[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB12645.1

[Show Plain Result]


## Summary of Sequence Search
    1::407
    1::407       0.0 100%  407 aa  YFJB_BACSU RecName: Full=Uncharacterized protein yfjB;
   27::121     9e-04  39%  557 aa  SBSN_BOVIN RecName: Full=Suprabasin;Flags: Precursor;
    1::407

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSGNIAVDPDKLEQLANDVVTELTDMENKYKDLHVELGQMILQCDPRYSSCFSGVGDAWSSGKALVTKLS
YFJB_BACSU      MSGNIAVDPDKLEQLANDVVTELTDMENKYKDLHVELGQMILQCDPRYSSCFSGVGDAWSSGKALVTKLS
SBSN_BOVIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DNEIFIRKTGDKFVEQDDILRKLYNAYDKYGTMTSLTALMLTQGKYYGLGLTKFVKQPSGLHTAQHSKLL
YFJB_BACSU      DNEIFIRKTGDKFVEQDDILRKLYNAYDKYGTMTSLTALMLTQGKYYGLGLTKFVKQPSGLHTAQHSKLL
SBSN_BOVIN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDISRAVDSSRYQKAARVLLNPKYLLKKTNRPFSDLVHKKFTKYFPQDTVDFSNSVRSYTKGFLNEAGVR
YFJB_BACSU      LDISRAVDSSRYQKAARVLLNPKYLLKKTNRPFSDLVHKKFTKYFPQDTVDFSNSVRSYTKGFLNEAGVR
SBSN_BOVIN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           STLKDVGKTGLRFAKGNAITATLITGATETFGAGVKIAENYAKYQDKPEVLKRENAKAVGNAVNNXXXXX
YFJB_BACSU      STLKDVGKTGLRFAKGNAITATLITGATETFGAGVKIAENYAKYQDKPEVLKRENAKAVGNAVNNXXXXX
SBSN_BOVIN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXXXXXXXXPVGTVLLGAAGSYIGGVVGEQIAKYTAGFAEKAALKLKEPIHAVVDTAKKGL
YFJB_BACSU      XXXXXXXXXXXXXXXXXXPVGTVLLGAAGSYIGGVVGEQIAKYTAGFAEKAALKLKEPIHAVVDTAKKGL
SBSN_BOVIN      --------------------------------------------------------DPIEKVIEGINRGL


                         .         .         .         .         *         .         .:420
query           ESAGKVVKSVNDGIDAANKSIHKGIDSAKKGMEKAKKTADSLIHGATHFLKGKFSFG
YFJB_BACSU      ESAGKVVKSVNDGIDAANKSIHKGIDSAKKGMEKAKKTADSLIHGATHFLKGKFSFG
SBSN_BOVIN      SSAGKALEGINNGINQAGKELEKGVQGLNRGLDKVAKEAEKLAHGVNH---------