aminobutyrate
   34::433     1e-08  25%  658 aa  CTR2_HUMAN RecName: Full=Low affinity cationic amino acid
   13::370     2e-08  20%  444 aa  ADIC_YERPE RecName: Full=Arginine/agmatine antiporter;
  236::459     3e-08  24%  465 aa  YHDG_BACSU RecName: Full=Uncharacterized amino acid permease yhdG;
  191::431     3e-08  28%  622 aa  CTR1_MOUSE RecName: Full=High affinity cationic amino acid
   18::448     7e-08  23%  461 aa  PUUP_ECOLI RecName: Full=Putrescine importer;
   40::363     2e-07  21%  469 aa  ARCD_BACSU RecName: Full=Putative arginine/ornithine antiporter;
   26::116     2e-07  31%  654 aa  CTR2_CHICK RecName: Full=Low affinity cationic amino acid
   21::115     3e-07  25%  618 aa  CTR3_MOUSE RecName: Full=Cationic amino acid transporter 3;        
   28::117     3e-07  26%  657 aa  CTR2_PIG RecName: Full=Low affinity cationic amino acid transporter
   25::115     3e-07  31%  640 aa  CTR2_DANRE RecName: Full=Low affinity cationic amino acid
  246::433     6e-07  24%  622 aa  CTR2_XENLA RecName: Full=Low affinity cationic amino acid
   39::98      8e-07  31%  485 aa  AAXC_CHLPN RecName: Full=Arginine/agmatine antiporter;
  191::433     1e-06  25%  624 aa  CTR1_RAT RecName: Full=High affinity cationic amino acid
   21::115     1e-06  25%  619 aa  CTR3_RAT RecName: Full=Cationic amino acid transporter 3;       
   28::432     1e-06  25%  657 aa  CTR2_RAT RecName: Full=Low affinity cationic amino acid transporter
   12::376     1e-06  28%  483 aa  AAXC_CHLTB RecName: Full=Arginine/agmatine antiporter;
   12::376     1e-06  28%  483 aa  AAXC_CHLT2 RecName: Full=Arginine/agmatine antiporter;
  203::419     2e-06  21%  435 aa  POTE_HAEIN RecName: Full=Putrescine-ornithine antiporter;AltName:
   28::117     2e-06  30%  657 aa  CTR2_MOUSE RecName: Full=Low affinity cationic amino acid
    6::437     3e-06  21%  445 aa  FRLA_ECOLI RecName: Full=Putative fructoselysine transporter frlA;
   15::363     3e-06  20%  445 aa  ADIC_SHIFL RecName: Full=Arginine/agmatine antiporter;
   15::363     3e-06  20%  445 aa  ADIC_ECOLI RecName: Full=Arginine/agmatine antiporter;
   15::363     3e-06  20%  445 aa  ADIC_ECOL6 RecName: Full=Arginine/agmatine antiporter;
   15::363     3e-06  20%  445 aa  ADIC_ECO57 RecName: Full=Arginine/agmatine antiporter;
   19::95      4e-06  31%  481 aa  Y2001_MYCBO RecName: Full=Uncharacterized transporter Mb2001c;
   19::95      4e-06  31%  481 aa  Y1979_MYCTU RecName: Full=Uncharacterized transporter
  207::382     5e-06  22%  464 aa  Y1691_LEGPH RecName: Full=Uncharacterized transporter lpg1691;
    6::437     5e-06  21%  445 aa  FRLA_ECO57 RecName: Full=Putative fructoselysine transporter frlA;
  191::438     5e-06  24%  629 aa  CTR1_HUMAN RecName: Full=High affinity cationic amino acid
   15::363     8e-06  19%  445 aa  ADIC_SALTY RecName: Full=Arginine/agmatine antiporter;
   15::363     8e-06  19%  445 aa  ADIC_SALTI RecName: Full=Arginine/agmatine antiporter;
   36::99      8e-06  32%  483 aa  AAXC_CHLTR RecName: Full=Arginine/agmatine antiporter;
   36::99      8e-06  32%  483 aa  AAXC_CHLTA RecName: Full=Arginine/agmatine antiporter;
    1::97      1e-05  26%  438 aa  STET_BACSU RecName: Full=Serine/threonine exchanger steT;
   15::92      2e-05  23%  424 aa  YECA_BACSU RecName: Full=Uncharacterized amino acid permease
  279::460     2e-05  31%  535 aa  LAT2_PONAB RecName: Full=Large neutral amino acids transporter
  279::460     2e-05  31%  535 aa  LAT2_HUMAN RecName: Full=Large neutral amino acids transporter
   18::107     4e-05  30%  501 aa  LYSI_CORGL RecName: Full=L-lysine transport protein;AltName:
   24::429     4e-05  25%  619 aa  CTR3_HUMAN RecName: Full=Cationic amino acid transporter 3;        
   30::121     5e-05  30%  511 aa  YLAT1_HUMAN RecName: Full=Y+L amino acid transporter 1;AltName:
   57::454     5e-05  21%  486 aa  AAXC_CHLCV RecName: Full=Arginine/agmatine antiporter;
  290::449     7e-05  23%  481 aa  Y389_CLOPE RecName: Full=Putative amino-acid transporter CPE0389;
  290::449     7e-05  23%  481 aa  Y377_CLOP1 RecName: Full=Putative amino-acid transporter CPF_0377;
   41::130     2e-04  26%  515 aa  YLAT2_HUMAN RecName: Full=Y+L amino acid transporter 2;AltName:
   24::114     2e-04  27%  487 aa  BAT1_MOUSE RecName: Full=B(0,+)-type amino acid transporter 1;     
  218::357     2e-04  29%  483 aa  AAXC_CHLMU RecName: Full=Arginine/agmatine antiporter;
   36::124     2e-04  28%  510 aa  YLAT2_XENLA RecName: Full=Y+L amino acid transporter 2;AltName:
   33::124     2e-04  28%  512 aa  YLAT1_RAT RecName: Full=Y+L amino acid transporter 1;AltName:
   31::122     2e-04  28%  510 aa  YLAT1_MOUSE RecName: Full=Y+L amino acid transporter 1;AltName:
   24::114     2e-04  27%  487 aa  BAT1_RAT RecName: Full=B(0,+)-type amino acid transporter 1;       
    1::92      2e-04  22%  460 aa  ARCD_SHIFL RecName: Full=Putative arginine/ornithine antiporter;
    1::92      2e-04  22%  460 aa  ARCD_ECOLI RecName: Full=Putative arginine/ornithine antiporter;
    1::92      2e-04  22%  460 aa  ARCD_ECOL6 RecName: Full=Putative arginine/ornithine antiporter;
   57::99      3e-04  44%  486 aa  AAXC_CHLFF RecName: Full=Arginine/agmatine antiporter;
  202::361     8e-04  26%  435 aa  Y609_METJA RecName: Full=Uncharacterized protein MJ0609;
 1515::1570    8e-04  34% 1762 aa  POLG_FCVC6 RecName: Full=Genome polyprotein;Contains:  RecName:
    1::469

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNQSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRMLGEMSAVN
GABP_BACSU      MNQSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRMLGEMSAVN
GABP_ECOLI      -----------LKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVMIMRMLAEMAVAT
YTNA_BACSU      MQKQKQELHRGLEERHISLMSLGAAIGVGLFLGSASAIQLAGPGILVAYAASGLVMFFIMRALGEMAIQK
HUTM_BACSU      -NSSQQ-LKRTMKSRHLFMISLGGVIGTGLFLSTGYTLHQAGPGGILAYVIGGLMMYLVMQCLGELSVAM
YBGF_BACSU      -NKNETTFQRSMKSRHLFMLSLGGVIGTGLFLSSGYTIQQAGPGTILAYLVGAGIVYLVMLCLGELSVAM
AROP_CORGL      MAKSNEGLGTGLRTRHLTMMGLGSAIGAGLFLGTGVGIRAAGPAVLLAYIIAGAIVVLVMQMLGEMAAAR
ROCC_BACSU      MQNHKNELQRSMKSRHLFMIALGGVIGTGLFLGSGFTISQAGPGAIAAYIIGGFLMYLVMLCLGELAVAM
YBXG_BACSU      -------LKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLLAYAICGIFIFFIMRAMGEMLYVE
LYSP_ECOLI      ------GLRRELKARHLTMIAIGGSIGTGLFVASGATISQAGPGALLSYMLIGLMVYFLMTSLGELAAYM
MMUP_ECOLI      --QQNAPLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAGTLLAYLIGALVVWLVMQCLGELSVAM
ANSP_ECOLI      LNAHEEGYHKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGLFSFFILRALGELVLHR
YIFK_ECOLI      MADNKPELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIMRSMGEMLFLE
ANSP_SALTY      LNAHEEGYHKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGIFSFFILRALGELVLHR
CYCA_ECOLI      ---AEQSLRRNLTNRHIQLXXXXXXXXTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSN
CYCA_ECO57      ---AEQSLRRNLTNRHIQLXXXXXXXXTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSN
ANSP2_MYCTU     LTREDTGYHKGLHSRQLQMIALGGAIGTGLFLGAGGRLASAGPGLFLVYGICGIFVFLILRALGELVLHR
ANSP2_MYCBO     LTREDTGYHKGLHSRQLQMIALGGAIGTGLFLGAGGRLASAGPGLFLVYGICGIFVFLILRALGELVLHR
YIFK_SALTY      MAEKKPELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIMRSMGEMLFLE
YIFK_SALTI      MAEKKPELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIMRSMGEMLFLE
AROP_ECOL6      -------LKRGLKNRHIQXXXXXXXXXXXXXXXSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVVEE
AROP_SHIFL      -------LKRGLKNRHIQXXXXXXXXXXXXXXXSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVVEE
AROP_ECOLI      -------LKRGLKNRHIQXXXXXXXXXXXXXXXSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVVEE
ROCE_BACSU      MNTNQDNLQRTMKSRHLFMISXXXXXXXXXXXXXXXXXNQAGPGAVLSYLVGGFIMFLTMLCLGELAVAF
AROP_SALTY      MDSQQHGLKRGLKNRHIQXXXXXXXXXXXXXXXSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVVEE
AROP_SALTI      MDSQQHGLKRGLKNRHIQXXXXXXXXXXXXXXXSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVVEE
AROP_ECO57      -------LKRGLKNRHIQXXXXXXXXXXXXXXXSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMVVEE
ANSP1_MYCTU     ----EAGYHKGLKPRQLQMIGIGGAIGTGLFLGAGGRLAKAGPGLFLVYGVCGVFVFLILRALGELVLHR
ANSP1_MYCBO     ----EAGYHKGLKPRQLQMIGIGGAIGTGLFLGASGRLAKAGPGLFLVYGVCGVFVFLILRALGELVLHR
PHEP_ECOLI      -------------------------------------IQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEE
AAPA_BACSU      ----QQKLSRGLKNRHIQLMAIGGAIGTGLFLGSGKSIHFAGPSILFAYLITGVFCFFIMRSLGELLLSN
PROY_SALTY      --ESNNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLXXXXXXXXXXXXMRALGEMSVHN
PROY_ECOLI      --ESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLXXXXXXXXXXXXMRALGEMSVHN
PROY_ECOL6      --ESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLXXXXXXXXXXXXMRALGEMSVHN
PROY_ECO57      --ESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLXXXXXXXXXXXXMRALGEMSVHN
ANSP_STRCO      -----AGYSKDLKARHVNMIAIGGAIGTGLFLGAGGRLRDAGPALAIAYLXXXXXXXXXXXXLGELVLYR
YDGF_BACSU      -NINQQTLQRGLKNRHIQXXXXXXXXXXXXXXXXXKSIHFAGPSILFAYMITGIICFLIMRSLGELLLSN
YVBW_BACSU      MKNDNQTLKRTMTSRHXXXXXXXXXXXXXXFKGSSSAIDVAGPSVXXXXXXXXXXXXXXXXXXAEMAVRN
LYP1_YEAST      -------VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPGSLIAYIFMGTIVYFVTQSLGEMATFI
CAN1_YEAST      -------VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPGALISYLFMGSLAYSVTQSLGEMATFI
CAN1_CANAL      INDEFGEVKRDLKARHVSMIAIGGTIGTGLFISTGSLLHTTGPMSLISFLFVTTICFSVTQSLGEMATYI
MEU22_SCHPO     -------LQRKLKPRHMQMIAIGGCVGTGLFVGSGNALADGGPASIIAFAVIGTYVLFTTSALAELSAIY
ALP1_YEAST      --QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPGALISYLFMGTVIYSVTQSLGEMVTFI
TAT2_YEAST      -----SNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPGVVIGWAIAGSQIIGTIHGLGEITVRF
YI26_SCHPO      -------LKRHLKGRHMQMIAIGGAIGTGLFVGSGSSLADGGPASVIDYTLIGIMMFFTVYALGELAVSY
YCUB_SCHPO      ---NSNGIKRGLKTRHVSMMALAGIIGPGVFIGMGSALHIGGPGLIVGFAIVSIVVFGVMLSIGEFNSL-
AGP3_YEAST      ----QTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLGFSIIGIIAFSVMESIGEMITLY
YCV4_SCHPO      -------LKREFKSRHVNMISVAGAIGTGLVIGSGSALLKGGPGSLIAYLMTGINLYVVLISLGEMAAXX
YI0B_SCHPO      -----TALKRSLKSRHMQMISIGGAIGTGLYVGSGSSLADGGPASVINYSLIGIMMFFIVYALGEMAVAY
ISP5_SCHPO      -------LKRTLTARHIQMIGIGGAIGTGVWVGSKNTLREGGAASVICYSLVGSMVLMTVYSLGELAVAF
BAP2_YEAST      ---SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAAIIGYILVSFETYFMIQAAGEMAVTY
YHE1_SCHPO      -NQQDSGLKRRLKSRHIQMIGIGGAIGTGVWVGSSKSLYRGGAASVIDYCIVGTMVFCTVYALGELAVAF
PUT4_YEAST      -------LKQGLQSRHVQXXXXXXXXXXXXXXXXSSTLHTCGPGLFISYIIISAVIYPIMCALGEMVCFL
INDA1_TRIAT     ----------------------------------------------VDFLIIGIMMFNVVYALGELAIMY
YQD2_SCHPO      ----------------------------------------SGPASLISFSVLGVSVYCTMLALGEMSVYM
GNP1_YEAST      -----------IKPRHTVMMSXXXXXXXXXXXXNSKVLNNAGPGGIIGYAIMGSCVYCIIQACGELAVIS
AGP1_SACBA      -------LKKTIQPRHVLMIAXXXXXXXXXXXXXXXALVHAGPGLLIGYAIMGSILYCIIQACGEMALVS
PUT4_SCHPO      --------KRALKSRHVQLIAIGGCIGTGLFVGSGSALSESGPASLLSYVIMSFVIWTVMNALGEMCTYL
HIP1_YEAST      ---NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASVIDWVIISTCLFTVINSLGELSAAF
PUTX_EMENI      --EEHTATKRGLSSRQLQLLAIGGCIGTGLFVGTSTVLTQTGPAPLLSYIVMASIVWFVMNVLGEMTTYL
GAP1_YEAST      ---AQTPLKHHLKNRHLQMXXXXXXXXXXXXXXXXTALRTGGPASLIGWGSTGTMIYAMVMALGELAVIF
YH83_SCHPO      -------LKRGLSTRHMQLMSIGGAIGSGLYVGSGSALADGGPASVINYILIGIMMFFVIYALGEMAVAY
YH81_SCHPO      -------LKRKLTSRHMQMISVGGAIGSGLYVGSGSAFADGGPASVXXXXXXXXXXXFVIYALGELAIAY
VAL1_YEAST      -SQEKNNLTKSIKSRHLVMISXXXXXXXXXXXXXXQVLGTAGPGLVLGYGIASIMLYCIIQAAGELGLCY
AGP2_YEAST      --------RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLAFALWCVPILCITVSTAEMVCFF
AGP1_YEAST      -------LKKTIQPRHVLMIAXXXXXXXXXXXXXXXALVHAGPGLLIGYAIMGSILYCIIQACGEMALVS
AGP1_YEAS7      -------LKKTIQPRHVLMIAXXXXXXXXXXXXXXXALVHAGPGLLIGYAIMGSILYCIIQACGEMALVS
YCGH_BACSU      --------KGNLAWWQLSLIGVGCTIGTGFFLGSSIAIVKSGFSVLLSFLIAGIGTYFVFEQLAKLSAKQ
DIP5_YEAST      -------LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMIAYAFVGLLVFYTMACLGEMASYI
BAP3_YEAST      --KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSVIGYVMVSFVTYFMVQAAGEMGVTY
AAP1_SCHPO      -----------LKPRHLQMIAIGSCIGTGLFVSTGKSLKNAGPGSLINFXXXXXXXXXXXXXXGEMCCFL
SAM3_YEAST      ---------------------------------------ASGPAALIGFLLVGTSMFCVVQSAAELSCQF
MMP1_YEAST      ---------------------------------------ASGPASLIGFLLVGASMLCVVQCGAELSCQY
SSY1_YEAST      -------IQRKLKVRHIQMLSIGACFSVGLFLTSGKAFSIAGPXXXXXXXXXXXIILATMLSFTELSTLI
YBEC_BACSU      MNQ----LHRRMGTFSLMMVGLGSMIGSGWLFGAWRAAQIAGPAAIISWVIGMVVILFIALSYSELGSMF
YPEV_LACDL      --ENTDGTIRSLSNRHVQMXXXXXXXXXXXXXXXXXXXSATGPSVIFIYAIMGXXXXXXXRALGEMFYFD
AAXC_CHLAB      ---------------------------------------SAGVGAIIAWILTGVGMFFIANTFKILSLVR
GADC_SHIFL      ----------------------------------------------------------------------
GADC_ECOLI      ----------------------------------------------------------------------
GADC_ECOL6      ----------------------------------------------------------------------
GADC_ECO57      ----------------------------------------------------------------------
CTR2_HUMAN      -----------LSTMDLIALGVGSTLGAGVYVLAGEVAKASGPSIVVSFLIAALASVMAGLCYAEFGARV
ADIC_YERPE      ----------------VTLMVAGNIMGSGVFLLPANLA-STGGIAIWGWLVTIIGALALSMVYAKISSLD
YHDG_BACSU      ----------------------------------------------------------------------
CTR1_MOUSE      ----------------------------------------------------------------------
PUUP_ECOLI      -------LRKSLKLWQVVMMGLAYLTPMTVFDTFGIVSGISDGHVPASYLLALAGVLFTAISYGKLVRQF
ARCD_BACSU      -------------------------------------------GATSAWLLTGAGVLMIALVFGHLSTAG
CTR2_CHICK      ----EDSLCRCLSTLDLIALGVGSTLGAGVYVLAGEVAKSSGPSIVVSFLIAALASVMAGLCYAEFGARV
CTR3_MOUSE      LGMGETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDAGPSIVICFXXXXXXXXXXGLCYAEFGARV
CTR2_PIG        -----SKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVAKASGPSIVVSFLIAALASVMAGLCYAEFGARV
CTR2_DANRE      ----ESKLCRCLSTVDLIALGVGSTLGAGVYVLAGEVAKSSGPSIVVSFLIAALASVMAGLCYAEFGARV
CTR2_XENLA      ----------------------------------------------------------------------
AAXC_CHLPN      ---------------------------------------TAGAGAVISWILTGFGMFFIANTFRILSTIR
CTR1_RAT        ----------------------------------------------------------------------
CTR3_RAT        LGMGETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAEKAGPSIVICFXXXXXXXXXXGLCYAEFGARV
CTR2_RAT        -----SKLCRCLTTMDLIALGVGSTLGAGVYVLAGEVAKASGPSIVVSFLIAALASVMAGLCYAEFGARV
AAXC_CHLTB      -----------LGTLALTGIVISYMIGGGIFLPQNMXXXXXXXXVMLAWMLSGIGIFFIANTFKTLSIIR
AAXC_CHLT2      -----------LGTLALTGIVISYMIGGGIFLPQNMXXXXXXXXVMLAWMLSGIGIFFIANTFKTLSIIR
POTE_HAEIN      ----------------------------------------------------------------------
CTR2_MOUSE      -----SKLCRCLTTVDLIALGVGSTLGAGVYVLAGEVAKASGPSIVVSFLIAALASVMAGLCYAEFGARV
FRLA_ECOLI      -------LQRKLGFWAVLAIAVGTTVGSGIFVSVGEVAKAAGTPTVLAFVIGGLIVIPQMCVYAELSTAY
ADIC_SHIFL      ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
ADIC_ECOLI      ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
ADIC_ECOL6      ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
ADIC_ECO57      ----------------VTLMVSGNIMGSGVFLLPANLA-STGGIAIYGWLVTIIGALGLSMVYAKMSFLD
Y2001_MYCBO     ----------------VVMLGINSIIGAGIFLTPGEVIGLAGPFAPMAYVLAGIFAGVVAIVFATAARYV
Y1979_MYCTU     ----------------VVMLGINSIIGAGIFLTPGEVIGLAGPFAPMAYVLAGIFAGVVAIVFATAARYV
Y1691_LEGPH     ----------------------------------------------------------------------
FRLA_ECO57      -------LQRKLGFWAVLAIAVGTTVGSGIFVSVGEVAKAAGTPTVLAFVIGGLIVIPQMCVYAELSTAY
CTR1_HUMAN      ----------------------------------------------------------------------
ADIC_SALTY      ----------------VTLMVSGNIMGSGVFLLPANLA-ATGGIAIYGWLVTIIGALALSMVYAKMSSLD
ADIC_SALTI      ----------------VTLMVSGNIMGSGVFLLPANLA-ATGGIAIYGWLVTIIGALALSMVYAKMSSLD
AAXC_CHLTR      -----------------------------------NMVASASAGAVMAWMLSGIGIFFIANTFKTLSIIR
AAXC_CHLTA      -----------------------------------NMVASASAGAVMAWMLSGIGIFFIANTFKTLSIIR
STET_BACSU      MHTEDNGLKKEIGLLFALTLVIGTIIGSGVFMKPGAVLAYSGDSALFAWXXXXXXXXXXXXXXXEIGTQI
YECA_BACSU      -----------------TALTIGAVLGCGILILPSVTADTAGPASLFVWVFMSFLSFFLVGTLARLVKIA
LAT2_PONAB      ----------------------------------------------------------------------
LAT2_HUMAN      ----------------------------------------------------------------------
LYSI_CORGL      ---------RTVSIRTLIALIIGSTVGAGIFSIPQNIGSVAGPGAMIGWLIAGLSVAFVFHVLARRKP-H
CTR3_HUMAN      ---AETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDAGPSIVICFXXXXXXXXXXGLCYAEFGARV
YLAT1_HUMAN     ----QVKLKKEISLLNGVCLIVGNMIGSGIFVSKGVLIYSASFGSLVIWAVGGLFSVFGALCYAELGTTI
AAXC_CHLCV      -------------------------------------------------------MFFIANTFKILSLVR
Y389_CLOPE      ----------------------------------------------------------------------
Y377_CLOP1      ----------------------------------------------------------------------
YLAT2_HUMAN     -------LKKEISLLNGVSLVVGNMIGSGIFVSKGVLVHTASYGSLIVWAIGGLFSVVGALCYAELGTTI
BAT1_MOUSE      -----TSLQKEVGLLSGICIIVGTIIGSGIFISPKSVLESVGP-CLIIWAACGILATLGALCFAELGTMI
AAXC_CHLMU      ----------------------------------------------------------------------
YLAT2_XENLA     -------LKKEISLLNGVSLIVGNMIGSGIFVSKGVLIYSASYGSLILWALGGIFSVIGAPCYAELGTTI
YLAT1_RAT       ----QVKLKKEISLLNGVCLIVGNMIGSGIFVSKGVLMYSASFGSLVIWAVGGIFSVFGALCYAELGTTI
YLAT1_MOUSE     ----QVKLKKEISLLNGVCLIVGNMIGSGIFVSKGVLMYSASFGSLVIWAVGGIFSVFGALCYAELGTTI
BAT1_RAT        -----TSLQKEVGLLSGICIIVGTIIGSGIFISPKSVLESVGP-CLIIWAACGVLATLGALCFAELGTMI
ARCD_SHIFL      -------MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALIGWGITGAGILLLAFAMLILTRIR
ARCD_ECOLI      -------MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALIGWGITGAGILLLAFAMLILTRIR
ARCD_ECOL6      -------MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALIGWGITGAGILLLAFAMLILTRIR
AAXC_CHLFF      -------------------------------------------------------MFFIANTFKILSLVR
Y609_METJA      ----------------------------------------------------------------------
POLG_FCVC6      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PTSGSFSQYAHDAIGPWAGFTIGWLYWFFWXXXXXXXXXXXXXXXQYWFHDIPXXXXXXXXXXXXXXXNV
GABP_BACSU      PTSGSFSQYAHDAIGPWAGFTIGWLYWFFWXXXXXXXXXXXXXXXQYWFHDIPXXXXXXXXXXXXXXXNV
GABP_ECOLI      PDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAMILHSWVPGIPIWLFSLVITLALTGSNL
YTNA_BACSU      PVAGSFSRYARDYLGPLAGYLTGWNYWFLWVVTCMAEITAVGIYMGFWFPDVPNWIWALSALVIMTGVNF
HUTM_BACSU      PVTGSFQKYATTFIGPSTGFMVGIMYWINWVVTVGSEFTASGILMQRWFPDSSVWMWSAIFAALLFICNA
YBGF_BACSU      PVTGAFHTYAAKYIGPGTGFTVAWLYWLTWTVALGSEFTAAGLLMQRWFPHTSVWMWSAVFALFIFLLNA
AROP_CORGL      PASGSFSRYGEDAFGHWAGFSLGWLYWFMLIMVMGAEMTGAAAIMGAWF-GVEPWIPSXXXXXXXXXXXX
ROCC_BACSU      PVAGSFQAYATKFLGQSTGFMIGWLYWFSWANTVGLELTSAGILMQRWLPSVPIWIWCLVFGIVIFLINA
YBXG_BACSU      PSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMSEIIAVGSYTKYWFPDLPAWIPGIVAMVILGAANL
LYSP_ECOLI      PVSGSFATYGQNYVEEGFGFALGWNYWYNWAVTIAVDLVAAQLVMSWWFPDTPGWIWSALFLGVIFLLNY
MMUP_ECOLI      PETGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQYWFPQVPVWVWCVVFCAIIFGLNV
ANSP_ECOLI      PSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVDITAVALYMHYWFGGVPQWVFALAALTIVGTMNM
YIFK_ECOLI      PVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFPEMAQWIPXXXXXXXXXXXXX
ANSP_SALTY      PSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVDITAVALYMHYWFGDVPQWVFALGALTIVGTMNM
CYCA_ECOLI      LEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWXXXXXXXXXXXXXXX
CYCA_ECO57      LEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWXXXXXXXXXXXXXXX
ANSP2_MYCTU     PSSGSFVSYAREFYGEKVAFVAGWMYFLNWAMTGIVDTTAIAHYCHYWFQPIPQWTLALIALLVVLSMNL
ANSP2_MYCBO     PSSGSFVSYAREFYGEKVAFVAGWMYFLNWAMTGIVDTTAIAHYCHYWFQPIPQWTLALIALLVVLSMNL
YIFK_SALTY      PVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFPEMAQWIPXXXXXXXXXXXXX
YIFK_SALTI      PVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFPEMAQWIPXXXXXXXXXXXXX
AROP_ECOL6      PVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINL
AROP_SHIFL      PVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINL
AROP_ECOLI      PVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINL
ROCE_BACSU      PVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQLMQRWFPHIDVWIWCLVFAALMFILNA
AROP_SALTY      PVAGSFSHFAYKYWGGFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWXXXXXXXXXXXXXXL
AROP_SALTI      PVAGSFSHFAYKYWGGFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWXXXXXXXXXXXXXXL
AROP_ECO57      PVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINL
ANSP1_MYCTU     PSSGSFVSYAREFFGEKAAYAVGWMYFLHWAMTSIVDTTAIATYLQRWFTVVPQWILALIALTVVLSMNL
ANSP1_MYCBO     PSSGSFVSYAREFFGEKAAYAVGWMYFLHWAMTSIVDTTAIATYLQRWFTVVPQWILALIALTVVLSMNL
PHEP_ECOLI      PVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELTAAGIYMQYWFPDVPTXXXXXXXXXXXXXVNL
AAPA_BACSU      AGYHSFVDFVRDYLGNMAAFITGWTYWFCWISLAMADLTAVGIYTQYWLPDVPQWXXXXXXXXXXXXXXX
PROY_SALTY      PAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINL
PROY_ECOLI      PAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNL
PROY_ECOL6      PAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNL
PROY_ECO57      PAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNL
ANSP_STRCO      PSSGSFVSYAREFLGEKGAYVAGWMYFLNWSTTGIADITAIALYTHYWFTSIPQWXXXXXXXXXXXXXNL
YDGF_BACSU      LNYHSFVDFVQDYLGDMAAFITGWTYWFCWISIAMADLTAVGLYTQYWLPGVPQWVPGXXXXXXXXXMNL
YVBW_BACSU      RNARTFRDLVQQVLGNYAAYFLDWIYWKMWVLNXXXXXXXXXXFIQYWLPGCPIWVLALGISLIVTIVNL
LYP1_YEAST      PVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNF
CAN1_YEAST      PVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNL
CAN1_CANAL      PISGSFAQFVTRWVSKSCGAANGWLYWFSWAVTFGLELSVVGQVIQFWTDAVPLAAWISIFFVILTIFNF
MEU22_SCHPO     PVSGSFYTYFSKFIDPAWGFAVGIQYWLSFAVTVPLELTVAPLIINFWNASGPVSIWISVFYVIIIAINI
ALP1_YEAST      PVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM
TAT2_YEAST      PVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINL
YI26_SCHPO      PVAGGFYNYAVRFIDPAWGFAVGWNYFMNYFVTFPLELTTCAITFRYW-TDINSCAWITIFLVFVICINL
YCUB_SCHPO      -FDFNFNTHAARWVDPAFGAAIGWNYVIVWLTNIAAEYTSLTSILQYWGPHVPSYGFFLIFWGFFTCYQM
AGP3_YEAST      PSGGGFTTLARRFHSDALPAVCGXXXXXXXXXXLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQL
YCV4_SCHPO      XXXXXXXXXXXRYVDKALGFATGWNYFFKYAIVYPTNLTAVGIVIHYWRPDLNVGIWVAVFLVVILAINL
YI0B_SCHPO      PVAGGFNTYATRFIDPAWGFAVSWNYFINYFVTFPLELTTCAITFRYW-TDINSAAWISIFLXXXXXXNL
ISP5_SCHPO      PINGSFHTYGTRFIHPSWGFTLGWNYLASFLATYPLELITASICLQFWIN-INSGIWITVFIALLCFVNM
BAP2_YEAST      PTPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHF
YHE1_SCHPO      PTRGSFVTHATRFIDESWGFALSWNYVFSFIVTIPLELTTGTMMIKYWTN-LNSGXXXXXXXXXXXXXXX
PUT4_YEAST      PSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNF
INDA1_TRIAT     PVSGSFYTYSARFIDPAWGFAMGWNYVLQWAAVLPLELTVCGITISYWNSEITTAAWISLFLGVIIIINL
YQD2_SCHPO      PVAGSFCTYVGRYVDEALSFSLTWNYWLFWLIPTEGDPVSASLSLPPWKEAV-RIITPITSLSANIILNM
GNP1_YEAST      DLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDXXXXXXXXXXXXXXX
AGP1_SACBA      NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINI
PUT4_SCHPO      PLSGSPITYIERYVDASLAFAAGWNYWYAYVFLVASEVTAASIVIEYWTYAVPTAGWIAILLFLVAVLNS
HIP1_YEAST      PVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANM
PUTX_EMENI      PIRGVSVPYLIGRFTPSIGFASGYNYWYSFAMLLASEVTASGLIIEYWNPPVSVGLWXXXXXXXXXXXXX
GAP1_YEAST      PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVINM
YH83_SCHPO      PVAGSFNTYATRFIDPAWGFAVSWNYFFNYFVTFPFELTTCAITFTFW-TDVNCAVWISIFLVVVIGINL
YH81_SCHPO      PVAGSFNTYATRFIDPAWGFAVSWNYFLNYFVTCPLELTTCAITFKFW-TEINSAAWISIFLAVVIVINL
VAL1_YEAST      ALTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNADXXXXXXXXXXXXXNL
AGP2_YEAST      PVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISI
AGP1_YEAST      NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINI
AGP1_YEAS7      NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINI
YCGH_BACSU      PEKGSFCAYARKAFGKWAGFSNGWVYWTSEMLITGSQLTAISLFTKHWFPQVPLWVFASIYAVLGLLIIF
DIP5_YEAST      PLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRVNPGVWITXXXXXXXXXXX
BAP3_YEAST      PTPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADXXXXXXXXXXXXXXX
AAP1_SCHPO      PNQSSITMYTGRLLNNNIGFAQSWLYFWIWLTVLPSEISAACEVVDFWTQHLNPAIWVTIFLAYVVLVNA
SAM3_YEAST      PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAVWVAIFYVFIMVLNL
MMP1_YEAST      PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNL
SSY1_YEAST      PVSSGFSGLASRFVEDAFGFALGWTYWISCMLALPAQVSSSTFYLSYYISKGVTAGFITLFSAFSIVVNL
YBEC_BACSU      PEAGGMVKYTQYSHGSFIGFIAGWANWIAIVSVIPVEAVASVQYMSSWPWEWEGLAFASVLLLIYFLLNY
YPEV_LACDL      SNSHTFVSFITRYLGEAAGRFAGWTYWIGILFACMAELTAVSTYVQYWLPGLPAWLIEVSVXXXXXXXXX
AAXC_CHLAB      PTTGIY-MYSREGFGPYIGFTIGWGYWLCQIFGNVGYAVMTMDALNYFFNTLPAILGGSILIWVFNFIVL
GADC_SHIFL      ----------------------------------------------------------------------
GADC_ECOLI      ----------------------------------------------------------------------
GADC_ECOL6      ----------------------------------------------------------------------
GADC_ECO57      ----------------------------------------------------------------------
CTR2_HUMAN      PKTGSAYLYTYVTVGEWASYVIGWSGTF----DELLSKQIGQFLRTYFRMNYTGLAEYPDFFAVCXXXXX
ADIC_YERPE      DSPGGSYAYARRAFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFEPMVLTITCVVFLWIFVGLNI
YHDG_BACSU      ----------------------------------------------------------------------
CTR1_MOUSE      ----------------------------------------------------------------------
PUUP_ECOLI      PEAGSAYTYAQKSINPHVGFMVGWSSLLDYLFLPMINVLLAKIYLSALFPEVPPWVWVVTFVAILTAANL
ARCD_BACSU      PQSYARALFSDPKKGNAAGFTMVWGYWVFFPILVDKREMFSIGGQEVTLGQLLTFAVCTILLWGTHAILV
CTR2_CHICK      PKTGSAYLYTYVAVGELWAFITGW----------------------------------------------
CTR3_MOUSE      PGSGSAYLYSYVTVGELWAFTTGW----------------------------------------------
CTR2_PIG        PKTGSAYLYTYVTVGELWAFITGW----------------------------------------------
CTR2_DANRE      PKTGSAYLYSYVTVGELWAFITGW----------------------------------------------
CTR2_XENLA      ----------------------------------------------------------------------
AAXC_CHLPN      PDKEGIYMYSREGFGPYIGFTIGWGYW-------------------------------------------
CTR1_RAT        ----------------------------------------------------------------------
CTR3_RAT        PGSGSAYLYSYVTVGELWAFTTGW----------------------------------------------
CTR2_RAT        PKTGSAYLYTYVTVGELWAFITGW----------------------------------------------
AAXC_CHLTB      PDKAGIYTYSREGFGPYVGFTIAWGYW-------------------------------------------
AAXC_CHLT2      PDKAGIYTYSREGFGPYVGFTIAWGYW-------------------------------------------
POTE_HAEIN      ----------------------------------------------------------------------
CTR2_MOUSE      PKTGSAYLYTYVTVGELWAFITGW----------------------------------------------
FRLA_ECOLI      PENGADYVYLKNAGSRPLAFLSGWASFWANDAPSLSIMALAIVSNLGFLTPIDPLLGKFIAAGLIIAFML
ADIC_SHIFL      PSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFDPLVLTITCVVVLWIFVLLNI
ADIC_ECOLI      PSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFDPLVLTITCVVVLWIFVLLNI
ADIC_ECOL6      PSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFDPLVLTITCVVVLWIFVLLNI
ADIC_ECO57      PSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFDPLVLTITCVVVLWIFVLLNI
Y2001_MYCBO     RTNGASYAYTTAAFGRRIGIYVG-----------------------------------------------
Y1979_MYCTU     RTNGASYAYTTAAFGRRIGIYVG-----------------------------------------------
Y1691_LEGPH     ----------------------------------------------------------------------
FRLA_ECO57      PENGADYVYLKNAGSRPLAFLSGWASFWANDAPSLSIMALAIVSNLGFLTPIDPLLGKFIAAGLIIAFML
CTR1_HUMAN      ----------------------------------------------------------------------
ADIC_SALTY      PSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFDPLVLTLTCVAVLWIFVLLNI
ADIC_SALTI      PSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFDPLVLTLTCVAVLWIFVLLNI
AAXC_CHLTR      PDKAGIYTYSREGFGPYVGFTIAWGYW-------------------------------------------
AAXC_CHLTA      PDKAGIYTYSREGFGPYVGFTIAWGYW-------------------------------------------
STET_BACSU      PKTGGLYTYLEEVYGEFWGFLCGWV---------------------------------------------
YECA_BACSU      PSAGGITAYVQLAFQKKAGAILGWI---------------------------------------------
LAT2_PONAB      ----------------------------------------------------------------------
LAT2_HUMAN      ----------------------------------------------------------------------
LYSI_CORGL      LDSGVYA-YARVGLGDYVGFSSAWGYW-------------------------------------------
CTR3_HUMAN      PRSGSAYLYSYVTVGELWAFTTGW----------------------------------------------
YLAT1_HUMAN     KKSGASYAYILEAFGGFLAFIRLW----------------------------------------------
AAXC_CHLCV      PTTGIY-MYSREGFGPYVGFTIGWGYWLCQIFGNVGYAVMTMDALNYFFNTIPAIIGGSILIWVFNFIVL
Y389_CLOPE      ----------------------------------------------------------------------
Y377_CLOP1      ----------------------------------------------------------------------
YLAT2_HUMAN     TKSGASYAYILEAFGGFIAFIRLWV---------------------------------------------
BAT1_MOUSE      TKSGGEYPYLMEAFGPIPAYLFSW----------------------------------------------
AAXC_CHLMU      ----------------------------------------------------------------------
YLAT2_XENLA     KKSGASYAYILEAFGGFVAFIRLW----------------------------------------------
YLAT1_RAT       KKSGASYAYILEAFGGFLAFIRLW----------------------------------------------
YLAT1_MOUSE     KKSGASYAYILEAFGGFLAFIRLW----------------------------------------------
BAT1_RAT        TKSGGEYPYLMEAFGPIPAYLFSW----------------------------------------------
ARCD_SHIFL      PEDGGIFTYAREGFGELIGFCSAWGYW-------------------------------------------
ARCD_ECOLI      PEDGGIFTYAREGFGELIGFCSAWGYW-------------------------------------------
ARCD_ECOL6      PEDGGIFTYAREGFGELIGFCSAWGYW-------------------------------------------
AAXC_CHLFF      PTTGIY-MYSREGFGPYVGFTIGWGYW-------------------------------------------
Y609_METJA      ----------------------------------------------------------------------
POLG_FCVC6      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSEPVGFSNLTGKGGFFPEXXXXXXXXXXXXXX
GABP_BACSU      YSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSEPVGFSNLTGKGGFFPEXXXXXXXXXXXXXX
GABP_ECOLI      LSVKNYGEFEFWLALCKVIAILAFIFLGAVAISGFYPYAEVSGISRLWDSGGFMPNGFGAVLSAMLITMF
YTNA_BACSU      LAVKAYGELEFWFALIKIVAILSMIAVGLLMIIGVGNGGIATGISNLWNNGGFFPHGLKGVLLSLQMVMF
HUTM_BACSU      FSVKLFAETEFWFSSVKIVTIILFIILGGAAMFGLISTADAPMLSNFTDHGGLFPNGFLAVFIAMISVSF
YBGF_BACSU      FSVKFFAESEFWFSSIKVLAIVLFILLGGSAMFGIIPGEAAPMLSNFTAEGGLFPNGFVPILMTMLSVNF
AROP_CORGL      XXXRGFGEFEYWFAFIKVAVXXXXXXXXXXXXXXWLPGSTFVGTSNFIGDHGFMPNGISXXXXXXXXXXX
ROCC_BACSU      LSVRSFAEMEFWFSSIKVAAIILFIVIGGAAVFGFKGGQETPFLSNFMTDRGLFPNGVLAVMFTLVMVNF
YBXG_BACSU      ISVKSFGEFEFWFAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSNLWSHXXXXXXXXXXXXXXXXXVIA
LYSP_ECOLI      ISVRGFGEAEYWFSLXXXXXXXXXXXXXXLMIIGIFKGAQPAGWSNWTIGEAPFAGGFAAMIGVAMIVGF
MMUP_ECOLI      ISTRFFAEGEFWFSLVKVVTXXXXXXXXXXXXXXXXPGSPAPGLSNITAEG-WFPHGGLPILMTMVAVNF
ANSP_ECOLI      IGVKWFAEMEFWFALIKVLAIVTFLVVGTVFLGSGQPDGNTTGFHLITDNGGFFPHGLLPALVLIQGVVF
YIFK_ECOLI      XXXXXYGEIEFWFAMIKVTTXXXXXXXXXXXXXXXXXXXQSIGFSNLTEHGGFFAGGWKGFLTALCIVVA
ANSP_SALTY      IGVKWFAEMEFWFALIKVLAIVIFLVVGTIFLGTGQPEGNATGFHLITDNGGFFPHGLLPALVLIQGVVF
CYCA_ECOLI      XXXKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVF
CYCA_ECO57      XXXKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVF
ANSP2_MYCTU     ISVRLFGELEFWASLIKVIALVTFLIVGTVFLAGYKIDGQETGVSLWSSHGGIVPTGLLPIVLVTSGVVF
ANSP2_MYCBO     ISVRLFGELEFWASLIKVIALVTFLIVGTVFLAGYKIDGQETGVSLWSSHGGIVPTGLLPIVLVTSGVVF
YIFK_SALTY      XXXXXYGEIEFWFAMIKVTTXXXXXXXXXXXXXXXXXXXXXXXXXXLTEHGGFFAGGWKGFLTALCIVVA
YIFK_SALTI      XXXXXYGEIEFWFAMIKVTTXXXXXXXXXXXXXXXXXXXXXXXXXXLTEHGGFFAGGWKGFLTALCIVVA
AROP_ECOL6      TNVKVFGEMEFWFXXXXXXXXXXXXXFGAWLLFS-GNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMF
AROP_SHIFL      TNVKVFGEMEFWFXXXXXXXXXXXXXFGGWLLFS-GNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMF
AROP_ECOLI      TNVKVFGEMEFWFXXXXXXXXXXXXXFGGWLLFS-GNGGPQATVSNLWDQGGFLPHGFTGLVMMMAIIMF
ROCE_BACSU      ITTKAFAESEFWFSXXXXXXXXXXXXXXXAAMFGLIDGGEQAPFLTHFYEDGLFPNGIKAMLITMITVNF
AROP_SALTY      TNVKVFGEMEFWFXXXXXXXXXXXXLFGAWLLFSDTAGPQAT-VRNLWEQGGFLPHGWTGLVMMMAIIMF
AROP_SALTI      TNVKVFGEMEFWFXXXXXXXXXXXXLFGAWLLFSDTAGPQAT-VRNLWEQGGFLPHGWTGLVMMMAIIMF
AROP_ECO57      TNVTVFGEMEFWFXXXXXXXXXXXXXFGGWLLFS-GNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMF
ANSP1_MYCTU     ISVEWFGELEFWAALIKVLALMAFLVVGTVFLAGRYPDGHSTGLSLWNNHGGLFPTSWLPLLIVTSGVVF
ANSP1_MYCBO     ISVEWFGELEFWAALIKVLALMAFLVVGTVFLAGRYPDGHSTGLSLWNNHGGLFPTSWLPLLIVTSGVVF
PHEP_ECOLI      VNVRLYGETEFWFALIKVLAIIGMIGFGLWLLFS-GHGGEKASIDNLWRYGGFFATGWNGLILSLAVIMF
AAPA_BACSU      ATVKLFGELEFWFXXXXXXXXXXXXXTGILLIAGFSAASGPASLNNLWSHGGMFPNGWHGFILSFQMVVF
PROY_SALTY      MSVKVFGELEFWFSFFKVATXXXXXXXXXXXXXXXXXXXQPTGIHNLWSNGGFFSNGWLGMIMSLQMVMF
PROY_ECOLI      MSVKVFGELEFWFSFFKVATXXXXXXXXXXXXXXXXXXXQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMF
PROY_ECOL6      MSVKVFGELEFWFSFFKVATXXXXXXXXXXXXXXXXXXXQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMF
PROY_ECO57      MSVKVFGELEFWFSFFKVATXXXXXXXXXXXXXXXXXXXQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMF
ANSP_STRCO      ISVKIFGEMEFWFAIVKVATLVGFMLIGFLLATQHEVSGQTPGMGMITDHGGILPHGVMPVVLVMQGVIF
YDGF_BACSU      ATVKLFGELEFWFXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXNLWSHGGLFPNGMHGFILSFQMVVF
YVBW_BACSU      LSVKIFAETEYWLAMXXXXXXXXXXXXXXXXXFVSFGDHTASGFSNLTDHGGFFPHGGTGLITAMLVVIY
LYP1_YEAST      FPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCG---GSHPIGFRYWRNPGAWGPGIISSDKSEGRFLGW
CAN1_YEAST      FPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGW
CAN1_CANAL      FPVKFYGEVEFWIASIKIIAVFGWIIYAFIMVCG-AGKTGPVGFGILVNNNG---KYVAAFVSGLINSIF
MEU22_SCHPO     WGTEGYGEVEFFLSIMKVISVIGFVILSIIIAAGGVPTDDRIGVSYLVFNNGF-----KGLCAVSVIAIF
ALP1_YEAST      FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW
TAT2_YEAST      FGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIG-AKYWHDPGCLANGFPXXXXXXXXXXX
YI26_SCHPO      FGVRGYGEVEFILSTLKVVATTGFIILAIIINCGGVP-TDPRGYGGKIIKNKPFRHSFKGFCSVFTTAGF
YCUB_SCHPO      LGVSVFGESEYILAFIKLLXXXXXXXXXXXXXXXXXPHHKPPNFKEMPLAHGF-----GGIVSAFVYAGV
AGP3_YEAST      VGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGAL-SHGFKGIAIVFVFCST
YCV4_SCHPO      LHVKYFGEVEFWLSAVKXXXXXXXXXXXXXXXSGGTPVHHKIGFHYWRDPGAFAPGRFLGFWACLVQSCF
YI0B_SCHPO      FGVRAYGEVEFILSTVKVVATFGFIILAIIINCGGVPTDHRGYIGGSIIKHKPFRHGFKGFCSVFTTAAF
ISP5_SCHPO      FGVRGYGEVEFFVSSLKVMAMXATIFRKNAFIHGFH------GFCSVFSTAAF-----------------
BAP2_YEAST      FGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILV
YHE1_SCHPO      XXXKGYGEMEFIMSTIKVVAMCGFIILGIIIDCGGVPTDHRGYMGTHIFRENAFRHKFKGFCAVFTSAAF
PUT4_YEAST      SAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRHLTG--GSLGNFTDIYTGIIKGAFA
INDA1_TRIAT     FGALGYAEEEFWASCFKLAATVIFMIIAFVLVLGGGPKDDPGAFKN--GFKGF--------CSVFVTAAF
YQD2_SCHPO      LPVGGFGEIEYWLSSIKVFTVAAFIVNGILCNLGVNNEKKFIGFRYWKDPGAF-NNGIIGVISSFVNAAF
GNP1_YEAST      XGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFTPIQRFKGXXXXXXXXX
AGP1_SACBA      FGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGDRFKXXXXXXXXXXX
PUT4_SCHPO      FFVKWFGETEFWFXXXXXXXXXXXXXXXXXXXXXXTPKHDRLGFRYVKGASGRF---VGFWSAVIKSGFA
HIP1_YEAST      LDVKSFGETEFVLSMIKILSIIGFTILGIVLSCXXXXXXXXXXXKYWHDPGAFVGHQFKGLCSVFVTAAF
PUTX_EMENI      XXXEWYGESEFWFXXXXXXXXXXXXXXXXXXXXXXXPNHDRLGFRYWQDPGAFNPKFLGFWTALIKSGFS
GAP1_YEAST      FGVKGYGEAEFVFSFIKVITVVXXXXXXXXXXXXXXXXXXXXXXKYWHDPGAFAGDTPGAKFKGVCSVFV
YH83_SCHPO      XXXXXXXXXXXXLALIKVVATVGFIILAIIINCGGVPTDHRGYIGGSIIKQKPFRHGFKGFCSVYTTAAF
YH81_SCHPO      FGVRAYGEVEFILSTIKVIATVGFIILAIIINCGGVPTDHRGYIGGSIIKQKPFRHGFKGFCSVFTTAAF
VAL1_YEAST      FGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRYIG-AEYWHNPGPFAHGFKGVCTVFCYAAF
AGP2_YEAST      CAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFRNY-GESPFFPDGNDVGKSSGYFQGF
AGP1_YEAST      FGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGDRFKGXXXXXXXXXX
AGP1_YEAS7      FGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGDRFKXXXXXXXXXXX
YCGH_BACSU      TGLSVFEKTENVLAVIKTAAIFMFIVIAILALCGLSGGNHGIHVPNKTSE--FFPYGAMGLWTGLIYAFY
DIP5_YEAST      XXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSF
BAP3_YEAST      XGVKAYGETEFIFNSCKILMVAGFIILGGAGVDGYIGGKDPGSFAEGSGATRF-----KGICYILVSAYF
AAP1_SCHPO      FGARSYGECEXXXXXXXXXXXXXXXXXXXXXNCGAAPKGGYIG-AHYWHHPGSFRNGFKGFCSVFISSAY
SAM3_YEAST      FGVRGFAETEFALSXXXXXXXXXXXXXXXXXXXXXXPNSTGIGAKYWHDPGAFAKPVFKNLCNTFVSAAF
MMP1_YEAST      FGARGFAESEFYMSIFKXXXXXXXXXXXXXXXXXXXPDSTGIGTKYWHDPGSFAVPVFKNLCNTFVSAAY
SSY1_YEAST      LDVSIMGEIVYVAGISKV--IIAILMVFTMIILNAGHGNEGVGFRNLTKKGISGPKGRFLATASVMLIST
YBEC_BACSU      WTVNLFSKANSLITIFKI--IIPGLTIGALLFVGFHG-------ENFTGGQSIAPNGWASVLTAVATSGI
YPEV_LACDL      XXXXXFGETEFWFAMIKIIAIISLVVTG------------------------------------------
AAXC_CHLAB      KGIRQASFINIIGTVGKLVPLIVFIII-TAFLFKLAIFKTDFWGDTVTKTQPLLGSMTSQLKSTMLVTLW
GADC_SHIFL      ----------------------------------------------------------------------
GADC_ECOLI      ----------------------------------------------------------------------
GADC_ECOL6      ----------------------------------------------------------------------
GADC_ECO57      ----------------------------------------------------------------------
CTR2_HUMAN      XXXXSFGVKESWVN--KVFTAVNILVLLFVMVAGFVKGNEPPSENSIYGAGGFMPYGFTGTLAGAATCFY
ADIC_YERPE      IGPKMITRVQAVATSLALIPIVGIALFGWFWF----KGETYMAAWNVSGLGTF-----GAIQSTLNVTLW
YHDG_BACSU      ----------------------------------------------------------------------
CTR1_MOUSE      ----------------KIFTCINVLVLCFIVVSGFVKGSTEKNFSNDTGEGGFMPFGFSGVLSGAATCFY
PUUP_ECOLI      KSVNLVANFNTLFVLVQISIMVVFI---FLVVQGLHKGE---GVGTVWSLQPFISEHLIPIITGATIVCF
ARCD_BACSU      ASINGASKLNFVTTLSKVLGFVFFIVAG---LFVFQTSLFGHFYFPVQGENGTSIGIGGQVHNAAISTLW
CTR2_CHICK      ----------------------------------------------------------------------
CTR3_MOUSE      ----------------KVFTGMNLLVLSFVIISGFIKGSESNGTCSLDGSGGFMPFGLEGILRGAATCFY
CTR2_PIG        ----------------KVFTAVNILVLLFVMVAGFVKGNEPPSENSIYGAGGFMPYGFTGTLAGAATCFY
CTR2_DANRE      ----------------------------------------------------------------------
CTR2_XENLA      ------------------------------------------------GAGGFMPFGFSGTLAGAATCFY
AAXC_CHLPN      ----------------------------------------------------------------------
CTR1_RAT        ----------------KIFTCINVLVLCFIMVSGFVKGSSPLCGNNDTGEGGFMPFGFSGVLSGAATCFY
CTR3_RAT        ----------------KVFTGMNLLVLGFVIISGFIKGSESNGTCSLDGSGGFMPFGLEGILRGAATCFY
CTR2_RAT        ----------------KFFTAINILVLLFVMVAGFVKGNEPPSENSIYGAGGFMPYGFTGTLAGAATCFY
AAXC_CHLTB      ----------------------------------------------------------------------
AAXC_CHLT2      ----------------------------------------------------------------------
POTE_HAEIN      ----------------------------------------------------------------------
CTR2_MOUSE      ----------------------------------------------------------------------
FRLA_ECOLI      LHLRSVEGGAAFQTLITIAKIIPFTIVIGLGIFWF----KAENFXXXXXXXXXXXXSFMALLAGISATSW
ADIC_SHIFL      VGPKMITRVQAVATVLALIPIVGIAVFGW---FWFR-GETYMAAWNVSGLGTF-----GAIQSTLNVTLW
ADIC_ECOLI      VGPKMITRVQAVATVLALIPIVGIAVFGW---FWFR-GETYMAAWNVSGLGTF-----GAIQSTLNVTLW
ADIC_ECOL6      VGPKMITRVQAVATVLALIPIVGIAVFGW---FWFR-GETYMAAWNVSGLGTF-----GAIQSTLNVTLW
ADIC_ECO57      VGPKMITRVQAVATVLALIPIVGIAVFGW---FWFR-GETYMAAWNVSGLGTF-----GAIQSTLNVTLW
Y2001_MYCBO     ----------------------------------------------------------------------
Y1979_MYCTU     ----------------------------------------------------------------------
Y1691_LEGPH     ----------------------------------------------------------------------
FRLA_ECO57      LHLRSVEGGAAFQTLITIAKIIPFTIVIGLGIFWF----KAENFXXXXXXXXXXXXSFMALLAGISATSW
CTR1_HUMAN      ----------------KIFTCINVLVLGFIMVSGFVKGSTEEDFGNTSGRGGFMPFGFSGVLSGAATCFY
ADIC_SALTY      VGPKMITRVQAVATVLALVPIVGIAVFGWFWF----KGETYMAAWNVSGMNTF-----GAIQSTLNVTLW
ADIC_SALTI      VGPKMITRVQAVATVLALVPIVGIAVFGWFWF----KGETYMAAWNVSGMNTF-----GAIQSTLNVTLW
AAXC_CHLTR      ----------------------------------------------------------------------
AAXC_CHLTA      ----------------------------------------------------------------------
STET_BACSU      ----------------------------------------------------------------------
YECA_BACSU      ----------------------------------------------------------------------
LAT2_PONAB      ----------------------------------------------------------------------
LAT2_HUMAN      ----------------------------------------------------------------------
LYSI_CORGL      ----------------------------------------------------------------------
CTR3_HUMAN      ----------------KVFTGVNLLVLGFVMISGFVKGDVELAMAELNGSGGFVPFGFEGILRGAATCFY
YLAT1_HUMAN     ----------------------------------------------------------------------
AAXC_CHLCV      KGIRQASFINIIGTVCKLVPLIVFIII-TAFAFKLAIFKTDFWGDAVTKTQPALGSVTSQLKSTMLVTLW
Y389_CLOPE      ----------------------------------------------------------------------
Y377_CLOP1      ----------------------------------------------------------------------
YLAT2_HUMAN     ----------------------------------------------------------------------
BAT1_MOUSE      ----------------------------------------------------------------------
AAXC_CHLMU      ----------------------------------------------------------------------
YLAT2_XENLA     ----------------------------------------------------------------------
YLAT1_RAT       ----------------------------------------------------------------------
YLAT1_MOUSE     ----------------------------------------------------------------------
BAT1_RAT        ----------------------------------------------------------------------
ARCD_SHIFL      ----------------------------------------------------------------------
ARCD_ECOLI      ----------------------------------------------------------------------
ARCD_ECOL6      ----------------------------------------------------------------------
AAXC_CHLFF      ----------------------------------------------------------------------
Y609_METJA      ----------------------------------------------------------------------
POLG_FCVC6      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXMGTEIVAIAAGETSNPIESVTKATRSVVWRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVP
GABP_BACSU      XXMGTEIVAIAAGETSNPIESVTKATRSVVWRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVP
GABP_ECOLI      SFMGAEIVTIAAAESDTPEKHIVRATNSVIWRISIFYLCSIFVVVALIPWNMPGLAVGSYRSVLELLNIP
YTNA_BACSU      AYLGIEMIGVTAGEVKNPQKSLAKAIDTVFWRILIFYVGALFVIMSIYPWQEIGSQGSPFVLTFQKVGIP
HUTM_BACSU      AFSGTELIGVTAGESANPQKDIPRSIRNVAWRTVIFFIGAVFILSGLISWKDAGVIESPFVAVFAEIGIP
YBGF_BACSU      AFSGTELIGIAAGESVDPDKTIPKAIKTTVWRLSLFFVGTIFVLSGLIPIQDAGVIKSPFVAVFDRVGVP
AROP_CORGL      XXXXIEIVTIAAAESDKPREAISLAVRAVIWRISVFYLGSVLVITFLMPYESINAAESPFTQILAMANIP
ROCC_BACSU      SFQGTELVGIAAGESESPEKTLPKSIRNVIWRTXXXXXXXXXXXXXXXPYKTAGVIESPFVAVLDQIGIP
YBXG_BACSU      AYQGVELIGITAGEAKDPQNTLRNAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGIT
LYSP_ECOLI      SFQGTELIGIAAGESEDPAKNIPRAVRQVFWRILLFYVFAILIISLIIPYTDPSLLRSPFTLVFQHAGLL
MMUP_ECOLI      AFSGTELIGIAAGETENPRKVIPVAIRTTIARLIIFFIGTVFVLAALIPMQQVGVEKSPFVLVFEKVGIP
ANSP_ECOLI      AFASIEMVGTAAGECKDPQTMVPKAINSVIWRIGLFYVGSVVLLVMLLPWSAYQAGQSPFVTFFSKLGVP
YIFK_ECOLI      SYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWNEIGSNGSPFVLTFXXXXXX
ANSP_SALTY      AFASIELVGTAAGECKDPQKMVPKAINSVIWRIGLFYVGSXXXXXXXXPWNAYQAGQSPFVTFFSKLGVP
CYCA_ECOLI      AFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLP
CYCA_ECO57      AFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLP
ANSP2_MYCTU     AYAAIELVGIAAGETAEPAKIMPRAINSVVLRIACFYVGSTVLLALLLPYTAYKEHVSPFVTFFSKIGID
ANSP2_MYCBO     AYAAIELVGIAAGETAEPAKIMPRAINSVVLRIACFYVGSTVLLALLLPYTAYKEHVSPFVTFFSKIGID
YIFK_SALTY      SYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWNEIGSNGSPFVLTFXXXXXX
YIFK_SALTI      SYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWNEIGSNGSPFVLTFXXXXXX
AROP_ECOL6      SFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDT
AROP_SHIFL      SFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDT
AROP_ECOLI      SFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDT
ROCE_BACSU      AFQGTELIGVAAGESEDPEKTIPRSIKQTVWRTLVFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIP
AROP_SALTY      SFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
AROP_SALTI      SFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
AROP_ECO57      SFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDT
ANSP1_MYCTU     AYSAVELVGTAAGETAEPEKIMPRAINSVVARIAIFYVGSVXXXXXXXPYTAYKAGESPFVTFFSKIGFH
ANSP1_MYCBO     AYSAVELVGTAAGETAEPEKIMPRAINSVVARIAIFYVGSVXXXXXXXPYTAYKAGESPFVTFFSKIGFH
PHEP_ECOLI      SFGGLELIGITAAEARDPEKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNSSPFVMIFHNLDSN
AAPA_BACSU      AFVGIELVGLTAGETENPQKVIPKAINQIPVRILLFYVGALFVIMCIYPWNVLNPNESPFVQVFSAVGIV
PROY_SALTY      AYXXXXXXXXXXXXXKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGIT
PROY_ECOLI      AYXXXXXXXXXXXXXKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGIT
PROY_ECOL6      AYXXXXXXXXXXXXXKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGIT
PROY_ECO57      AYXXXXXXXXXXXXXKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGIT
ANSP_STRCO      SYAALELVGVAAGETAEPHKIVPRAVNSIMWRVALFYXXXXXXXXXXXXXXXYSGDESPFVTVLSGIGVP
YDGF_BACSU      AFVGIELVGLTAGETENPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWDIINPSESPFVQVFVAVGIV
YVBW_BACSU      SYGGTEIIGVTLAETKNPEKVVPKAVRSTLTRIVAFYLLPFFIIVSLIPWNQVNVPESPFVMVFKMVGIP
LYP1_YEAST      VSQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNSAVIASSPFVISIQNAGTY
CAN1_YEAST      VSQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSPFIIAIENSGTK
CAN1_CANAL      TFQGSELVAVTAGEASP--RALRSAIRKVMFRILVFYVLCMLFMGLLVPYNDPKLTQSPFLIAMENSGTK
MEU22_SCHPO     SLSGTELVGLAASEAKNPQKTVPAAVKQIFWRIFLFYIVALFMLTLVVPSDNSNVLISPFVIAIQLANIR
ALP1_YEAST      VSQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKVSSSPFMISIENSGTK
TAT2_YEAST      XXXXIEMTCLASGETDP--KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLNSPFVIAIKLHHIK
YI26_SCHPO      SFSGTEVVGLAAAEAEDPQKSLPRATKQVFWRIAIFYXXXXXXXXXXLMGNSSDGSTSPFVLAIKEANIR
YCUB_SCHPO      FFSGVESVSMTAAESKNPKKAIPLAVRQTFWRILYVYFGISISYGITVAWNDPNLLKSPMTIAIMNAGWN
AGP3_YEAST      FYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNVLKSPIAIAISRAGWA
YCV4_SCHPO      AYVGSEVVGIAFGEAPNPEKTIRKSSFQSLFRIATFYVIGVFVLGLCVPYDSXXXXXXPFVVAIKLAQIK
YI0B_SCHPO      SFSGTEVIGLAAAEVDNPQKALPHAVKQVFWRIAIFYVVSXXXXXXXXSPDDPNLMVSPFVLAIKEANIK
ISP5_SCHPO      SYAGTEYIGIAASETKNPAKAFPKAVKQVFIRVSLFYILALFVVSLLISGRDERLTTSPFILALMDAKIR
BAP2_YEAST      TAYGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMASPYVLAASIHGVK
YHE1_SCHPO      SFSGTEYVGVAAAETENPAKAFPVAVRQTLFRIAXXXXXXXXXXXXXXXGADPRLTSSPFVLAIKDANIK
PUT4_YEAST      FILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVGTLAISV-IVPYNDPTLVNSPFVIGIQNAGIK
INDA1_TRIAT     SFSGTELVGLAAAESTNPTKNMPGAIKQVFWRITIFYILGLFFVGLLINSDDPALLSSPFVLVGKYAGLK
YQD2_SCHPO      AYAGTESIALTAGEAKSPITTLPKAIRFTAHRXXXXXXXXXXXXXXNLPYNTPSVRMSPFTFVFKKFGVP
GNP1_YEAST      XXXGSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLASPYVIAVSSHGVR
AGP1_SACBA      XXXXSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLASPYVIAIASHGVR
PUT4_SCHPO      FILAPELVIFSAGETEAPRRNIPKATSXXXXXXXXXXXXGSLTIGVITSSKDPRLLNAPFVIGIQNAEIP
HIP1_YEAST      SYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLSSPLVIAIENGGIK
PUTX_EMENI      FIFSPELITTAAGEVEAPRRNIPKATKRFIYRVFTFYILGSLVIGVTVAYNDPTLXXXPFVVAIQNAGIG
GAP1_YEAST      TAAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIASPFVIAIKTHGIK
YH83_SCHPO      SFSGTEIVGLAAAEVGDPRKTLPGAVKQVFWRVAIFYXXXXXXXXKLMGNGSASV--SPFVLAIQEANIK
YH81_SCHPO      SFSGTEIIGLAAAEVGNPRKSVPSAVKQVFWRIAIFYXXXXXXXXXXXXMGNGDVSVSPFVLAIQEANIK
VAL1_YEAST      SYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNXXXXXXSPFVIAVASHGVK
AGP2_YEAST      LACGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTSSPYVIAMNNLKIR
AGP1_YEAST      XXXXSEFIAITTAEQSNPRKAIPGAAKQMIYRXXXXXXXXXXXXXXXVPYNSDQLLASPYVIAVASHGVR
AGP1_YEAS7      XXXXSEFIAITTAEQSNPRKAIPGAAKQMIYRXXXXXXXXXXXXXXXVPYNSDQLLASPYVIAVASHGVR
YCGH_BACSU      AFGGIEVMGLMAVHLKKP-EEASKSGKLMLATLAIIYIISIGLALLLVPLHTFTEQDSPFITSLKGYNLE
DIP5_YEAST      VAVGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSSPFVVAIQNSGIE
BAP3_YEAST      SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRXXXXXXXXXXXXGFNVPHNNDQLMASPYVLAASIHKVR
AAP1_SCHPO      SLSGTENIGTAAGNTSNPQRAIPSAVKKVFYRMGXXXXXXXXXXXXVVPYDNPDLGNSPFIIAIKNGGIH
SAM3_YEAST      SFGGSELVLLTSTESKN-ISAISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSSPFVIALSNTGSM
MMP1_YEAST      SFSGTEMVVLTSTEXXXXXXXXXXX-KGTFWRXXXXXXXXXXXXGCLVPYNSEDITASPFVIALSNTGAM
SSY1_YEAST      FAFGVEMTFLASGEAINPIPSATKRTFSIVLISYVFLIFSVGILLSYFPGISEKRYESPWVVALQNFGLC
YBEC_BACSU      VFAGFQSPINMAGEAKNPGKSIPIAVVGSLFVATVIYVLQIAFIGAVNPWSHLN-FNSPFADL-------
YPEV_LACDL      ----------------------------------------------------------------------
AAXC_CHLAB      AFIGIEGAVVMSARAKSP-SAVGKAT-------ILGFTGTVYILLSILPFGSAGIANPSTAGVLDILVGK
GADC_SHIFL      --MGVEASATHVNEMSNPGRDYPLAMLLLVAAICLSSVGGLSIAM-VIPGNEINLVMQTFTVLMSHVAIE
GADC_ECOLI      --MGVEASATHVNEMSNPGRDYPLAMLLLVAAICLSSVGGLSIAM-VIPGNEINLVMQTFTVLMSHVAIE
GADC_ECOL6      --MGVEASATHVNEMSNPGRDYPLAMLLLVAAICLSSVGGLSIAM-VIPGNEINLVMQTFTVLMSHVAIE
GADC_ECO57      --MGVEASATHVNEMSNPGRDYPLAMLLLVAAICLSSVGGLSIAM-VIPGNEINLVMQTFTVLMSHVAIE
CTR2_HUMAN      AFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDE-KSPLPVAFEYVGWG
ADIC_YERPE      SFIGVETASVAAGVVKNPKRNVPIATVGGVLIAAVCYVLSSSAIMGMIPNAELRLSASPFGDAARLALGD
YHDG_BACSU      --IGFDAVSSAAEETKNPAKDLPKGIIFSLLVCTILYVTVSAIMTGVIPFAQFAGVDHPVSLVLQSAGQN
CTR1_MOUSE      AFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDI-DSPLPGAFKHQGWE
PUUP_ECOLI      SFLGFDAVTTLSEETPDAARVIPKAILTAVYGGVIFIAASFFM---QLFFPDISRFKDPDAALPEIALYV
ARCD_BACSU      AFVGIESAVILSGRARSQ-RDVKRATITGLLIALSIYIIVTLITMGVLPHDKLVGSEKPFVDVLYAIVGN
CTR2_CHICK      ----------------------------------------------------------------------
CTR3_MOUSE      AFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHP-ESPLPEAFSYVGWE
CTR2_PIG        AFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYVLDE-KSPLPVAFEYVGWG
CTR2_DANRE      ----------------------------------------------------------------------
CTR2_XENLA      AFVGFDCIATTGEEVKNPQKSIPLGIVLSLSICFFAYFGVSASLTLMMPYHLLDS-QSPLPAAFEYVGWN
AAXC_CHLPN      --IGIEGAVVMSGRAKNPL-SVGQAT-------VLGFLGTIYILFSLLPFGSANIPNPSTAGVLDILVGK
CTR1_RAT        AFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLD-TDSPLPGAFKYRGWE
CTR3_RAT        AFVGFDCIATTGEEAQNPQRSIPMGIVISLSICFLAYFGVSSALTLMMPYYKLQP-ESPLPEAFTYVGWE
CTR2_RAT        AFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDE-KSPLPVAFEYVGWG
AAXC_CHLTB      --IGIEGAVVISGRAANP-SSVGKATILGFSGCLLIYV-----LLSLLPFGSAKIADPSTAGVLNILVGK
AAXC_CHLT2      --IGIEGAVVISGRAANP-SSVGKATILGFSGCLLIYV-----LLSLLPFGSAKIADPSTAGVLNILVGK
POTE_HAEIN      --LGLESACANADAVENPEKNVPIAVLGGTLGAAVIYIVSTNVIAGIVPNLELANSTAPFGLAFAHMFDE
CTR2_MOUSE      ----------------------------------------------------------------------
FRLA_ECOLI      SYTGMASICYMTGEIKNPGKTMPRALIGSCXXXXXXXXXXXXXISGLMPFDKLANSETPISDALTWI--P
ADIC_SHIFL      SFIXXXXXXXXXXXXKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGD
ADIC_ECOLI      SFIXXXXXXXXXXXXKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGD
ADIC_ECOL6      SFIXXXXXXXXXXXXKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGD
ADIC_ECO57      SFIXXXXXXXXXXXXKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGD
Y2001_MYCBO     ----------------------------------------------------------------------
Y1979_MYCTU     ----------------------------------------------------------------------
Y1691_LEGPH     --IGMEMSAVHAEEVKNPQRDYPKALFYXXXXXXXXXXXXXXXXVIVVPNDSLSVLVDAYAIFFNSYNMP
FRLA_ECO57      SYTGMASICYMTGEIKNPGKTMPRALIGSCXXXXXXXXXXXXXISGLMPFDKLANSETPISDALTWI--P
CTR1_HUMAN      AFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLD-NNSPLPDAFKHVGWE
ADIC_SALTY      SFIXXXXXXXXXXXXKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGD
ADIC_SALTI      SFIXXXXXXXXXXXXKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGD
AAXC_CHLTR      ----------------------------------------------------------------------
AAXC_CHLTA      ----------------------------------------------------------------------
STET_BACSU      ---GWILLAALGGEMKNPEKLLPRAMTGGLLIVTAIY---IFINFALLHILSANEI----VTLGENATST
YECA_BACSU      ----------------------------------------------------------------------
LAT2_PONAB      ----------------------------------VYVFANVAYVTAMSP---QELLASNAVAVTKLLGV-
LAT2_HUMAN      ----------------------------------VYVFANVAYVTAMSP---QELLASNAVAVTKLLGV-
LYSI_CORGL      ----------------------------------------------------------------------
CTR3_HUMAN      AFVGFDCIATTGEEAQNPQRSIPMG---IVISLSVCFLAYFAVSSALMPYYQLQP-ESPLPEAFLYIGWA
YLAT1_HUMAN     ----------------------------------------------------------------------
AAXC_CHLCV      AFIGIEGAVVMSARAKSP-SAVGKAT-------LLGFVGTVYILLSILPFGSL------FQYQLAGIPNP
Y389_CLOPE      ----------------------------------------------------------------------
Y377_CLOP1      ----------------------------------------------------------------------
YLAT2_HUMAN     ----------------------------------------------------------------------
BAT1_MOUSE      ----------------------------------------------------------------------
AAXC_CHLMU      --IGIEGAVVMSGRASNP-SSVGKATILGFSGCLLIYV-----LLSLLPFGSAKIADPSTAGVLKFLVGK
YLAT2_XENLA     ----------------------------------------------------------------------
YLAT1_RAT       ----------------------------------------------------------------------
YLAT1_MOUSE     ----------------------------------------------------------------------
BAT1_RAT        ----------------------------------------------------------------------
ARCD_SHIFL      ----------------------------------------------------------------------
ARCD_ECOLI      ----------------------------------------------------------------------
ARCD_ECOL6      ----------------------------------------------------------------------
AAXC_CHLFF      ----------------------------------------------------------------------
Y609_METJA      --MGFGVITNASEHIENPKKNVPRAIFISILIVMFVYVGVAISAIGNLPINALAVAAKPFLGNLGFLLIS
POLG_FCVC6      --------------------------------------------------SATNTLKSPPIAVFNGVAVK


                         .         *         .         .         .         .         +:350
query           AAAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNY
GABP_BACSU      AAAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNY
GABP_ECOLI      HAKLIMDCVILLSVTSCLNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVLLSTGAAFLTVVVNY
YTNA_BACSU      SAAGIINFVVLTAALSSCNSGIFSTGRMLFNLAEQKEAPQAYGQLTKGGIPGKXXXXXXXXXXXXXXXXX
HUTM_BACSU      YAADIMNFVILTALLSVANSGLYASTRMMWSLANENMISSRFKKVTSKGIPLNALMISMAVSCLSLVSSI
YBGF_BACSU      YAADIMNFVILTAILSAANSGLYASSRMLWSLSKEKTLHPTFAKLTSKGTPFNALVFSMIGGIXXXXXXV
AROP_CORGL      GTVGFMEAIIVLALLSAFNAQIYATSRLVFSMANRQDAPRVFSKLSTSHVPTNAVLLSMFFAFVSVGLQY
ROCC_BACSU      FSADIMNFVILTAILSVANSGLYAASRMMWSLSSNQMGPSFLTRLTKKGVPMNALLITLGISGCSLLTSV
YBXG_BACSU      AAAGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTXXXXXXXXXXXXXNY
LYSP_ECOLI      SAAAVMNAVILTAVLSAGNSGMYASTRMLYTLACDGKAPRIFAKLSRGGVPRNALYATTVIAGLCFLTSM
MMUP_ECOLI      YAADIFNFVILTAILSAANSGLYASGRMLWSLSNERTLPACFARVTKNGVPLTALSVSMLGGVLALFSSV
ANSP_ECOLI      YIGSIMNIVVLTAALSSLNSGLYCTGRILRSMAMGGSAPSFMAKMSRQHVPYAGILATLVVYVVGVFLNY
YIFK_ECOLI      XXXXXXNFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAMAKVSRHGVPVAGVAVSIAILLIGSCLNY
ANSP_SALTY      YIGSIMNIVVLTAALSSLNSGLYCTGRILRSMSMGGSAPKFMAKMSRQHVPYAGILATLVVYVVGVFLNY
CYCA_ECOLI      AAASVINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLY
CYCA_ECO57      AAASVINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLY
ANSP2_MYCTU     AAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPRFTAPMSKTGVPYXXXXXXXXXXXXXXXXXX
ANSP2_MYCBO     AAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPRFTAPMSKTGVPYXXXXXXXXXXXXXXXXXX
YIFK_SALTY      XXXXXXNFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAVAKVSRHGVPVAGVALSILILLVGSCLNY
YIFK_SALTI      XXXXXXNFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAVAKVSRHGVPVAGVALSILILLVGSCLNY
AROP_ECOL6      FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINY
AROP_SHIFL      FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINY
AROP_ECOLI      FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINY
ROCE_BACSU      YAADIMNFVILIALLSVANSGLYASTRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKF
AROP_SALTY      FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSAVVTALCVLLNY
AROP_SALTI      FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSAVVTALCVLLNY
AROP_ECO57      FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINY
ANSP1_MYCTU     GAGDLMNIVVLTAALSSLNAGLYSTGRVMHSIAMSGSAPRFTARMSKSGVPYGGIVLTAVITLFGVALNA
ANSP1_MYCBO     GAGDLMNIVVLTAALSSLNAGLYSTGRVMHSIAMSGSAPRFTARMSKSGVPYGGIVLTAVITLFGVALNA
PHEP_ECOLI      VVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGVPINSLMLSGAITSLVVLINY
AAPA_BACSU      VAASLINFVVXXXXXXXXXXXXXXXXRMVYSLAKDHHAPGLLKKLTSSNVPSNALFFSSIAILIGVSLNY
PROY_SALTY      FAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVTVLVMTIALLFAVYLNY
PROY_ECOLI      FAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTTALLFAVYLNY
PROY_ECOL6      FAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTTALLFAVYLNY
PROY_ECO57      FAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTTALLFAVYLNY
ANSP_STRCO      AAGDVMNLVVLTAAMSSLNSGLYSTGRILRSMAMAGSAPRFTGVMSRSQVPYGGILLTCAVCVLGVGLNY
YDGF_BACSU      GAASIINFVVLTSAASACNSAVFSTSRMVYSLAKDHNAPESMAKLTQRKVPRNALFFSAIVILIGVTLNY
YVBW_BACSU      GADHIMNAVILLAIISSMNSGLYGSSRILYTQASDGRLPKVFSKLSSKNVPMFAILMCTSSLYIGVLISL
LYP1_YEAST      ALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCXXXXXXXXXXXXX
CAN1_YEAST      VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS
CAN1_CANAL      VLPHIFNAVIVTTIISAGNSNIYSGSRILYGLAQAGVAPKFFLRTNKXXXXXXXXXXXXXXXXXXYLACS
MEU22_SCHPO     ALPSIMNVVILLSTLSVGNSASYAASRALFALAKNGYAPKIFNKTNKRGHPIYAIAVTLLFGSIAYFTEA
ALP1_YEAST      VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVS
TAT2_YEAST      ALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKS
YI26_SCHPO      GLPSVFNAVIIISTVSVANSCTFTASRTLHAMAAKGDAPRFFAYTDRLGRPLLAMAVCLLFGFFAYINAA
YCUB_SCHPO      HAGDFVNAVILITCLSSINSGIYIGSRSLYNLAKDGMAPKIFKRVDKRGVPWVAVHSVHLFGFLS-IMNY
AGP3_YEAST      GGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVS
YCV4_SCHPO      VMPDVINACLLVFIISSANSDIYIGSRTLYALAKEGYAPKILMLQTKQGIPWVGCLVTSSFGLLAFMNTK
YI0B_SCHPO      GLPXXXXXXXXXXXXXXXXXXXYTAGRTLHGMANLKQAPSFFKYTDRLGRPLLAMIVVLLFGFFAYINEA
ISP5_SCHPO      GLPHVLNAVILISVLTAANGITYTGSRTLHSMAEQGHAPKWFKYVDREGRPLLAMAFVLCFGALGYICES
BAP2_YEAST      IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAAS
YHE1_SCHPO      ALPSILNAIILISVISSANAQLYAGSRAIHSLGCNGFAPKCFTLVDREGRPLVALLILFLFMFLGYLVET
PUT4_YEAST      VLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVS
INDA1_TRIAT     GFDHFMNLVILASVLSIGVSGVYGGSRTLTALAQQGYAPKLFTYIDKSGRPLPSVIFLILFGFIAYVSLD
YQD2_SCHPO      GAASIMNLVILSSALSAGNHSLYAGTRLLYSLAKSGHAPKVFSKCNKHGIPWLSVLATSATAILCLMSS-
GNP1_YEAST      VVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASS
AGP1_SACBA      VAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAAS
PUT4_SCHPO      VLNHIINAVILTSACSSGNSFLFAGSRSIYSLAKEHQAPKIFKYCNRWGVPVISVAVTVLFACLAFLNAS
HIP1_YEAST      GLPSLMXXXXXXXXXXXXXXXXYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAAS
PUTX_EMENI      GLNHVVNAAILISAWSSGNAWCYAGSRTLYSLAGEGQAPKIFTRTNRTGVPYVAVLATWTIGXXXXXXXX
GAP1_YEAST      GLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAAS
YH83_SCHPO      GLPXXXXXXXXXXXXXXXXXXXYTAGRTLHGMANLKQAPAFFKYTDRLGRPLIAVLSFGFFAYINEANNN
YH81_SCHPO      GLPSVFXXXXXXXXXXXXXXXXXXXXRTLQGMATLKQAPKFFSYTDRVGRPLIAMVVVLLFGFFAYINEA
VAL1_YEAST      VVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVATS
AGP2_YEAST      ILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWALVSLLQLN
AGP1_YEAST      VVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAAS
AGP1_YEAS7      VVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAAS
YCGH_BACSU      XXXXXXXXXXXXAGFSTLVASLFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAGXXXXXXXXX
DIP5_YEAST      VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMNVS
BAP3_YEAST      VIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRAXXXXXXXXXXXXXACS
AAP1_SCHPO      VLPHITNAVILVSVLSVGNAAVFAASRNAMALVKQGWAPRFLGRVDQKGRPVISYLCSLAMACIAYVNAA
SAM3_YEAST      GASNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVAS
MMP1_YEAST      GTSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVS
SSY1_YEAST      TFASAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKRGVPYXXXXXXXXXXXXAYIAVD
YBEC_BACSU      AIALNINWLVIVAFVSPSGTGIATTSRMIYGMEKNKYMPSIFGKLHPYGVPRQAM----FFNLIV-----
YPEV_LACDL      ----------------------------------------------------------------------
AAXC_CHLAB      WGEILMNVGLLIAVLSSWLSWTMIVAEIPYSAAKNGTFPEIFAIENAHRSPKVSLYVTSALMQIAMLLVY
GADC_SHIFL      WTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIITG
GADC_ECOLI      WTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIITG
GADC_ECOL6      WTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIITG
GADC_ECO57      WTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIITG
CTR2_HUMAN      PAKYVVAAGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSK--TKTPIIATLSSGAVAALM--
ADIC_YERPE      TAGAVVXXXXXXXXXXXXXXWTLVAGQTAKAAADDGLFPPIFGKVNKAGTPVAGLILGVLMTIFQI--SS
YHDG_BACSU      WVAGIIDIGAVLGMTTVMLVMLYGQTRVMFAMSRDGLVPGSLSKVHPK--HKTPYVATWFFGTMSALLGS
CTR1_MOUSE      EAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRKTPVIATVTS---GAIAAVM--
PUUP_ECOLI      GGKLFQSIFLCTTFVNTLASGLASVSRLLYVMGRDNVFPERYVHPKWRTPALNVIMVG----IVALSALF
ARCD_BACSU      AGSVIMALLAILCLFGTMLGWILLGSEVPYQAAKAGDFPAFFAKTNKKGSPVIALIITNVMSQVFI----
CTR2_CHICK      ----------------------------------------------------------------------
CTR3_MOUSE      PARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVSVTHIPIVALVSGVIAAFMAFLFEL
CTR2_PIG        PAKYVVAAGSLCALSTSLLGSMFPLPRILFAMARDGLLFRFLARVSKRQSPVAALTAGVISAVMAFLFDL
CTR2_DANRE      ----------------------------------------------------------------------
CTR2_XENLA      VAKYIVAVGSLCALTTSLLGSMFPMPRILFAMARDGLLFQPLSRVSSRQSPVIAIVSGVVAALMAFLFNL
AAXC_CHLPN      WGEVLMNVGLIIAVLSSWLSWTIIVAEIPFSAAKNGTFPEIFTIENKEKSPSVSLYITSSVMQLAMLLVY
CTR1_RAT        EAKYAVAVGSLCALSTSPLGSMFPMPRVIYAMAEDGLLFKFLAKINDR--TKTPIIATVTSGAIAAVM--
CTR3_RAT        PARYLVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARVNGTHTPIVAVVSGVIAAFMAFLFEL
CTR2_RAT        PAKYVVAAGSLCALSTSLLGSMFPLPRILFAMARDGLLFRFLARVSKRQSPVAAMTAGVISAVMAFLFDL
AAXC_CHLTB      WGEVLMNTGLLIAVLTSWLSWTILASEIPYAAAKNGTFPECFAIENSKHAPSFSLFMTSGLMQITMLLVY
AAXC_CHLT2      WGEVLMNTGLLIAVLTSWLSWTILASEIPYAAAKNGTFPECFAIENSKHAPSFSLFMTSGLMQITMLLVY
POTE_HAEIN      TVGKVIMGLMVMSCFGSLLGWQFTIAQVFKSSAEEGYFPAFFKKITSKDAPVVGMITITALQTLLSLMTI
CTR2_MOUSE      ----------------------------------------------------------------------
FRLA_ECOLI      ALGSTAGFVAITAILGSLSSCVMYQPRLEYAMAKDNLFFKCFGHVHPKNTPDVSIILGIFFIFVSDLTSL
ADIC_SHIFL      TAGAIVSFXXXXXXXXXXXXWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLI------IVGILMTI
ADIC_ECOLI      TAGAIVSFXXXXXXXXXXXXWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLI------IVGILMTI
ADIC_ECOL6      TAGAIVSFXXXXXXXXXXXXWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLI------IVGILMTI
ADIC_ECO57      TAGAIVSFXXXXXXXXXXXXWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLI------IVGILMTI
Y2001_MYCBO     ----------------------------------------------------------------------
Y1979_MYCTU     ----------------------------------------------------------------------
Y1691_LEGPH     WMTSVIAVLIILGGLSGVSAWIIGPTKGLLVSARDGSLPALFSRVNKYGSPVAILLTGVIFTVLSTVFIL
FRLA_ECO57      ALGSTAGFVAITAILGSLSSCVMYQPRLEYAMAKDNLFFKCFGHVHPKNTPDVSIILGIFFIFVSDLTSL
CTR1_HUMAN      GAKYXXXXXXXXXXXXXXXXXMFPMPRVIYAMAEDGLLFKFLANVNRTKTPIIATLAS---GAVAAVM--
ADIC_SALTY      TAGAIVSFXXXXXXXXXXXXWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLL------IVGVLMTI
ADIC_SALTI      TAGAIVSFXXXXXXXXXXXXWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLL------IVGVLMTI
AAXC_CHLTR      ----------------------------------------------------------------------
AAXC_CHLTA      ----------------------------------------------------------------------
STET_BACSU      AATMLFGSIIIVSIFGCLNGKVLSFPRVSFAMAERKQLPFA-EKLSHVHPSFRTWIAISFQIALALIMML
YECA_BACSU      ----------------------------------------------------------------------
LAT2_PONAB      -MAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHKRCTPIPALL----FTCISTLLML
LAT2_HUMAN      -MAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHKRCTPIPALL----FTCISTLLML
LYSI_CORGL      ----------------------------------------------------------------------
CTR3_HUMAN      PARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIGTRTPIIATVVSGIIAAFMAFLFKL
YLAT1_HUMAN     ----------------------------------------------------------------------
AAXC_CHLCV      STAGVLGMLVGRWGEILMNVGXXXVAEIPYTAATNGTFPEIFAIENAQHSPKLSLYITSALMQITMLFVY
Y389_CLOPE      ----IMNLGVIIAILSSWLIWTVMLSELPFAAAQSGTFPKIFAKENKNESPSFSLLASTIIMQIILILVH
Y377_CLOP1      ----IMNLGVIIAILSSWLIWTVMLSELPFAAAQSGTFPKIFAKENKNESPSFSLLASTIIMQIILILVH
YLAT2_HUMAN     ----------------------------------------------------------------------
BAT1_MOUSE      ----------------------------------------------------------------------
AAXC_CHLMU      WGEVLMNTGLLIAVLTSWLSWTILTAEIPYAAAKNGTFPECFAIENAKHSPAFSLFITSGLMQITMLLVY
YLAT2_XENLA     ----------------------------------------------------------------------
YLAT1_RAT       ----------------------------------------------------------------------
YLAT1_MOUSE     ----------------------------------------------------------------------
BAT1_RAT        ----------------------------------------------------------------------
ARCD_SHIFL      ----------------------------------------------------------------------
ARCD_ECOLI      ----------------------------------------------------------------------
ARCD_ECOL6      ----------------------------------------------------------------------
AAXC_CHLFF      ----------------------------------------------------------------------
Y609_METJA      IGA-------LFSISSAMNATIYGGANVAYSLAKDGELPEFFERKSTEGLYITSAL-GVLFALL------
POLG_FCVC6      VSSGLPSGMPLTSVINSLNHCLYVGCAILQSLEARN----------------------------------


                         .         .         .         .         *         .         .:420
query           FSPDTVFLFLVNSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMA
GABP_BACSU      FSPDTVFLFLVNSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMA
GABP_ECOLI      YAPAKVFKFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSE-IRLRMWLYPWLTWLVIGFITFVLVVML
YTNA_BACSU      XXPAKVFTWVTSIATFGAIWTWAIILLSQIKYRKSLKPEEKKQLKYKMPLFPFTSYVSLAFLAFVVILMA
HUTM_BACSU      VAPGTVYVVMVAIAGFAGVVVWMSIALSQLLFRKRFLKKGGDVLTFRTPLYPLMPIAALLLCSASCIGLA
YBGF_BACSU      FAPDTVYVVLVSISGFAVVVVWMGIAASQFMFRKRYIEAGNKVLKYRTPLYPFVPIAAFLLCLASVVGIA
AROP_CORGL      WNPAGLLDFLLNAVGGCLIVVWAMITLSQLKLRKELQ-ANDEISTVRMWAHPWXXXXXXXXXXXXXXXXX
ROCC_BACSU      MAAETVYLWCISISGMVTVVAWMSICASQFFFRRRFEGGNVNDLEFRTPLYPLVPILGFCLYGCVLISLI
YBXG_BACSU      IAPPKIFVYVYSASVLPGMIPWFIILISHIGFR-KAKGAALDKHPFKMPFAPFTNYLTIAFLLMVLVGMW
LYSP_ECOLI      FGNQTVYLWLLNTSGMTGFIAWLGIAISHYRFRR------------------------------------
MMUP_ECOLI      VAPDTVFVALSAISGFAVVAVWLSICASHFVFRRRQGKALSELHYRAPWLVPVLGFVLCLVAC---VGLA
ANSP_ECOLI      LVPSRVFEIVLNFASLGIIASWAFIIVCQMRLRKAIKEGKAADVSFKLPGAPXXXXXXXXXXXXXXXXMA
YIFK_ECOLI      INPQRVFVYVYSASVLPGMVPWFVILISQLRFR-RAHKAAIASHPFRSILFPWANYVTMAFLICVLIGMY
ANSP_SALTY      LVPSRVFEIVLNFASLGIIASWAFIMVCQMRLRQAIKEGKAADVSFKLPGAPXXXXXXXXXXXXXXXXMA
CYCA_ECOLI      VNPSVIFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSI-YKMPLGKLMCWVCMAXXXXXXXLLT
CYCA_ECO57      VNPSVIFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSI-YKMPLGKLMCWVCMAXXXXXXXLLT
ANSP2_MYCTU     XKPSQAFEIVLHIAATGVIAAWATIVACQLRLHRMANAGQLQRPKFRMPLSPFSGYLTLAFLAGVLILMY
ANSP2_MYCBO     XKPSQAFEIVLHIAATGVIAAWATIVACQLRLHRMANAGQLQRPKFRMPLSPFSGYLTLAFLAGVLILMY
YIFK_SALTY      INPQRVFVYVYSASVLPGMVPWFVILISQLRFRRAHKEAIADH-PFRSIMFPWANYLTMAFLVCVLIGMY
YIFK_SALTI      INPQRVFVYVYSASVLPGMVPWFVILISQLRFRRAHKEAIADH-PFRSIMFPWANYLTMAFLVCVLIGMY
AROP_ECOL6      LAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQG-VVTRFPALLYPLGNWICLLFMAAVLVIML
AROP_SHIFL      LAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQG-VVTRFPALLYPLGNWICLLFMAAVLVIML
AROP_ECOLI      LAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQG-VVTRFPALLYPLGNWICLLFMAAVLVIML
ROCE_BACSU      AQAETVYMVLLSLAGMSAQVGWITISLSQIMFRRKYEGGKIEDLKFKTPLYPVLPLIGLTLNTVVLISLA
AROP_SALTY      LAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKT-RFPALFYPFGNVLCLLFMAAVLIIML
AROP_SALTI      LAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKT-RFPALFYPFGNVLCLLFMAAVLIIML
AROP_ECO57      LAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQG-VVTRFPALLYPLGNWICLLFMAVVLVIML
ANSP1_MYCTU     FKPGEAFEIVLNMSALGIIAGWATIVLCQLRLHKLANAGIMQRPRFRMPFSPYSGY--------------
ANSP1_MYCBO     FKPGEAFEIVLNMSALGIIAGWATIVLCQLRLHKLANAGIMQRPRFRMPFSPYSGY--------------
PHEP_ECOLI      LLPQKAFGXXXXXXXXXXXXNWIMICLAHLRFRAAMRRQGRET-QFKALLYPFGNYLCIAFLGMILLLMC
AAPA_BACSU      LMPEQVFTLITSVSTICFIFIWGITVICHLKYR-KTRQHEAKANKFKMPFYPLSNYXXXXXXXXXXXXXX
PROY_SALTY      IMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKV---PGGVVTTIAGLIFLVFIIA
PROY_ECOLI      IMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKV----------------------
PROY_ECOL6      IMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKV----------------------
PROY_ECO57      IMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKV----------------------
ANSP_STRCO      LVPSKAFEIVLNVASLGIISTWVIIMICHLVFVRRARAGLVERPGFRLPGSPVTEIVTILAVVGLMWNDE
YDGF_BACSU      IMPEGVFTLITSISTVCFIYIWGITVICHMKYRKELAKTN----KFKLPLYPFTNYLIXXXXXXXXXXXX
YVBW_BACSU      FAGSQTFNYLMGSLGYTVLFIWLIIGFAHLKSRK--QQTETPAYYVK-W-FPYTTWFXXXXXXXXXXGVI
LYP1_YEAST      XXXXXXXXXXINISTLAGLCAWLFISLAHIRFMQALKHISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQG
CAN1_YEAST      TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQG
CAN1_CANAL      SQGNKAFTWLLNITATAGLISWGFISVSHIRFMKTLQRISRDTLPFKAFFMPFSAYYGMV-VCFIVV---
MEU22_SCHPO     GVGGALFGWLLSICGLSTTFIWGSICLAHIQFRR--------AWKIQNRKLEDLPYRSIFGVYGSIYGVA
ALP1_YEAST      AGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKISRDDLPYKAQMMPFLAYYASFFIALIVLIQG
TAT2_YEAST      GSMSEVFNWLMAIAGLATCIVWLSINLSHIRFR-------------------------------------
YI26_SCHPO      GDSDTVFDWLLAISGISNFFSWGSINLCHIVFRLAMKK--------------------------------
YCUB_SCHPO      STGAVAYGYIINLAGVSAFIVWTAIIFVHFRFRRGWVKQGLSDLPFKSPLYPF-----------------
AGP3_YEAST      VGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAAQGRSIEELPYEALFYPWTPVLSLAA---------
YCV4_SCHPO      SSSATIFGYFSSAVTVFGTINWINILLSYICYHRAVQQIPTERIPFRSWGQPYIAYASLI----------
YI0B_SCHPO      DKSDTVFNWLLALSGLSNFFTWGSICLCHIIFRLAFKK--------------------------------
ISP5_SCHPO      AQSDTVFDWLLSISNLATLFVWLSINVSYIIYRLAFKK--------------------------------
BAP2_YEAST      SKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK---------------------------------
YHE1_SCHPO      GQYDTVFDWMLSISGLGTLFCWGSICLAHIRYRAAMKHQN-RSLKEVGFVSPFASYYAFILVCLVLAAEF
PUT4_YEAST      SSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGYDRLPFKTWGQPYTVWFSLIVIGIITITNG
INDA1_TRIAT     ATGPVVFDWLLAISGLAALFTWGSVCLAHIRFRK------------------------------------
YQD2_SCHPO      -QAGKTWGFLLNVIAVSNQISWIFIAVSSLRFRKALRQGKTHRLYFPNWTYPVGPYI-IILLNGVFLFLQ
GNP1_YEAST      KKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMK---------------------------------
AGP1_SACBA      PKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMK---------------------------------
PUT4_SCHPO      ASAAVVFNWFCNLSTISGFLAWICVLVAYLQFRKAMILNN------------------------------
HIP1_YEAST      DKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMK---------------------------------
PUTX_EMENI      XXGQTVFYWFTNITTVGGFINWVLIGIAYLRFRKALQFHGMDMLPFKTPLQPYGTYYVMFIISILTLTNG
GAP1_YEAST      KKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKAL----------------------------------
YH83_SCHPO      GNSDTVFDWLLAISGLSNFFTWGSICLSHIMFRLAFKK--------------------------------
YH81_SCHPO      DKSDTVFDWLLAISGLSSFFTWGSICLSHIMFRLAFKK--------------------------------
VAL1_YEAST      DAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAK--------------------------------
AGP2_YEAST      SNSAVVLNWLINLITASQLINFVVLCIVYLFFRRHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQG
AGP1_YEAST      PKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMK---------------------------------
AGP1_YEAS7      PKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMK---------------------------------
YCGH_BACSU      XXPKNIYEHMTTAAGLMLLYTWLFILFSSKKL------TDPEGMGKTQ------IYLAMVLIAAAVSGTL
DIP5_YEAST      SGSAKIFNYFVNVVSMFGILSWITILI-------------------------------------------
BAP3_YEAST      PQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMK---------------------------------
AAP1_SCHPO      PDGSVVFDWLMSVSGGGAFVIWGLSFIDHIRLRMKAQKIPDTVLPYKFPGSVYLSYINFLALCALVYISI
SAM3_YEAST      KKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALK---------------------------------
MMP1_YEAST      KNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMK---------------------------------
SSY1_YEAST      QTAIENFDVLANVSSASTSIIWMGLNLSALKQRKDIISRNDSSYPYKS---PFQPYLAIYGLVGCSLFVI
YBEC_BACSU      ---SFIFLFLFRGWGVLAEIISVATLISYI----------------------------------------
YPEV_LACDL      ----------------------------------------------------------------------
AAXC_CHLAB      FSTD-AWNTMLSITGVMVLPAYFASAAFLVKFSKNKKYPNKGPIK-------------------------
GADC_SHIFL      GGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKLKRTIPGGKGVKL----------VVAIVGLLTSMA
GADC_ECOLI      GGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKLKRTIPGGKGVKL----------VVAIVGLLTSMA
GADC_ECOL6      GGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKLKRTIPGGKGVKL----------VVAIVGLLTSMA
GADC_ECO57      GGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKLKRTIPGGKGVKL----------VVAIVGLLTSMA
CTR2_HUMAN      -----AFLFLVDMMSIGTLMAYSLVAACVLILR-------------------------------------
ADIC_YERPE      ISPNAAKEFLVSSVSVIFTLVPYLYTCSAL----------------------------------------
YHDG_BACSU      LVPLDELAKLVNIG---TLSAFVLISVAVIVLRKK-QPDLPRAFKCPG--VPVIPGLAILFCLFLILNLG
CTR1_MOUSE      -----AFLFLVDLMSIGTLLAYSLVAACVLVLRYQPEQPN------------------------------
PUUP_ECOLI      F--DLVTATALINFGALVAFTFVNLSVNHFWRRKGMNKSWKD--HFHYLLMPLVGALTV----GVL--WV
ARCD_BACSU      ----------------------------------------------------------------------
CTR2_CHICK      ----------------------------------------------------------------------
CTR3_MOUSE      --TDLVDLMSIGT-----LLAHSLVSICVLILR-------------------------------------
CTR2_PIG        KA-------LVDMMSIGTLLAYSLVAACVLILR-------------------------------------
CTR2_DANRE      ----------------------------------------------------------------------
CTR2_XENLA      KA-------LVDMMSIGTLLAYTLVSTCVLLLR-------------------------------------
AAXC_CHLPN      FS-SNAWNTMLSITGVMVLPAYLASAAFLFKLSK--SKTYPKKGSIKAPL------AMITGILGVVYSLW
CTR1_RAT        -----AFLFLVDLMSIGTLLAYSLVAACVLVLRYQPEQPN------------------------------
CTR3_RAT        --TDLVDLMSIGT-----LLAYSLVSICVLILR-------------------------------------
CTR2_RAT        KA-------LVDMMSIGTLMAYSLVAACVLILR-------------------------------------
AAXC_CHLTB      FS-SNAWNTMLEITGVMVLPAY------------------------------------------------
AAXC_CHLT2      FS-SNAWNTMLEITGVMVLPAY------------------------------------------------
POTE_HAEIN      SSLNKQFNVLVDLAVVTNVIPYL-LSMAALAVLLKAENVAPQKYKTTVF----------VAFIGSLYSIY
CTR2_MOUSE      ----------------------------------------------------------------------
FRLA_ECOLI      LGYFTLVMCFKNT-----------LTFGSIIWCRKRDDYKP------LWRTPAFGLMTTLAIASILVAST
ADIC_SHIFL      FSPNATKEFLVSSVSVIFTLV-------------------------------------------------
ADIC_ECOLI      FSPNATKEFLVSSVSVIFTLV-------------------------------------------------
ADIC_ECOL6      FSPNATKEFLVSSVSVIFTLV-------------------------------------------------
ADIC_ECO57      FSPNATKEFLVSSVSVIFTLV-------------------------------------------------
Y2001_MYCBO     ----------------------------------------------------------------------
Y1979_MYCTU     ----------------------------------------------------------------------
Y1691_LEGPH     LSINAAYWVLSDLSAQMALLVYIMMFAAAIKLR-------------------------------------
FRLA_ECO57      LGYFTLVMCFKNT-----------LTFGSIIWCRKRDDYKP------LWRTPAFGLMTPLAIASILVAST
CTR1_HUMAN      -----AFLFLVDLMSIGTLLAYSLVAACVLVLRYQPEQPN------------------------------
ADIC_SALTY      FSPNAAKEFLVSSVSVIFTLV-------------------------------------------------
ADIC_SALTI      FSPNAAKEFLVSSVSVIFTLV-------------------------------------------------
AAXC_CHLTR      ----------------------------------------------------------------------
AAXC_CHLTA      ----------------------------------------------------------------------
STET_BACSU      ISPDK-----LSEISIFMIYIFYVMAFFAVFILRKRAKGEKRAYSVP--LYPFMPILAIAGSFFVLGSTL
YECA_BACSU      ----------------------------------------------------------------------
LAT2_PONAB      VTSD--MYTLINYVGFINYLFYGVTVAGQIVLRWK-KPDIPRPIKINL-LFPII-YLLFWAFLLVLWSEP
LAT2_HUMAN      VTSD--MYTLINYVGFINYLFYGVTVAGQIVLRWK-KPDIPRPIKINL-LFPII-YLLFWAFLLVLWSEP
LYSI_CORGL      ----------------------------------------------------------------------
CTR3_HUMAN      --TDLVDLMSIGT-----LLAYSLVSICVLILR-------------------------------------
YLAT1_HUMAN     ----------------------------------------------------------------------
AAXC_CHLCV      FSTN-AWNTMLSITGVMVLPAYLASAAFLFQFSK--NKKYPNKGPVKSYIAKYTGFFAVIYSLWLIYAGG
Y389_CLOPE      FA-GNAWNMMLSITSVMALPCYLVSTLYLFKITYKNENYPTD-------IFAKRKYAMITAILGSIYGVW
Y377_CLOP1      FA-GNAWNMMLSITSVMALPCYLVSTLYLFKITYKNENYPTD-------IFAKRKYAMITAILGSIYGVW
YLAT2_HUMAN     ----------------------------------------------------------------------
BAT1_MOUSE      ----------------------------------------------------------------------
AAXC_CHLMU      FS--------------------------------------------------------------------
YLAT2_XENLA     ----------------------------------------------------------------------
YLAT1_RAT       ----------------------------------------------------------------------
YLAT1_MOUSE     ----------------------------------------------------------------------
BAT1_RAT        ----------------------------------------------------------------------
ARCD_SHIFL      ----------------------------------------------------------------------
ARCD_ECOLI      ----------------------------------------------------------------------
ARCD_ECOL6      ----------------------------------------------------------------------
AAXC_CHLFF      ----------------------------------------------------------------------
Y609_METJA      FNMEGV----ASITSAVFMVIYLFVILS------------------------------------------
POLG_FCVC6      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FIDSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAANPVTQQQPDILP
GABP_BACSU      FIDSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAANPVTQQQPDILP
GABP_ECOLI      FRPAQQLEVISTGLLAGIICTVPIMARWKKL------------------
YTNA_BACSU      YSPDTRVAVII-GPIWFLILLA---------------------------
HUTM_BACSU      F-DPNQRIALFCGV--PCIILCYLIYHKRNVTK---AKKISQEE-----
YBGF_BACSU      FDPNQRIALYCGVPFMAICYAIYYV--KNRKSQPAA-------------
AROP_CORGL      XXXXSRSQVYSVAIVYGLVLLSFV-------------------------
ROCC_BACSU      FIPDQRIGLYCGVPIIIFCYAYYHLSIKKRINHETIEKKQTEAQ-----
YBXG_BACSU      FNDDTRISLIVGVIFLALVVISYYVF---GIGKRTQANLTKSEQ-----
LYSP_ECOLI      -------------------------------------------------
MMUP_ECOLI      FDPAQR-------------------------------------------
ANSP_ECOLI      FDYPNGTYTIAALPIIGILLVIGWFGVRKRVAEIHSTAPVVEEDEE---
YIFK_ECOLI      FNEDTRMSLFVGIIFMLAVTAIYKVF-----------------------
ANSP_SALTY      FDYPNGTYTIASLPLIAILLVAGWFGVRRRVAEIHRTAPVT--------
CYCA_ECOLI      LEDDTRQALLVTPLWFIALGLGWLFIGKKRAAE----------------
CYCA_ECO57      LEDDTRQALLVTPLWFIALGLGWLFIGKKRAAE----------------
ANSP2_MYCTU     F-DEQHGPWMIAATVIGV-------------------------------
ANSP2_MYCBO     F-DEQHGPWMIAATVIGV-------------------------------
YIFK_SALTY      FNEDTRMSLFVGVIFLLAVTLVYKVF-----------------------
YIFK_SALTI      FNEDTRMSLFVGVIFLLAVTLVYKVF-----------------------
AROP_ECOL6      MTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKA--------------
AROP_SHIFL      MTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKA--------------
AROP_ECOLI      MTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKA--------------
ROCE_BACSU      F-DPEQRIALYCGVPFMIIIIYHVVIKKRQQANR---------------
AROP_SALTY      MTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKA--------------
AROP_SALTI      MTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKA--------------
AROP_ECO57      MTPGMAISVYLIPVWLVVLGIGYLFKEKTAKAVKA--------------
ANSP1_MYCTU     -------------------------------------------------
ANSP1_MYCBO     -------------------------------------------------
PHEP_ECOLI      TMDDMRLSAILLPVWIVFLFMAFKTLRRK--------------------
AAPA_BACSU      XXNDTRIALFVTPVWFVLLIILYKVQTRR--------------------
PROY_SALTY      LIGYHPDTSLYVGFAWIVLLLIGWIFKRRRDRQLAQA------------
PROY_ECOLI      -------------------------------------------------
PROY_ECOL6      -------------------------------------------------
PROY_ECO57      -------------------------------------------------
ANSP_STRCO      EVG--RKTVLLVPVIAVMLVAGWFGVRRRVAHQAGQERPAPRE------
YDGF_BACSU      XXQDTRVSLFVTPVWFILLIVIYKV-RKAK-------------------
YVBW_BACSU      ----MTTSIVITGITAAIYLVAYLV------------------------
LYP1_YEAST      F------------------------------------------------
CAN1_YEAST      F------------------------------------------------
CAN1_CANAL      -------------------------------------------------
MEU22_SCHPO     -------------------------------------------------
ALP1_YEAST      F------------------------------------------------
TAT2_YEAST      -------------------------------------------------
YI26_SCHPO      -------------------------------------------------
YCUB_SCHPO      -------------------------------------------------
AGP3_YEAST      -------------------------------------------------
YCV4_SCHPO      -------------------------------------------------
YI0B_SCHPO      -------------------------------------------------
ISP5_SCHPO      -------------------------------------------------
BAP2_YEAST      -------------------------------------------------
YHE1_SCHPO      YV-----------------------------------------------
PUT4_YEAST      Y------------------------------------------------
INDA1_TRIAT     -------------------------------------------------
YQD2_SCHPO      GYKSLRLSLFVSPIVLGLYLI-WKIYKKTKLVSSSEAD-----------
GNP1_YEAST      -------------------------------------------------
AGP1_SACBA      -------------------------------------------------
PUT4_SCHPO      -------------------------------------------------
HIP1_YEAST      -------------------------------------------------
PUTX_EMENI      Y------AVFFPGRFTASFLVSYIVF-----------------------
GAP1_YEAST      -------------------------------------------------
YH83_SCHPO      -------------------------------------------------
YH81_SCHPO      -------------------------------------------------
VAL1_YEAST      -------------------------------------------------
AGP2_YEAST      Y------------------------------------------------
AGP1_YEAST      -------------------------------------------------
AGP1_YEAS7      -------------------------------------------------
YCGH_BACSU      FEKSSRPGFFVSIGFLVIIAIVTMIYQKKQGHKDRPASP----------
DIP5_YEAST      -------------------------------------------------
BAP3_YEAST      -------------------------------------------------
AAP1_SCHPO      F------------------------------------------------
SAM3_YEAST      -------------------------------------------------
MMP1_YEAST      -------------------------------------------------
SSY1_YEAST      FM-----------------------------------------------
YBEC_BACSU      -------------------------------------------------
YPEV_LACDL      -------------------------------------------------
AAXC_CHLAB      -------------------------------------------------
GADC_SHIFL      FIVS---------------------------------------------
GADC_ECOLI      FIVS---------------------------------------------
GADC_ECOL6      FIVS---------------------------------------------
GADC_ECO57      FIVS---------------------------------------------
CTR2_HUMAN      -------------------------------------------------
ADIC_YERPE      -------------------------------------------------
YHDG_BACSU      WVTIVR---FLVWLLIGLV-IYFLYSRK---------------------
CTR1_MOUSE      -------------------------------------------------
PUUP_ECOLI      NLESTSLTLGLVWASLGGAYLWYLIRRYRKV------------------
ARCD_BACSU      -------------------------------------------------
CTR2_CHICK      -------------------------------------------------
CTR3_MOUSE      -------------------------------------------------
CTR2_PIG        -------------------------------------------------
CTR2_DANRE      -------------------------------------------------
CTR2_XENLA      -------------------------------------------------
AAXC_CHLPN      LI-----------------------------------------------
CTR1_RAT        -------------------------------------------------
CTR3_RAT        -------------------------------------------------
CTR2_RAT        -------------------------------------------------
AAXC_CHLTB      -------------------------------------------------
AAXC_CHLT2      -------------------------------------------------
POTE_HAEIN      ALYAAGEQAMLYGSIVTFI------------------------------
CTR2_MOUSE      -------------------------------------------------
FRLA_ECOLI      FVWAPIPGLICAVIVIATGLPAYAFWAKR--------------------
ADIC_SHIFL      -------------------------------------------------
ADIC_ECOLI      -------------------------------------------------
ADIC_ECOL6      -------------------------------------------------
ADIC_ECO57      -------------------------------------------------
Y2001_MYCBO     -------------------------------------------------
Y1979_MYCTU     -------------------------------------------------
Y1691_LEGPH     -------------------------------------------------
FRLA_ECO57      FVWAPIPGLICAVIVIATGLPAYAFWAKR--------------------
CTR1_HUMAN      -------------------------------------------------
ADIC_SALTY      -------------------------------------------------
ADIC_SALTI      -------------------------------------------------
AAXC_CHLTR      -------------------------------------------------
AAXC_CHLTA      -------------------------------------------------
STET_BACSU      ITDTMSCGLSILIGLAGLPV--YYGMKKRKAS-----------------
YECA_BACSU      -------------------------------------------------
LAT2_PONAB      VVCGIGLAIMLTGV-----------------------------------
LAT2_HUMAN      VVCGIGLAIMLTGV-----------------------------------
LYSI_CORGL      -------------------------------------------------
CTR3_HUMAN      -------------------------------------------------
YLAT1_HUMAN     -------------------------------------------------
AAXC_CHLCV      L-----NYLLMSVILLALGIPFYIDAGKKSKREK---------------
Y389_CLOPE      LIYAAGINYMLIAIVIYALGIPVFIKARRETS-----------------
Y377_CLOP1      LIYAAGINYMLIAIVIYALGIPVFIKARRETS-----------------
YLAT2_HUMAN     -------------------------------------------------
BAT1_MOUSE      -------------------------------------------------
AAXC_CHLMU      -------------------------------------------------
YLAT2_XENLA     -------------------------------------------------
YLAT1_RAT       -------------------------------------------------
YLAT1_MOUSE     -------------------------------------------------
BAT1_RAT        -------------------------------------------------
ARCD_SHIFL      -------------------------------------------------
ARCD_ECOLI      -------------------------------------------------
ARCD_ECOL6      -------------------------------------------------
AAXC_CHLFF      -------------------------------------------------
Y609_METJA      -------------------------------------------------
POLG_FCVC6      -------------------------------------------------