[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB13009.1

[Show Plain Result]


## Summary of Sequence Search
    1::218
    1::218     e-114 100%  218 aa  MECA1_BACSU RecName: Full=Adapter protein mecA 1;
    1::223     2e-60  55%  227 aa  MECA1_BACAN RecName: Full=Adapter protein mecA 1;
    1::223     4e-60  54%  227 aa  MECA1_BACCR RecName: Full=Adapter protein mecA 1;
    1::214     1e-49  48%  217 aa  MECA_BACPF RecName: Full=Adapter protein mecA;
    1::208     5e-48  48%  212 aa  MECA2_BACHD RecName: Full=Adapter protein mecA 2;
    1::217     9e-46  46%  217 aa  MECA_LISW6 RecName: Full=Adapter protein mecA;
    1::217     3e-45  46%  217 aa  MECA_LISMO RecName: Full=Adapter protein mecA;
    1::217     6e-45  46%  217 aa  MECA_LISMF RecName: Full=Adapter protein mecA;
    1::217     6e-45  46%  217 aa  MECA_LISMC RecName: Full=Adapter protein mecA;
    1::217     1e-44  45%  217 aa  MECA_LISIN RecName: Full=Adapter protein mecA;
    1::222     2e-40  42%  222 aa  MECA_LYSSC RecName: Full=Adapter protein mecA;
    1::206     4e-36  41%  208 aa  MECA_EXIS2 RecName: Full=Adapter protein mecA;
    1::218     4e-34  36%  220 aa  MECA_MACCJ RecName: Full=Adapter protein mecA;
    1::218     6e-33  41%  218 aa  MECA_EXISA RecName: Full=Adapter protein mecA;
    1::234     7e-30  35%  239 aa  MECA_STAAC RecName: Full=Adapter protein mecA;
    1::234     9e-30  35%  239 aa  MECA_STAA9 RecName: Full=Adapter protein mecA;
    1::234     9e-30  35%  239 aa  MECA_STAA2 RecName: Full=Adapter protein mecA;
    1::234     1e-29  35%  239 aa  MECA_STAAW RecName: Full=Adapter protein mecA;
    1::234     1e-29  35%  239 aa  MECA_STAAS RecName: Full=Adapter protein mecA;
    1::234     1e-29  35%  239 aa  MECA_STAAR RecName: Full=Adapter protein mecA;
    1::234     1e-29  35%  239 aa  MECA_STAAN RecName: Full=Adapter protein mecA;
    1::234     1e-29  35%  239 aa  MECA_STAAM RecName: Full=Adapter protein mecA;
    1::234     1e-29  36%  239 aa  MECA_STAAB RecName: Full=Adapter protein mecA;
    1::234     1e-29  35%  239 aa  MECA_STAA1 RecName: Full=Adapter protein mecA;
    1::234     2e-29  35%  239 aa  MECA_STAAT RecName: Full=Adapter protein mecA;
    1::234     2e-29  35%  239 aa  MECA_STAAE RecName: Full=Adapter protein mecA;
    1::234     2e-29  35%  239 aa  MECA_STAA8 RecName: Full=Adapter protein mecA;
    1::234     2e-29  35%  239 aa  MECA_STAA3 RecName: Full=Adapter protein mecA;
    1::232     2e-28  39%  238 aa  MECA_STACT RecName: Full=Adapter protein mecA;
    1::235     7e-27  31%  240 aa  MECA_STAES RecName: Full=Adapter protein mecA;
    1::235     7e-27  31%  240 aa  MECA_STAEQ RecName: Full=Adapter protein mecA;
    1::235     1e-24  31%  240 aa  MECA_STAHJ RecName: Full=Adapter protein mecA;
    1::233     3e-23  38%  238 aa  MECA_STAS1 RecName: Full=Adapter protein mecA;
    1::191     8e-23  35%  192 aa  MECA_OCEIH RecName: Full=Adapter protein mecA;
    1::227     9e-22  29%  228 aa  MECA_LACC3 RecName: Full=Adapter protein mecA;
    1::227     2e-21  28%  228 aa  MECA_LACCB RecName: Full=Adapter protein mecA;
    1::195     2e-20  34%  202 aa  MECA2_BACAN RecName: Full=Adapter protein mecA 2;
    1::195     5e-20  31%  202 aa  MECA2_BACCR RecName: Full=Adapter protein mecA 2;
    1::196     2e-19  31%  201 aa  MECA1_BACHD RecName: Full=Adapter protein mecA 1;
    1::222     8e-18  25%  223 aa  MECA_LACRJ RecName: Full=Adapter protein mecA;
    1::222     8e-18  25%  223 aa  MECA_LACRD RecName: Full=Adapter protein mecA;
    1::235     1e-17  29%  235 aa  MECA_LEUMM RecName: Full=Adapter protein mecA;
    1::194     3e-16  27%  194 aa  MECA2_BACSU RecName: Full=Adapter protein mecA 2;
    1::237     1e-15  29%  241 aa  MECA_LACBA RecName: Full=Adapter protein mecA;
    1::239     2e-15  27%  242 aa  MECA_STRGC RecName: Full=Adapter protein mecA;
    1::227     8e-15  26%  229 aa  MECA_LACSS RecName: Full=Adapter protein mecA;
    1::218     7e-14  28%  220 aa  MECA_ENTFA RecName: Full=Adapter protein mecA;
    1::240     3e-13  29%  241 aa  MECA_PEDPA RecName: Full=Adapter protein mecA;
    1::242     3e-13  27%  243 aa  MECA_LACPL RecName: Full=Adapter protein mecA;
    1::244     7e-13  25%  249 aa  MECA_STRTD RecName: Full=Adapter protein mecA;
    1::244     2e-12  25%  249 aa  MECA_STRT2 RecName: Full=Adapter protein mecA;
    1::232     5e-12  24%  233 aa  MECA_LACLA RecName: Full=Adapter protein mecA;
    1::244     6e-12  24%  249 aa  MECA_STRT1 RecName: Full=Adapter protein mecA;
    1::246     8e-12  26%  250 aa  MECA_STRSV RecName: Full=Adapter protein mecA;
    1::243     1e-11  29%  245 aa  MECA_STRZT RecName: Full=Adapter protein mecA;
    1::243     1e-11  29%  245 aa  MECA_STRZP RecName: Full=Adapter protein mecA;
    1::243     1e-11  29%  245 aa  MECA_STRZJ RecName: Full=Adapter protein mecA;
    1::243     1e-11  29%  245 aa  MECA_STRPI RecName: Full=Adapter protein mecA;
    1::243     3e-11  29%  245 aa  MECA_STRPJ RecName: Full=Adapter protein mecA;
    1::243     3e-11  29%  245 aa  MECA_STRP7 RecName: Full=Adapter protein mecA;
    1::243     3e-11  29%  245 aa  MECA_STRP4 RecName: Full=Adapter protein mecA;
    1::243     4e-11  29%  245 aa  MECA_STRR6 RecName: Full=Adapter protein mecA;
    1::243     4e-11  29%  245 aa  MECA_STRPN RecName: Full=Adapter protein mecA;
    1::243     4e-11  29%  245 aa  MECA_STRP2 RecName: Full=Adapter protein mecA;
    1::170     9e-11  27%  253 aa  MECA_STRPZ RecName: Full=Adapter protein mecA;
    1::170     9e-11  27%  253 aa  MECA_STRPG RecName: Full=Adapter protein mecA;
    1::170     9e-11  27%  253 aa  MECA_STRP8 RecName: Full=Adapter protein mecA;
    1::170     9e-11  27%  253 aa  MECA_STRP1 RecName: Full=Adapter protein mecA;
    1::170     3e-10  27%  253 aa  MECA_STRP6 RecName: Full=Adapter protein mecA;
    1::170     3e-10  27%  253 aa  MECA_STRP3 RecName: Full=Adapter protein mecA;
    1::248     2e-09  25%  252 aa  MECA_STRU0 RecName: Full=Adapter protein mecA;
    1::237     5e-09  25%  240 aa  MECA_STRMU RecName: Full=Adapter protein mecA;
    1::83      2e-08  31%  251 aa  MECA_STRA5 RecName: Full=Adapter protein mecA;
    1::83      2e-08  31%  251 aa  MECA_STRA3 RecName: Full=Adapter protein mecA;
    1::83      2e-08  31%  251 aa  MECA_STRA1 RecName: Full=Adapter protein mecA;
    1::218

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWXXXXXXXXXXXXXXXGPLWIQVQALDKG
MECA1_BACSU     MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWXXXXXXXXXXXXXXXGPLWIQVQALDKG
MECA1_BACAN     MDIERINDHTMKFFITYIDIEDRGFNREEIWYDRERSEELFWEMMDEARDHDDFFIDGPLWIQVQAVDKG
MECA1_BACCR     MDIERINDHTMKFFITYIDIEDRGFNREEIWYDRERSEELFWEMMDEARDHDDFFIDGPLWIQVQAVDKG
MECA_BACPF      MDIERVNDTTIKFFITYKDIEDRGFDRDEIWYNRERGEELFFEMMNEANDRDEFELDGPLWIQVHALDKG
MECA2_BACHD     MEIERINDSTVKFFITYKDIESRGFDRDEIWYNRERGEELFFEMMNEANDREDFELEGPLWIQVHALEKG
MECA_LISW6      MEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWDMMDELKYEEEFSPEGPLWIQVQALKHG
MECA_LISMO      MEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWDMMDELKYEEEFSPEGPLWIQVQALKHG
MECA_LISMF      MEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWDMMDELKYEEEFSPEGPLWIQVQALKHG
MECA_LISMC      MEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWDMMDELKYEEEFSPEGPLWIQVQALKHG
MECA_LISIN      MEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWDMMDELKYEEEFSPEGPLWIQVQALKHG
MECA_LYSSC      MDIERVNENTLKLFITYNDIEDRGYSREEIWYNRAKGEQLFWDMIDEVNTEDYFDVEGPIWIHINASEVG
MECA_EXIS2      MKIERVNDNTVKFFITYTDIERRGFARDEIWYNRERGEQLFWQMMDEANEKESISFEGPLWIQVQAFEKG
MECA_MACCJ      MRIERVNESTLKFYLTYTDIEARGFKRDDLWTSRKKGEEFFWSVMEEVNQEEDFFFDGPLWIQVHAFDKG
MECA_EXISA      MKIERINDNTVKFFITYVDIEKRGFARDEIWYNRERGEQLFWQMMDEAHEREDISFDGPLWIQVQAFEKG
MECA_STAAC      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFDKG
MECA_STAA9      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAA2      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAW      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAS      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAR      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAN      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAM      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAB      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAA1      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAT      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAAE      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAA8      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAA3      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STACT      MRIERVDDTTVKLFITYGDIESRGFKREDLWTNRQRGEEFFWSMMXXXXXXXXXXXXGPLWIQVHAFEKG
MECA_STAES      MRIERVDDTTVKLFITYSDIEARGFSREDLWSNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAEQ      MRIERVDDTTVKLFITYSDIEARGFSREDLWSNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAHJ      MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKG
MECA_STAS1      MRIERVDDTTVKLFITYSDIEARGFKREDLWTNRKRGXXXXXXXXXXXXXXXXXXXXGPLWIQVHAFEKG
MECA_OCEIH      MRIERVSTDQFKIFLTFDDLIERGFTREDLWHDASNVRSLFSDMMYEASSELGIELEGMLLVQVHLMQQG
MECA_LACC3      MEMERINANTIRVMLGNDDLAQRGITVLDLLGNHKQIESFFYSILDEVDKDHTFATNEAVTFQVMPSQSG
MECA_LACCB      MEMERINANTIRVMLGNDDLAQRGITVLDLLGNHKQIESFFYSILDEVDKDHTFATNEAVTFQVMPSQSG
MECA2_BACAN     MRLERLNYNKIKIFLTFDDLSERGLTKEDLWRNAPKVQQLFRDMMQEANKELGFEADGPIAVEVFSLQQG
MECA2_BACCR     MRLERLNYNKIKIFLTFDDLSERGLTKEDLWRNAPKVQQLFRDMMQEANKELGFEADGPIAVEVFSLQQG
MECA1_BACHD     MRLERLAVNKIKVFLTFDDLKERGITKDELWQDIPKVHDLFRDMMLEADDELGFKADGPIAVEVFALPQG
MECA_LACRJ      MEMERINENTIRVLVDNDDLSARGITILDLLGDHQQIEDFFYSILKEVDTDHQFQNNDAVTFQVMPTNNG
MECA_LACRD      MEMERINENTIRVLVDNDDLSARGITILDLLGDHQQIEDFFYSILKEVDTDHQFQNNDAVTFQVMPTNNG
MECA_LEUMM      MEKERINENTIRVMIDNSDLKDRGITVMELLGNHEKIESFFYNILSEVDTEHDFEDDDQVSFQILPNRNG
MECA2_BACSU     MRLERLNYNKIKIFXXXXXXXXXXXXKEDLWKDSFKVHQLFKDMMNEANTELGFEANGPIAVEVYSLQQG
MECA_LACBA      MEMERINENTIRVVIGNDDLTERGITVLDLLGNHKQIEGFFYSILEEVDVDHQFQDNDAVTFQVLPNRNG
MECA_STRGC      MEVKQISESTIKITIKLEDLEEHGMEMADFLVPQEKTEEFFYTILDELEMPESFLDSGMLSFRVTPKPDK
MECA_LACSS      MRMEKIDENTIRVLLENDDLEERGITGLDLLSNHKKIERFFYSILEEVDQDHVFANNDAVTFQVLPNEQG
MECA_ENTFA      MEMEHINENTIRVLIGNEDLADRGITFLDLLGNHKDVENFFYSILEEVDVEDEFQGSEAVTFQVLPKNDG
MECA_PEDPA      MEMERINDDTIRVTISSDDLNERGVTFLDLLDNHKEIESFFYSVLEEVDTDHQFASNDAVTFQVLPNRNG
MECA_LACPL      MEMERINEDTIRVVIGNDDLNERGIRVLDLLGNHKQIESFFYSILEEVDVDHQFQDNDAVTFQVLPNRNG
MECA_STRTD      MEMKQISETTLKIMITMEDLEEHGMELKDFLIPQEKTEEFFYTVMDELDLPDNFKNSGMLSFRVTPRKDR
MECA_STRT2      MEMKQINETTLKIMITMEDLEEHGMELKDFLIPQEKTEEFFYTVMDELDLPDNFKNSGMLSFRVTPRKDR
MECA_LACLA      MKYEDINENTIKITLSFDDLTDYDIKLSDFFGNQEVIEQFFYELVDELGLENRFGNVGMLTFQIQPFPQG
MECA_STRT1      MEMKQINETTLKIMITMEDLEEHGMELKDFLIPQEKTEEFFYTVMDELDLPDNFKNSGMLSFRVTPRKDR
MECA_STRSV      MEMKQISDSTIKITIQLEDLEKRGMEMADFLVPQEKTEEFFYTILDELEMPDNFLDSGMLSFRVTPKPDK
MECA_STRZT      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRZP      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRZJ      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRPI      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRPJ      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRP7      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRP4      MKMKQISDTTLKITMSLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRR6      MKMKQISDTTLKITISLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRPN      MKMKQISDTTLKITISLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRP2      MKMKQISDTTLKITISLEDLMDRGMEIADFLVPQEKTEEFFYAILDELEMPDSFLDTGMLSFRVTPKPDK
MECA_STRPZ      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRPG      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRP8      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRP1      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRP6      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRP3      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRU0      MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYTVMDELDLPDNFKDSGMLSFRVTPRKDR
MECA_STRMU      MEMKQISETTLKITISMEDLEERGMELKDFLIPQEKTEEFFYTVMDELDLPENFKDSGMLSFRVTPRNDR
MECA_STRA5      MEMKQISETTLKITISMEDLEDRGMELKDFLIPQEKTEEFFYSVMDELDLPENFKNSGMLSFRVTPKKDR
MECA_STRA3      MEMKQISETTLKITISMEDLEDRGMELKDFLIPQEKTEEFFYSVMDELDLPENFKNSGMLSFRVTPKKDR
MECA_STRA1      MEMKQISETTLKITISMEDLEDRGMELKDFLIPQEKTEEFFYSVMDELDLPENFKNSGMLSFRVTPKKDR


                         .         .         *         .         .         .         .:140
query           LEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVI
MECA1_BACSU     LEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVI
MECA1_BACAN     IEVLVTKAELSKDGQKLELPIGVDKIIDPLDEGIESLFXXXXXXXXAGTNFNEDGTFGFLIKFNDFEDVI
MECA1_BACCR     IEVLVTKAELSKDGQKLELPIGVDKIIDPLDEGIESLFXXXXXXXXXXTNFNEDGTFGFLIKFNDFEDVI
MECA_BACPF      LEIVVTRGQVSDGNVKLEIPVSQDK--ENTDENIDLMTGHSSEDDEGIDTDQ----LEIVIGFNDFEDII
MECA2_BACHD     LEIVVTRGQISDGNVKLEIPVTQEDGDGQGQESSMMTEDDF-----------LEESLEIVIGFADFEDIV
MECA_LISW6      LEVFVTKATIGEDGFDVTLSSPDXXXXXXXXXXXXXNFNPVKKESLG-----EDDTLEFILEFRDFEDVI
MECA_LISMO      LEVFVTKATIGEDGFDVTLSSPDXXXXXXXXXXXXXNFNPVKKEALG-----EDDTLEFILEFRDFEDAI
MECA_LISMF      LEVFVTKATIGEDGFDVTLSSPDXXXXXXXXXXXXXNFNPVKKEALG-----DDDTLEFILEFRDFEDAI
MECA_LISMC      LEVFVTKATIGEDGFDVTLSSPDXXXXXXXXXXXXXNFNPVKKEALG-----DDDTLEFILEFRDFEDAI
MECA_LISIN      LEVFVTKATIGEDGFDVTLSSPDXXXXXXXXXXXXXNFNPVKKESLG-----EDDTLEFILEFRDFEDLI
MECA_LYSSC      LEIIVTRAHILKDGETLDGHSNFDEHKEPFDEVGDDLLSQL---TQFGDMDESELFMDYVYKFKDIDELI
MECA_EXIS2      LEVTVTIAKTTIDGEQVD------------EDELDSLLRSAMSDAE---EKETELSQDVLFETTDFEHII
MECA_MACCJ      IEVVVTKSKND------DLQLPEDDSDLNIDEKVNDFINDSELRDLLMRASEESTEQFFIVHFDDLEDVI
MECA_EXISA      LEVTVTIAKNVMDGSLLRSAIDEARDQQSVXXXXXXXXXXXXXXXXXXXXXXXTN---------DFEAII
MECA_STAAC      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAA9      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIVVKFNDLEDVI
MECA_STAA2      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIVVKFNDLEDVI
MECA_STAAW      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAS      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAR      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAN      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAM      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAB      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAA1      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAT      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAAE      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAA8      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STAA3      VEVTISKSK-NEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQIIVKFNDLEDVI
MECA_STACT      VEVVISKSKXXXXXXXXXXXXXXXXXRQ-LNELLEQSFEDENEESVQGNQQQRRSHASVIVKFEDLESVI
MECA_STAES      VEVTISKSK-NEDAMNMS----DDDTNHQFDDQVNELLAQTLEGEESLEDHKPSNVRNIIVKFDDLEQVI
MECA_STAEQ      VEVTISKSK-NEDAMNMS----DDDTNHQFDDQVNELLAQTLEGEESLEDHKPSNVRNIIVKFDDLEQVI
MECA_STAHJ      VEVTISK---SKNEEAMNMSDEDANEQXXSIEDLRAXXXXXXXXXXXXXXXXRPNIRTVIVKFDDLEQVI
MECA_STAS1      VEVTISKSKSDEDNEQLDYQV-NDLLSQTFDQD-DSLEDLFXXXXXXXXXXXXXXXXTVIVKFNDLEEVI
MECA_OCEIH      MHIFVTQ------------------QYEDNSEDEDYI-------EMKVTLDESKE---LIFSFMDFEDII
MECA_LACC3      LELLISKSGQKNDDSAADQTDDEGTDTQVPDQQLQGLDASDQQDHQAVDEADKAPQTELVLKLKDFEDFI
MECA_LACCB      LELLISRSGQKNDDSAADQTDDEGTDTQVPDQQLQGLDASDQQDHQAVDEADKAPQTELVLKLKDFEDFI
MECA2_BACAN     MVVIVTK--------------------EHQEADTD---DEFRDEEMQVTLDESE---HILYEFATLDDVI
MECA2_BACCR     MVVIVTKENQEMDTD-------------------DEFRDEFIEMQVTLDESE-----HILYEFATLDDVI
MECA1_BACHD     MVIIVTKGHQESDF------------------DEDGLEDGYIEMQVTLDESD-----EVFYEFADIEDVI
MECA_LACRJ      LELFISKNDSNFAGNEQHGPINDQVSKYIKQHLIQKNSPDQDQRKTAINDSE-DNEIQHVITFDSFEDLI
MECA_LACRD      LELFISKNDSNFAGNEQHGPINDQVSKYIKQHLIQKNSPDQDQRKTAINDSE-DNEIQHVITFDSFEDLI
MECA_LEUMM      LELFISRLDEENKISDILDNITNFSSKQPAN--IDNISD---KRRQELRQQENFENTQVILALSDFENAI
MECA2_BACSU     MVVIVTKNQXXXXXXXXXXXXXIEM------------------------QVKLDESADIIYQFHSFEDII
MECA_LACBA      LELFISKADESQGDASVDSEHP-DQVSDQIKEHLDNQKDFFSGFKSAANEDSGQPTTTRVVKLHSFEDMI
MECA_STRGC      LDVFVTKSKVDKNEDLADLPDMDELSQEKSRDDIDAMLEKAEEEDTSEPEEGQEQDIYYILRFSDLKNLI
MECA_LACSS      LELLI-----SKNLSNLDLNKAQSEMVQGKDGITEYIKDQLLKRDTALNQADNPTK-QVVLGFDTFEDWI
MECA_ENTFA      LELFISKNVAMDDLSSLELSEVNADVSELIRKQIXXXXXXXXXXXXXXXXXXTNRNVIFEL--DNFEAMI
MECA_PEDPA      LELYISKNPT--DGME-EAIKSVSKDNAPSNGEMDEV-SDFLKRKLAANGVGSTQKS--VIELEDFESLP
MECA_LACPL      LELFISK---NSDNLQDTIAKATXXXXXXXXXXXXXXXXXYLKRQTDTNQVEDGQGIEYVLKFDQFEDLV
MECA_STRTD      VDVFVTKSDLKEDLDFNDLSDMEDYSGLSPEEFLKALEDNFEPAKEVAEETIREDYTHYVLAFSDFDQVV
MECA_STRT2      VDVFVTKSDLKEALDFNDLSDMEDYSGLSPEEFLKALEDNFEPAKEVAEETIREDYTHYVLAFSDFDQVV
MECA_LACLA      VHMIVEEAMLXXXXXXXXXXXXXXXLMTGFYNKLNEIGADMARERPGTKKDEAEQEPDFIYYSIRYEDIM
MECA_STRT1      VDVFVNKSDLKEALDFNDLSDMEDYSGLSPEEFLKALEDNFEPAKEVAEETIREDYTHYVLAFSDFDQVV
MECA_STRSV      VDVFVTKSKLDKDMDELSHMSPDEFLKEKSKEDIEAVLETAEAEEREQSAENAERYIYYILRFEDIKAAA
MECA_STRZT      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRZP      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRZJ      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRPI      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRPJ      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRP7      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRP4      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRR6      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRPN      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRP2      VDVFVTK---SKIDQNLDF---EDLSDLPDMEELAQMSDEFIKTEKSIADKTKDDYIYYILSFAKLADLV
MECA_STRPZ      LDVFVTKSEINKDINLEDLAEFGDMSQ-MTPEDFFKSLEQSMREKGDVKAHEKLEKIEEIM-----EDVV
MECA_STRPG      LDVFVTKSEINKDINLEDLAEFGDMSQ-MTPEDFFKSLEQSMREKGDVKAHEKLEKIEEIM-----EDVV
MECA_STRP8      LDVFVTKSEINKDINLEDLAEFGDMSQ-MTPEDFFKSLEQSMREKGDVKAHEKLEKIEEIM-----EDVV
MECA_STRP1      LDVFVTKSEINKDINLEDLAEFGDMSQ-MTPEDFFKSLEQSMREKGDVKAHEKLEKIEEIM-----EDVV
MECA_STRP6      LDVFVTKSEINKDINLEDLAEFGDMSQ-MTPEDFFKSLEQSMREKGDVKAHEKLEQIEEIM-----EDVV
MECA_STRP3      LDVFVTKSEINKDINLEDLAEFGDMSQ-MTPEDFFKSLEQSMREKGDVKAHEKLEQIEEIM-----EDVV
MECA_STRU0      LDVFVTKSDLNKEINFDDLADLGDVSQ-MTPEDFFKTIEKSMIEKGDVNAHXXXDYVHYVLDFMTIQDAI
MECA_STRMU      IDVFVTKSEINKNLNLEDLSDFDDSKMSP--EDFFNTLEETMREKGDAAALDKXDYVHFVLDFPNIQQVI
MECA_STRA5      IDVFVTKSELSKD---------------------------------------------------------
MECA_STRA3      IDVFVTKSELSKD---------------------------------------------------------
MECA_STRA1      IDVFVTKSELSKD---------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALE
MECA1_BACSU     SLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALE
MECA1_BACAN     SLSRLIFEDIKDELYSFEDRYYVYVEFDEVDEEEIDRILSIVLEYGEESTLTIHRVSEYGKQIVKEHALE
MECA1_BACCR     SLSRLIFEDIKDELYSFEDRYYVYVEFDEVDEEEIDRILSIILEYGEESTLTIHRVSEYGKQIVKEHALE
MECA_BACPF      SLSNFFIDDLENELYHFEGRYYLHVLFXXXXXXXXXXMLSQMLEYGYETDLSIHRMQEYGKEIIGEYALK
MECA2_BACHD     DLSNFFIDDINNTLVHFEGTYYLHVVFNDETEDEQDDMLSQMLEYGYESDLSIYRIMEYGKVIIDSNALT
MECA_LISW6      SLSRTGLENLLTKLYSYQGKYYLNVEFPNKYDENIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALQ
MECA_LISMO      SLSRTGLENLVTKLYSYQGKYYLNVEFPNKYDENIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALK
MECA_LISMF      SLSRTGLENLVTKLYSYQGKYYLNVEFPNKYDENIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALK
MECA_LISMC      SLSRTGLENLVTKLYSYQGKYYLNVEFPNKYDENIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALK
MECA_LISIN      SLSRTGLENLVTKLYSYQGKYYLNVEFPNKYDENIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALK
MECA_LYSSC      PVAKMTDELVDSSLFKYENWYYLVVDFGN-ADEELHDRNAVIKEFLTPSNFTIHRLEEYGEKIMEFNCFE
MECA_EXIS2      ALSQYAFEEVKTSLYQKDGLYLLHLHFXXXXXXXXXNVMSLIAEYLNFSEQTIHPVAEYGKVIVPNDVFA
MECA_MACCJ      QFSYHNYEDIEDLLXXXXXXXXXXVEFDHMSEDAIHSYIAHLLEYANETQISHEQLDEYGKIVMSHNVKR
MECA_EXISA      SLSKRTFSDLDLKLYHYQDRYYLWIDFXXXXXXXXXNALSLLAEYLTFSTQTQPMLEEYGKLILDGDVFA
MECA_STAAC      NYSNPITTEFEDLLYMVDGTYYYAVYFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAA9      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAA2      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAW      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAS      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAR      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAN      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAM      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAB      NYA-YHTNPITTLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAA1      NYSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAT      NYSNPITTEFEDLLYMVDGTYYYAVYFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAAE      NYSNPITTEFEDLLYMVDGTYYYAVYFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAA8      NYSNPITTEFEDLLYMVDGTYYYAVYFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STAA3      NYSNPITTEFEDLLYMVDGTYYYAVYFDSHVDQEVINSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTA
MECA_STACT      DYSNQPTDDFEDLLYMLNNEYYYAIHFDDNVGEEVINDFSQLLEFTQPSDRSEMYLNDYAKIIMSHNVTA
MECA_STAES      DYNNQNTDEFEDLLYMIDNKYYYSIHFDDSVSQEINDSYSQLLEFAYPTDKTNIYLNDYAKIIMSHNVTS
MECA_STAEQ      DYNNQNTDEFEDLLYMIDNKYYYSIHFDDSVSQEINDSYSQLLEFAYPTDKTNIYLNDYAKIIMSHNVTS
MECA_STAHJ      SYANLSTDEFEDLLYMNDNKYYYAIHFDSVSQEMINDSYSQMLEFAYPTDKTEVYLNDYAKIIMSHNVTA
MECA_STAS1      EYAHYNTDEFEDLLYSLNNVYYYAVHYDETVDQEINDSYSQLLEFAYPTDKSEVYLNDYAKIIMSHNVAS
MECA_OCEIH      SVSYLDPMGLENILYYMEDRYYMILDHIELSRVDKEDIIGVMSEYANPSIVTSHRIEEYGKLIMEENTVQ
MECA_LACC3      SLADLRLEGGKSDLYRYKNAYYLVLTFYEISSDEAHDQMAVAMEFGDRSPLSSAVLSEYGKRLMETSALE
MECA_LACCB      SLADLRLEGGKSDLYRYKNAYYLVLTFYEISSDEAHDQMAVAMEFGDRSPLSSAVLSEYGKRLMETSALE
MECA2_BACAN     NLSNLDVTGGK--LYTWDGRFYLWMEEEEQIQLLKADFIAILAEYGNPSTATIYRLMEYGKELMASQAIE
MECA2_BACCR     NLSNLGVTGGK--LYTWDERFYLWVEEEEQIQLLKADFIAILAEYGNPSTATIYRIMEYGKELMDVNAIE
MECA1_BACHD     SLVPRLVTLGMTTLYSYQGRYYISFTDLDLDGIDEESLIALLAEYGYPSTISTYRVAEYGSLIIANDACI
MECA_LACRJ      DFAKIAESDDVSSLYKYNDLYYLAIAYSDLNSNDVKDQLALAYEYGNPTATTVDFLSEHGKKIMSVSALH
MECA_LACRD      DFAKIAESDDVSSLYKYNDLYYLAIAYSDLNSNDVKDQLALAYEYGNPTATTVDFLSEHGKKIMSVSALH
MECA_LEUMM      AIANLKIENLVSDLYLYEGAYYLLVPDHSVSQEQLKNELAIALEFSRISHVTHEVLHEHGQLILKHEALE
MECA2_BACSU     QLSRIGITGG--TVYHYDGQYFLSLE--DLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVE
MECA_LACBA      SLARLRLENAASNLYRYQDAYYLLVFFVNESSREIKDELAVAYEYAERTKVAPDVLAEHGQLIMDNSALE
MECA_STRGC      AFTKVDYPVDTSELYKMDQRYYLLVDIEGRPSRYPAWLLAAMREHAEDTDTTRALLQEHGHLLIVTDAVQ
MECA_LACSS      ALAQLHIESGVSNLFVYKHQYYAQLVFFNTTETFVQDDLAVANEFGHKTNYTADFLSEYGQRVMENSALE
MECA_ENTFA      QLSKVFMQSVLTNLYTYNDRYYLQVLF--LTDENVDNEIAQILEFAHKTTVTQDTLVEYGTCIMERSALE
MECA_PEDPA      SIAELTNSGIESVLYRYHDIYYLELTFFTSENETIKNDLAIAYEYGNSTIVSSEVLREHGEVVMDGAALE
MECA_LACPL      SLAQLRPEGLASNLFKYRDQYYLELVFFQSSTATIKDDVAVALEYAHLANISADVLLEHGEKIMSNAALE
MECA_STRTD      TFAQKNVSVEGSEFYKLGDVYYMTIYLADEPDYYANNMYARFLEYANVADRTRPYLQEHATILMEEDALP
MECA_STRT2      TFAQKNVSVEGSEFYKLGDVYYMTIYLADEPDYYANNMYARFLEYANVADRTRPYLQEHATILMEEDALP
MECA_LACLA      SIKNVKFADEESEFYRYDGNFYLVV-LDNQKEKHVESTRSRMMEYGEATKMSREFLQEYGECLIATRALD
MECA_STRT1      TFAQKNVSVEGSEFYKLGDVYYMTIYLADEPDYYANNMYARFLEYANVADRTRPYLQEHATILMEEDALP
MECA_STRSV      AFAQVDYKIDLSELYKYDSAYYLLVDVEGFPERYPAWLLAKMREFADDSDITRAVLQEHGHLLLVTDAVS
MECA_STRZT      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRZP      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRZJ      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRPI      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRPJ      VFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRP7      VFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRP4      VFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRR6      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRPN      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRP2      AFAKTVTFEMETSLYKMNERYYLLVDIENHPSPYPAWLLARMREFADDSDISRSVLQEYGQVLMSHDAVL
MECA_STRPZ      EATLANQSEAADPSTNHESEPLDYVDFSTITE--------------------------------------
MECA_STRPG      EATLANQSEAADPSTNHESEPLDYVDFSTITE--------------------------------------
MECA_STRP8      EATLANQSEAADPSTNHESEPLDYVDFSTITE--------------------------------------
MECA_STRP1      EATLANQSEAADPSTNHESEPLDYVDFSTITE--------------------------------------
MECA_STRP6      EATLANQSEAADPSTNHESEPLDYVDFSTITE--------------------------------------
MECA_STRP3      EATLANQSEAADPSTNHESEPLDYVDFSTITE--------------------------------------
MECA_STRU0      TFSKVTFPIEASELYKSSDRYHMTIDIQNQPSYYANVMYARLIEHALPGSKTRAYLQEHAHQLLEDHAVT
MECA_STRMU      NFAKVDYDVEASELFKESDAYHMTV-LLNLEDKPADLMFARMLEHAGRGTKTRAYLLEHGVQLIKADALQ
MECA_STRA5      ----------------------------------------------------------------------
MECA_STRA3      ----------------------------------------------------------------------
MECA_STRA1      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TIKKHFAS
MECA1_BACSU     TIKKHFAS
MECA1_BACAN     TIRNNF--
MECA1_BACCR     TIRNNF--
MECA_BACPF      HLRGHF--
MECA2_BACHD     VVREQF--
MECA_LISW6      QVRKHF--
MECA_LISMO      QIRKHF--
MECA_LISMF      QIRKHF--
MECA_LISMC      QIRKHF--
MECA_LISIN      QVRKYF--
MECA_LYSSC      TVRKYFA-
MECA_EXIS2      FIRKHF--
MECA_MACCJ      QVKQYF--
MECA_EXISA      KVRHYF--
MECA_STAAC      QVRRYF--
MECA_STAA9      QVRRYF--
MECA_STAA2      QVRRYF--
MECA_STAAW      QVRRYF--
MECA_STAAS      QVRRYF--
MECA_STAAR      QVRRYF--
MECA_STAAN      QVRRYF--
MECA_STAAM      QVRRYF--
MECA_STAAB      QVRRYF--
MECA_STAA1      QVRRYF--
MECA_STAAT      QVRRYF--
MECA_STAAE      QVRRYF--
MECA_STAA8      QVRRYF--
MECA_STAA3      QVRRYF--
MECA_STACT      QVRRFF--
MECA_STAES      QVRKYF--
MECA_STAEQ      QVRKYF--
MECA_STAHJ      QVRRYF--
MECA_STAS1      QVRRYF--
MECA_OCEIH      QIKRFF--
MECA_LACC3      TARYYF--
MECA_LACCB      TARYYF--
MECA2_BACAN     QIHNYF--
MECA2_BACCR     QIHNYF--
MECA1_BACHD     KLYQSF--
MECA_LACRJ      LIRHYF--
MECA_LACRD      LIRHYF--
MECA_LEUMM      KIKSLFS-
MECA2_BACSU     TIQTHFS-
MECA_LACBA      LTRFHF--
MECA_STRGC      HLQK----
MECA_LACSS      LTRYYF--
MECA_ENTFA      LTRYYF--
MECA_PEDPA      LAKRYF--
MECA_LACPL      TIRHYF--
MECA_STRTD      VLQ-----
MECA_STRT2      VLQ-----
MECA_LACLA      VLRK----
MECA_STRT1      VLQ-----
MECA_STRSV      GLQK----
MECA_STRZT      NLQK----
MECA_STRZP      NLQK----
MECA_STRZJ      NLQK----
MECA_STRPI      NLQK----
MECA_STRPJ      NLQK----
MECA_STRP7      NLQK----
MECA_STRP4      NLQK----
MECA_STRR6      NLQK----
MECA_STRPN      NLQK----
MECA_STRP2      NLQK----
MECA_STRPZ      --------
MECA_STRPG      --------
MECA_STRP8      --------
MECA_STRP1      --------
MECA_STRP6      --------
MECA_STRP3      --------
MECA_STRU0      ELQK----
MECA_STRMU      ELQ-----
MECA_STRA5      --------
MECA_STRA3      --------
MECA_STRA1      --------