[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB13391.1

[Show Plain Result]


## Summary of Sequence Search
    1::494
   13::494       0.0 100%  494 aa  MURE_BACSU RecName:
   13::489       0.0  84%  490 aa  MURE_BACA2 RecName:
   14::487       0.0  75%  488 aa  MURE_BACLD RecName:
   18::485     e-160  60%  491 aa  MURE_LISMO RecName:
   18::485     e-160  60%  491 aa  MURE_LISMF RecName:
   22::485     e-157  59%  491 aa  MURE_LISIN RecName:
   15::469     e-149  58%  489 aa  MURE_GEOTN RecName:
   19::490     e-148  55%  491 aa  MURE_BACAN RecName:
   19::483     e-147  55%  491 aa  MURE_BACCR RecName:
   15::487     e-138  52%  489 aa  MURE_GEOKA RecName:
   22::486     e-135  52%  493 aa  MURE_LACPL RecName:
   21::483     e-134  52%  486 aa  MURE_BACHD RecName:
   23::488     e-133  50%  493 aa  MURE1_OCEIH RecName:
   23::478     e-116  47%  494 aa  MURE_ALKMQ RecName:
   22::481     e-116  46%  482 aa  MURE1_CLOAB RecName:
   14::482     e-111  43%  482 aa  MURE_THETN RecName:
   22::484     e-109  45%  484 aa  MURE_CLOD6 RecName:
   28::483     e-109  44%  483 aa  MURE_CLOBH RecName:
   28::483     e-109  44%  483 aa  MURE_CLOB1 RecName:
   20::484     e-106  43%  489 aa  MURE_SYNWW RecName:
   15::484     e-106  43%  485 aa  MURE_CLOTE RecName:
   20::463     e-101  44%  494 aa  MURE_STAHJ RecName:
   18::477     e-100  43%  487 aa  MURE_ALKOO RecName:
   20::463     2e-97  42%  494 aa  MURE_STAES RecName:
   20::463     2e-97  42%  494 aa  MURE_STAEQ RecName:
   18::463     2e-97  42%  494 aa  MURE_STAAS RecName:
   18::463     4e-97  42%  494 aa  MURE_STAAW RecName:
   18::463     5e-97  42%  494 aa  MURE_STAAN RecName:
   18::463     5e-97  42%  494 aa  MURE_STAAM RecName:
   18::463     5e-97  42%  493 aa  MURE_STAAC RecName:
   18::463     5e-97  42%  493 aa  MURE_STAA8 RecName:
   18::463     5e-97  42%  493 aa  MURE_STAA3 RecName:
   18::463     5e-97  42%  494 aa  MURE_STAA1 RecName:
   18::463     2e-96  41%  494 aa  MURE_STAAR RecName:
   18::463     4e-96  41%  494 aa  MURE_STAAB RecName:
   18::476     2e-95  43%  485 aa  MURE_FUSNN RecName:
   15::476     2e-94  40%  484 aa  MURE_CLOPE RecName:
   23::468     2e-93  41%  482 aa  MURE_AQUAE RecName:
   13::475     3e-92  43%  486 aa  MURE_PARD8 RecName:
   22::501     1e-91  40%  509 aa  MURE_GEOSL RecName:
   20::489     1e-91  41%  489 aa  MURE_COXBU RecName:
   16::483     9e-91  41%  488 aa  MURE_HAEIG RecName:
   16::483     1e-90  41%  488 aa  MURE_HAEIE RecName:
   24::488     2e-90  43%  497 aa  MURE_THEEB RecName:
   16::483     3e-90  41%  488 aa  MURE_HAEI8 RecName:
   16::483     2e-89  40%  488 aa  MURE_HAEIN RecName:
   15::476     1e-88  40%  485 aa  MURE_BACFR RecName:
   15::476     1e-88  40%  485 aa  MURE_BACFN RecName:
   23::491     3e-88  41%  492 aa  MURE2_OCEIH RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase
   22::474     4e-88  42%  483 aa  MURE_CHLAB RecName:
   22::482     6e-87  41%  489 aa  MURE_GLOVI RecName:
   18::481     8e-87  40%  494 aa  MURE_PASMU RecName:
   22::476     1e-86  41%  484 aa  MURE_BACV8 RecName:
   24::476     2e-86  41%  485 aa  MURE_CHLFF RecName:
   14::486     2e-86  39%  486 aa  MURE_CYTH3 RecName:
   25::499     1e-85  42%  512 aa  MURE_CHLPD RecName:
   22::476     1e-85  40%  482 aa  MURE_BACTN RecName:
   21::498     1e-85  42%  500 aa  MURE_ACTP2 RecName:
   22::506     2e-85  38%  511 aa  MURE_GEOMG RecName:
   23::482     4e-84  40%  483 aa  MURE_CHLMU RecName:
   14::488     5e-84  39%  496 aa  MURE_PSEPK RecName:
   15::485     6e-84  37%  494 aa  MURE_SOLUE RecName:
   35::501     1e-83  42%  505 aa  MURE_SYNY3 RecName:
   19::493     1e-83  38%  495 aa  MURE_HAES1 RecName:
   23::482     2e-83  39%  483 aa  MURE_CHLTR RecName:
   23::482     2e-83  39%  483 aa  MURE_CHLTA RecName:
   12::493     4e-83  39%  495 aa  MURE_XYLFT RecName:
   22::495     5e-83  40%  496 aa  MURE_ANAVT RecName:
   22::482     7e-83  38%  490 aa  MURE_ALCBS RecName:
   23::477     7e-83  38%  483 aa  MURE2_CLOAB RecName:
   23::493     3e-82  41%  497 aa  MURE_SYNE7 RecName:
   22::489     8e-82  38%  493 aa  MURE_VIBVU RecName:
   22::489     2e-81  38%  493 aa  MURE_VIBVY RecName:
   36::498     2e-81  40%  508 aa  MURE_CHLTE RecName:
   27::491     1e-80  39%  495 aa  MURE_VIBCH RecName:
   33::489     7e-80  39%  493 aa  MURE_VIBPA RecName:
   12::493     6e-79  38%  495 aa  MURE_XYLFA RecName:
   12::491     6e-79  38%  493 aa  MURE_CHRVO RecName:
   22::479     1e-78  39%  483 aa  MURE_CHLCV RecName:
   22::495     5e-78  39%  496 aa  MURE_ANASP RecName:
   22::502     7e-78  38%  509 aa  MURE_PROM1 RecName:
   22::502     1e-75  37%  509 aa  MURE_PROMT RecName:
   21::502     1e-75  37%  506 aa  MURE_LEPIN RecName:
   21::502     1e-75  37%  506 aa  MURE_LEPIC RecName:
   20::480     4e-75  37%  487 aa  MURE_PORGI RecName:
   20::511     5e-75  36%  511 aa  MURE_PROMP RecName:
   22::479     7e-75  39%  482 aa  MURE_LAWIP RecName:
   12::486     1e-74  38%  495 aa  MURE_XANAC RecName:
   10::472     1e-73  37%  479 aa  MURE_RICRI RecName:
   10::472     2e-73  37%  479 aa  MURE_RICCN RecName:
   14::476     3e-73  37%  480 aa  MURE_RICPR RecName:
   12::480     6e-73  38%  509 aa  MURE_ROSS1 RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   21::496     2e-72  36%  500 aa  MURE_LEPBL RecName:
   21::496     2e-72  36%  500 aa  MURE_LEPBJ RecName:
   31::501     3e-72  37%  506 aa  MURE_STRAW RecName:
   10::472     3e-72  37%  479 aa  MURE_RICMO RecName:
   13::476     7e-72  37%  492 aa  MURE_RICTY RecName:
   11::471     9e-72  39%  488 aa  MURE_BRUSU RecName:
   21::497     2e-71  37%  501 aa  MURE_HAEDU RecName:
   11::486     3e-71  38%  490 aa  MURE_YERPE RecName:
   14::468     5e-71  38%  474 aa  MURE_RICBR RecName:
   14::479     5e-71  36%  487 aa  MURE_PSESM RecName:
   23::512     5e-71  36%  521 aa  MURE_NITEU RecName:
   28::499     6e-71  37%  508 aa  MURE_JANMA RecName:
   22::479     6e-71  37%  483 aa  MURE_CHLPN RecName:
   28::512     1e-70  38%  514 aa  MURE_RALSO RecName:
   29::509     1e-70  37%  517 aa  MURE_CORGL RecName:
   21::497     2e-70  35%  503 aa  MURE_PROMA RecName:
   39::516     4e-70  37%  526 aa  MURE_COREF RecName:
   12::491     5e-70  36%  495 aa  MURE_ERWCT RecName:
   21::483     7e-70  38%  486 aa  MURE_RHIME RecName:
   18::471     9e-70  38%  487 aa  MURE_PSEMY RecName:
   22::486     1e-69  35%  490 aa  MURE_THEMA RecName:
   34::501     1e-69  37%  506 aa  MURE_STRCO RecName:
   12::486     1e-69  36%  495 aa  MURE_XANOR RecName:
   12::486     1e-69  36%  495 aa  MURE_XANOM RecName:
   10::529     1e-69  38%  530 aa  MURE_RICFE RecName:
   23::493     6e-69  35%  499 aa  MURE_BLOFL RecName:
   16::491     3e-68  37%  495 aa  MURE_PHOLL RecName:
   26::489     4e-68  35%  492 aa  MURE_NEIMA RecName:
   21::491     1e-67  35%  495 aa  MURE_SALPA RecName:
   12::491     1e-67  35%  495 aa  MURE_ECO57 RecName:
   21::491     4e-67  35%  495 aa  MURE_SALTY RecName:
   21::491     4e-67  35%  495 aa  MURE_SALTI RecName:
   21::491     4e-67  35%  495 aa  MURE_SALCH RecName:
   12::491     7e-67  35%  495 aa  MURE_ECOL6 RecName:
   12::491     9e-67  34%  495 aa  MURE_SHIFL RecName:
   22::484     1e-66  35%  491 aa  MURE_SHEON RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   12::491     2e-66  34%  495 aa  MURE_ECOLI RecName:
   12::491     3e-66  35%  495 aa  MURE_ENT38 RecName:
   57::520     6e-66  37%  535 aa  MURE_MYCTU RecName:
   57::520     6e-66  37%  535 aa  MURE_MYCBO RecName:
   22::496     2e-65  35%  500 aa  MURE_SYNPX RecName:
   26::492     5e-65  34%  508 aa  MURE_BUCBP RecName:
   22::485     8e-65  38%  485 aa  MURE_ZYMMO RecName:
   33::488     8e-65  36%  489 aa  MURE_AGRT5 RecName:
   27::525     2e-64  34%  532 aa  MURE_TREDE RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   20::505     3e-64  35%  508 aa  MURE_BORBU RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   26::489     5e-64  33%  492 aa  MURE_NEIMB RecName:
   22::480     9e-64  37%  483 aa  MURE_MESSB RecName:
   12::488     1e-63  33%  497 aa  MURE_BUCAI RecName:
   25::495     2e-63  34%  499 aa  MURE_SYNPW RecName:
   16::481     3e-63  36%  486 aa  MURE_CAUCR RecName:
   89::454     8e-63  42%  463 aa  MURE_HELHP RecName:
   22::501     1e-62  34%  507 aa  MURE_PROMM RecName:
   14::479     3e-62  34%  487 aa  MURE_PSEAE RecName:
   11::471     9e-62  36%  488 aa  MURE_BRUME RecName:
   24::486     1e-61  34%  501 aa  MURE_ACISJ RecName:
   12::493     2e-61  30%  497 aa  MURE_BUCAP RecName: Full=Putative
   20::505     6e-61  34%  505 aa  MURE_BORAP RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   12::468     1e-60  35%  495 aa  MURE_XANCP RecName:
   12::468     1e-60  35%  495 aa  MURE_XANC8 RecName:
   40::511     2e-60  35%  520 aa  MURE_MYCPA RecName:
   40::511     5e-60  35%  520 aa  MURE_MYCA1 RecName:
   44::514     6e-60  35%  530 aa  MURE_MYCLE RecName:
   12::491     2e-59  33%  495 aa  MURE_SODGM RecName:
   22::497     1e-57  33%  503 aa  MURE_SYNS3 RecName:
   17::471     4e-57  34%  484 aa  MURE_RHILO RecName:
   15::478     4e-57  33%  490 aa  MURE_DEIRA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   20::505     4e-57  33%  508 aa  MURE_BORGA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   14::494     6e-57  32%  498 aa  MURE_ALHEH RecName:
   13::469     1e-56  35%  472 aa  MURE_ANAMM RecName:
   25::529     4e-56  33%  540 aa  MURE_TREPA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   66::436     6e-55  38%  447 aa  MURE_HELPJ RecName:
   61::430     2e-54  35%  434 aa  MURE_WOLSU RecName:
   66::436     3e-54  38%  447 aa  MURE_HELPY RecName:
   21::474     3e-53  32%  485 aa  MURE_BRAJA RecName:
   96::498     5e-52  33%  514 aa  MURE_LEIXX RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   22::516     4e-51  32%  516 aa  MURE_LACDB RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   22::516     4e-51  32%  516 aa  MURE_LACDA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   40::485     3e-50  31%  496 aa  MURE_WIGBR RecName:
   38::479     1e-49  32%  481 aa  MURE_STRTD RecName:
   38::479     1e-49  32%  481 aa  MURE_STRT2 RecName:
   38::479     1e-49  32%  481 aa  MURE_STRT1 RecName:
   21::510     2e-49  32%  510 aa  MURE_LACS1 RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   32::481     1e-48  33%  483 aa  MURE_STRMU RecName:
   32::477     7e-48  32%  481 aa  MURE_STRSY RecName:
   32::477     7e-48  32%  481 aa  MURE_STRS2 RecName:
   22::493     3e-46  32%  517 aa  MURE_LACC3 RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   80::426     9e-46  39%  427 aa  MURE_CAMJE RecName:
   21::516     4e-45  31%  516 aa  MURE_LACRD RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   37::463     2e-44  32%  481 aa  MURE_STRR6 RecName:
   37::463     2e-44  32%  481 aa  MURE_STRP2 RecName:
   37::466     3e-44  32%  481 aa  MURE_STRSV RecName:
   22::514     1e-43  31%  523 aa  MURE_LACAC RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   37::463     1e-43  32%  481 aa  MURE_STRPN RecName:
   38::461     4e-43  30%  481 aa  MURE_STRPF RecName:
   38::461     7e-43  30%  481 aa  MURE_STRPG RecName:
   38::461     7e-43  30%  481 aa  MURE_STRPD RecName:
   38::461     7e-43  30%  481 aa  MURE_STRPC RecName:
   38::461     7e-43  30%  481 aa  MURE_STRP8 RecName:
   38::461     7e-43  30%  481 aa  MURE_STRP6 RecName:
   38::461     7e-43  30%  481 aa  MURE_STRP1 RecName:
   38::461     1e-42  30%  481 aa  MURE_STRP3 RecName:
   38::461     2e-42  30%  481 aa  MURE_STRPM RecName:
   39::508     2e-42  32%  508 aa  MURE_ENTFA RecName:
   22::510     6e-42  31%  513 aa  MURE_LACSS RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   26::485     1e-40  30%  509 aa  MURE_TROW8 RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   26::485     3e-40  29%  509 aa  MURE_TROWT RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   29::437     6e-36  28%  484 aa  MURE_STRA3 RecName:
   29::437     6e-36  28%  484 aa  MURE_STRA1 RecName:
   29::437     8e-36  28%  484 aa  MURE_STRA5 RecName:
   29::463     9e-32  29%  483 aa  MURE_LACLS RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   29::463     1e-31  29%  483 aa  MURE_LACLM RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   29::463     2e-28  28%  483 aa  MURE_LACLA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   30::505     2e-28  28%  517 aa  MURE_BIFLO RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   30::364     4e-25  28%  460 aa  MURF_BUCBP RecName:
   89::355     1e-24  34%  454 aa  MURC_AQUAE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   81::438     1e-22  30%  449 aa  MURC_DESHY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::442     9e-22  31%  458 aa  MURC_GEOUR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   35::447     1e-21  29%  460 aa  MURC_ALKMQ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::354     2e-21  31%  456 aa  MURC_DESAH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   22::442     3e-21  29%  464 aa  MURC_DICTD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::446     4e-21  32%  458 aa  MURC_CLOB6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     6e-21  33%  437 aa  MURC_STACT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::446     6e-21  30%  457 aa  MURC_CLOP1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   21::358     7e-21  29%  452 aa  MURF_ECOLI RecName:
  114::446     7e-21  31%  458 aa  MURC_CLOBL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::446     1e-20  30%  458 aa  MURC_CLOBH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::446     1e-20  30%  458 aa  MURC_CLOB1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   25::339     2e-20  33%  434 aa  MURC_GEOTN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::446     2e-20  28%  457 aa  MURC_CLOPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::446     2e-20  28%  457 aa  MURC_CLOPE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   25::389     2e-20  26%  449 aa  MURF_RICCN RecName: Full=Probable
  114::446     2e-20  30%  458 aa  MURC_CLOBK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::360     3e-20  29%  459 aa  MURC_CLOB8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   80::368     4e-20  29%  463 aa  MURD_IDILO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::438     5e-20  31%  455 aa  MURC_CALS8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::446     1e-19  29%  458 aa  MURC_CLOBM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::446     1e-19  31%  458 aa  MURC_CLOBJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   25::389     1e-19  24%  449 aa  MURF_RICMO RecName: Full=Probable
   43::450     1e-19  31%  469 aa  MURC_CLOTH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   21::318     2e-19  29%  457 aa  MURF_HAEIN RecName:
   28::339     2e-19  33%  437 aa  MURC_STAAW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAA9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAA8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAA3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAA2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAA1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::344     2e-19  31%  456 aa  MURC_DESAA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-19  33%  437 aa  MURC_STAAR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   93::328     2e-19  34%  432 aa  MURC_BACLD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   26::339     3e-19  33%  433 aa  MURC_GEOSW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   25::339     4e-19  33%  434 aa  MURC_GEOKA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   53::328     4e-19  30%  433 aa  MURC_BACHD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  111::364     5e-19  29%  481 aa  MURC_RHORT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   17::360     7e-19  24%  449 aa  MURF_RICPR RecName: Full=Probable
  109::440     7e-19  29%  454 aa  MURC_SULSY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::364     9e-19  33%  491 aa  MURC_PARL1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::443     1e-18  28%  451 aa  MURC_FRATM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   25::339     1e-18  32%  432 aa  MURC_BACP2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  115::361     1e-18  28%  465 aa  MURC_ALKOO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::342     2e-18  31%  436 aa  MURC_PEDPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::443     2e-18  27%  451 aa  MURC_FRATH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::443     2e-18  27%  451 aa  MURC_FRATF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::361     2e-18  31%  459 aa  MURC_EUBE2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  113::358     2e-18  31%  456 aa  MURC_CLOTE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   77::339     2e-18  34%  433 aa  MURC_ANOFW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  112::446     3e-18  28%  460 aa  MURC_THETN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::423     3e-18  31%  450 aa  MURD_BACCR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::443     3e-18  27%  451 aa  MURC_FRATT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::443     3e-18  27%  451 aa  MURC_FRAT1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   25::339     3e-18  32%  432 aa  MURC_BACSU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   73::315     4e-18  33%  441 aa  MURD_ZYMMO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     4e-18  30%  450 aa  MURD_BACC4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   93::438     4e-18  30%  438 aa  MURC_OCEIH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::362     4e-18  31%  465 aa  MURC_MESSB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     4e-18  29%  447 aa  MURC_LISW6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     4e-18  29%  447 aa  MURC_LISMO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::443     4e-18  27%  451 aa  MURC_FRATW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   94::315     6e-18  33%  449 aa  MURD_STAAW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAA9 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAA8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAA3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAA2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::315     6e-18  33%  449 aa  MURD_STAA1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   28::339     6e-18  30%  447 aa  MURC_LISMF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     6e-18  30%  447 aa  MURC_LISMC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     6e-18  31%  447 aa  MURC_LISIN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::423     8e-18  29%  450 aa  MURD_BACHK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     8e-18  29%  450 aa  MURD_BACC3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     8e-18  30%  450 aa  MURD_BACC2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     8e-18  29%  450 aa  MURD_BACAH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   28::339     8e-18  30%  437 aa  MURC_STAHJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::452     8e-18  29%  468 aa  MURC_OCHA4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::344     8e-18  27%  445 aa  MURC_ENTFA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   99::368     1e-17  29%  474 aa  MURC_WOLWR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   68::371     1e-17  26%  474 aa  MURC_HYPNA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::363     1e-17  32%  475 aa  MURC_BARQU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::423     2e-17  29%  450 aa  MURD_BACCZ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     2e-17  29%  450 aa  MURD_BACC0 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     2e-17  29%  450 aa  MURD_BACAN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     2e-17  29%  450 aa  MURD_BACAC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     2e-17  29%  450 aa  MURD_BACAA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  111::444     2e-17  26%  468 aa  MURC_MOOTA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-17  29%  447 aa  MURC_LISMH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-17  31%  437 aa  MURC_STAES RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::339     2e-17  31%  437 aa  MURC_STAEQ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   24::286     3e-17  28%  455 aa  MURF_BUCAI RecName:
   30::315     3e-17  32%  451 aa  MURD_STRA5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   30::315     3e-17  32%  451 aa  MURD_STRA1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     3e-17  30%  450 aa  MURD_BACCQ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::443     3e-17  26%  451 aa  MURC_FRATN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::450     3e-17  29%  464 aa  MURC_CHRVO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   87::352     4e-17  29%  449 aa  MURD_STAHJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     4e-17  29%  450 aa  MURD_BACWK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::423     4e-17  30%  450 aa  MURD_BACC1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  175::343     4e-17  32%  450 aa  MURC_UNCTG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   57::441     5e-17  28%  459 aa  MURC_PERMH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   62::442     5e-17  28%  458 aa  MURC_GEOSF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::362     6e-17  29%  471 aa  MURC_RHIEC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::451     6e-17  30%  467 aa  MURC_POLSJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::451     6e-17  33%  467 aa  MURC_AZOSB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  156::423     6e-17  31%  455 aa  MURC_ANATD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::423     8e-17  29%  450 aa  MURD_BACC7 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  108::353     8e-17  29%  452 aa  MURC_GRAFK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   30::315     1e-16  31%  451 aa  MURD_STRA3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::358     1e-16  27%  452 aa  MURC_FRAP2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::316     1e-16  31%  449 aa  MURD_EXIS2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   99::392     1e-16  32%  498 aa  MURC_WOLPM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  111::363     1e-16  32%  482 aa  MURC_RHOCS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::362     1e-16  29%  466 aa  MURC_RHILO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  107::441     1e-16  29%  461 aa  MURC_PELTS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   37::359     2e-16  29%  458 aa  MURC_CLOAB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::344     2e-16  28%  457 aa  MURF_BACSU RecName:
  112::420     2e-16  28%  449 aa  MURD_LEUCK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   28::339     2e-16  29%  437 aa  MURC_STAS1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::343     2e-16  29%  444 aa  MURC_LEUMM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   93::425     2e-16  29%  435 aa  MURC_EXISA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  109::459     2e-16  30%  459 aa  MURC_DESPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::325     2e-16  30%  436 aa  MURC_BACCN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::416     3e-16  33%  437 aa  MURC_LACAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::362     3e-16  31%  475 aa  MURC_BARHE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     3e-16  30%  436 aa  MURC_BACCQ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   58::344     4e-16  29%  442 aa  MURD_SOLUE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   58::452     4e-16  28%  473 aa  MURC_NITEC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   59::353     4e-16  29%  474 aa  MURC_ERYLH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     4e-16  29%  467 aa  MURC_BRASB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::358     4e-16  28%  464 aa  MURC_ACIF5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::358     4e-16  28%  464 aa  MURC_ACIF2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::364     5e-16  29%  444 aa  MURD_BACFR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   43::364     5e-16  29%  444 aa  MURD_BACFN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::424     5e-16  28%  451 aa  MURD_BACCN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  125::408     5e-16  28%  480 aa  MURC_SYNAS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::362     5e-16  29%  471 aa  MURC_RHIL3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  112::366     5e-16  29%  468 aa  MURC_FUSNN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::352     5e-16  29%  487 aa  MURC_ACAM1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   53::451     7e-16  29%  477 aa  MURC_RHOFD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   73::472     7e-16  30%  475 aa  MURC_METFK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  109::424     7e-16  29%  439 aa  MURC_LACDB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  109::424     7e-16  29%  439 aa  MURC_LACDA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     7e-16  30%  467 aa  MURC_BRASO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::362     7e-16  31%  475 aa  MURC_BARBK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::394     7e-16  29%  458 aa  MURC_ANASK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::394     7e-16  29%  458 aa  MURC_ANAD2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::362     7e-16  27%  471 aa  MURC_AGRT5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   87::315     9e-16  31%  449 aa  MURD_STAES RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   61::365     9e-16  29%  477 aa  MURC_PHEZH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::342     9e-16  30%  436 aa  MURC_LACPL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::445     9e-16  27%  458 aa  MURC_CLONN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   19::330     9e-16  29%  450 aa  MURC_CLOD6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::359     9e-16  32%  460 aa  MURC_CLOBA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   53::328     9e-16  29%  435 aa  MURC_BACSK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACHK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACCZ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACC7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACC3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACC1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACC0 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACAN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACAH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::339     9e-16  30%  436 aa  MURC_BACAA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::394     9e-16  28%  458 aa  MURC_ANADE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::460     9e-16  29%  479 aa  MURC_ALHEH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::356     1e-15  31%  478 aa  MURC_POLNS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::483     1e-15  28%  493 aa  MURC_NITMU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::345     1e-15  31%  437 aa  MURC_LACGA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   53::339     1e-15  28%  436 aa  MURC_BACCR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   53::339     1e-15  28%  436 aa  MURC_BACC4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   93::328     1e-15  32%  432 aa  MURC_BACA2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   60::352     2e-15  28%  476 aa  MURC_MAGSM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   46::326     2e-15  29%  431 aa  MURC_MACCJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::359     2e-15  31%  460 aa  MURC_CLOBB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   53::328     2e-15  29%  436 aa  MURC_BACC2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  104::340     2e-15  27%  435 aa  MURC_OENOB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   93::339     2e-15  31%  437 aa  MURC_LYSSC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::342     2e-15  27%  443 aa  MURC_LACS1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   48::328     2e-15  30%  436 aa  MURC_BACWK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   87::315     3e-15  30%  449 aa  MURD_STAEQ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::310     3e-15  31%  448 aa  MURD_ACIB5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::310     3e-15  31%  448 aa  MURD_ACIB3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::349     3e-15  30%  475 aa  MURC_SALRD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   58::452     3e-15  30%  473 aa  MURC_NITEU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::354     3e-15  31%  449 aa  MURC_HYDS0 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  102::359     4e-15  29%  498 aa  MURD_WOLTR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::381     4e-15  28%  448 aa  MURD_ACIBC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   50::451     4e-15  30%  468 aa  MURC_ROSS1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  180::364     4e-15  29%  476 aa  MURC_MAGSA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::345     4e-15  31%  437 aa  MURC_LACJO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::340     5e-15  32%  464 aa  MURD_ROSDO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::372     5e-15  28%  478 aa  MURC_RICBR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::372     5e-15  28%  478 aa  MURC_RICB8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::453     5e-15  31%  483 aa  MURC_RALSO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::341     6e-15  32%  473 aa  MURD_PROMP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::310     6e-15  29%  448 aa  MURD_ACIBT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  174::373     6e-15  31%  457 aa  MURC_THESQ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  174::373     6e-15  31%  457 aa  MURC_THEMA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   44::364     6e-15  27%  483 aa  MURC_SHEVI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::405     6e-15  29%  471 aa  MURC_PROAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::342     6e-15  28%  443 aa  MURC_LACBA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::350     6e-15  28%  449 aa  MURC_FLAJ1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::358     6e-15  28%  462 aa  MURC_DESRM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     6e-15  30%  465 aa  MURC_BURM1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  174::373     8e-15  31%  457 aa  MURC_THEP1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  182::367     8e-15  28%  469 aa  MURC_RUTMC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::362     8e-15  31%  468 aa  MURC_ROSDO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     8e-15  30%  465 aa  MURC_BURVG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::453     1e-14  26%  471 aa  MURC_AGRVS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  130::331     1e-14  37%  455 aa  MURD_ALKMQ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  182::367     1e-14  30%  469 aa  MURC_VESOH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::345     1e-14  30%  473 aa  MURC_SPHWW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   97::343     1e-14  29%  444 aa  MURC_LACSS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   63::368     1e-14  26%  473 aa  MURC_CAUCR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   63::368     1e-14  26%  473 aa  MURC_CAUCN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::356     1e-14  35%  468 aa  MURC_BORA1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::362     1e-14  33%  475 aa  MURC_BART1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::333     2e-14  29%  460 aa  MURD_PROMM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  124::341     2e-14  33%  454 aa  MURD_DESHD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::352     2e-14  34%  469 aa  MURC_LARHH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  236::346     2e-14  36%  465 aa  MURC_CHLPB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-14  30%  465 aa  MURC_BURS3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-14  30%  465 aa  MURC_BURCJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUSU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUSI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUO2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUME RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUMB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUC2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUAB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUA2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::455     2e-14  28%  471 aa  MURC_BRUA1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  107::343     3e-14  29%  444 aa  MURC_LEUCK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   63::367     3e-14  25%  472 aa  MURC_CAUSK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   77::368     3e-14  28%  486 aa  MURC_BUCBP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::340     4e-14  33%  465 aa  MURD_RHOS5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   49::424     4e-14  27%  451 aa  MURD_BACSU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  175::451     4e-14  31%  477 aa  MURC_VEREI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::453     4e-14  32%  485 aa  MURC_VARPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   78::358     5e-14  30%  444 aa  MURD_BACTN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::462     5e-14  25%  478 aa  MURC_RICFE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   77::419     7e-14  29%  445 aa  MURD_NEIMA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  111::367     7e-14  28%  476 aa  MURC_ZYMMO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::360     7e-14  33%  469 aa  MURC_SILST RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     7e-14  26%  478 aa  MURC_RICAH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   46::342     7e-14  26%  472 aa  MURC_MYXXD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::416     7e-14  31%  437 aa  MURC_LACH4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   93::328     7e-14  32%  431 aa  MURC_EXIS2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::448     7e-14  28%  459 aa  MURC_EUBR3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  149::379     7e-14  31%  495 aa  MURC_CYAP7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::448     7e-14  30%  468 aa  MURC_ACIBL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   96::341     9e-14  30%  477 aa  MURD_PROM5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  112::435     9e-14  28%  462 aa  MURD_BDEBA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::356     9e-14  28%  448 aa  MURD_ACIAD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   38::350     9e-14  29%  452 aa  MURC_STRMU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     9e-14  28%  467 aa  MURC_RHOPT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   65::356     9e-14  29%  478 aa  MURC_POLSQ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  105::368     9e-14  31%  477 aa  MURC_CORDI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::340     1e-13  33%  465 aa  MURD_RHOSK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::340     1e-13  33%  465 aa  MURD_RHOS4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::340     1e-13  33%  465 aa  MURD_RHOS1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  124::341     1e-13  32%  454 aa  MURD_DESHY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  103::345     1e-13  28%  447 aa  MURC_RUBXD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     1e-13  28%  467 aa  MURC_RHOPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  109::362     1e-13  25%  466 aa  MURC_CYTH3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::363     1e-13  28%  467 aa  MURC_AZOC5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  109::331     1e-13  33%  460 aa  MURD_JANSC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   95::341     1e-13  29%  443 aa  MURC_LACLA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   59::353     1e-13  26%  477 aa  MURC_GLUOX RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::455     1e-13  28%  468 aa  MURC_BORPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::455     1e-13  28%  468 aa  MURC_BORBR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  472::854     1e-13  23%  874 aa  CPHA_SYNY8 RecName: Full=Cyanophycin synthetase;       
   95::312     2e-13  32%  450 aa  MURD_RICBR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  105::306     2e-13  33%  434 aa  MURD_PASMU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   95::341     2e-13  28%  443 aa  MURC_STREM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::341     2e-13  28%  443 aa  MURC_STRE4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   56::455     2e-13  29%  468 aa  MURC_BORPE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::368     2e-13  27%  476 aa  MURC_BEII9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   30::240     3e-13  30%  446 aa  MURF_STRTO RecName: Full=Probable
   77::419     3e-13  29%  445 aa  MURD_NEIG2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::352     3e-13  35%  483 aa  MURC_SYNS3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::341     3e-13  27%  443 aa  MURC_STRS7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     3e-13  24%  485 aa  MURC_RICRS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     3e-13  24%  485 aa  MURC_RICRO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     3e-13  29%  467 aa  MURC_RHOPB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::444     3e-13  29%  462 aa  MURC_GEOSL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  101::343     3e-13  28%  464 aa  MURC_DICT6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     3e-13  29%  465 aa  MURC_BURCH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     3e-13  29%  465 aa  MURC_BURCA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  111::307     3e-13  31%  449 aa  MURD_SHEVI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   77::419     3e-13  29%  445 aa  MURD_NEIG1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  156::422     3e-13  29%  451 aa  MURD_CARHZ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  110::362     3e-13  30%  471 aa  MURC_SINMW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     3e-13  25%  485 aa  MURC_RICPU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   64::453     3e-13  30%  483 aa  MURC_RALPJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  188::373     3e-13  29%  478 aa  MURC_DICNV RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   77::419     4e-13  28%  445 aa  MURD_NEIMF RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  174::447     4e-13  28%  457 aa  MURC_THENN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     4e-13  25%  485 aa  MURC_RICM5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     4e-13  24%  485 aa  MURC_RICCN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     4e-13  28%  467 aa  MURC_RHOPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     4e-13  27%  468 aa  MURC_RHOP2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::372     4e-13  28%  490 aa  MURC_ORITB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::444     4e-13  27%  456 aa  MURC_GEOLS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   38::364     4e-13  28%  464 aa  MURC_CARHZ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     4e-13  29%  465 aa  MURC_BURCC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  535::853     4e-13  28%  901 aa  CPHA_ANAVT RecName: Full=Cyanophycin synthetase;       
  535::853     4e-13  27%  901 aa  CPHA_ANASP RecName: Full=Cyanophycin synthetase;       
  162::358     6e-13  30%  452 aa  MURD_STRPZ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPG RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPF RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRPB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRP8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRP6 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRP3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     6e-13  30%  452 aa  MURD_STRP1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  110::421     6e-13  31%  453 aa  MURD_ACIBL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::447     6e-13  28%  482 aa  MURC_SYMTH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::341     6e-13  28%  443 aa  MURC_LACLM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::237     7e-13  40%  466 aa  MURD_SILPO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   95::341     7e-13  28%  443 aa  MURC_STRA3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     7e-13  25%  477 aa  MURC_RICCK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  177::335     7e-13  31%  464 aa  MURC_PROA2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::341     7e-13  28%  443 aa  MURC_LACLS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   30::359     7e-13  27%  462 aa  MURC_BRAHW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::341     1e-12  26%  443 aa  MURC_STRSY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::341     1e-12  26%  443 aa  MURC_STRS2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::341     1e-12  28%  443 aa  MURC_STRA5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::341     1e-12  28%  443 aa  MURC_STRA1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::442     1e-12  24%  459 aa  MURF_TREPA RecName:
   88::311     1e-12  29%  445 aa  MURD_RICPR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::437     1e-12  30%  465 aa  MURD_PROVI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  109::445     1e-12  27%  469 aa  MURC_SORC5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   75::355     1e-12  26%  472 aa  MURC_SOLUE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::362     1e-12  30%  471 aa  MURC_RHIME RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     1e-12  29%  467 aa  MURC_NITHX RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  152::391     1e-12  28%  518 aa  MURC_CYAA5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   28::461     2e-12  25%  464 aa  MURF_BORBU RecName:
  110::452     2e-12  28%  466 aa  MURC_STRGG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::363     2e-12  29%  467 aa  MURC_NITWN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::444     2e-12  28%  461 aa  MURC_GEOMG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     2e-12  28%  488 aa  MURC_ENTS8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::442     2e-12  30%  457 aa  MURC_DESOH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   82::301     2e-12  32%  434 aa  MURD_SPHAL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::369     2e-12  31%  477 aa  MURC_XANC5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  136::358     2e-12  32%  510 aa  MURC_SYNJA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::352     2e-12  29%  477 aa  MURC_SPHAL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::462     2e-12  26%  495 aa  MURC_RICPR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   99::252     3e-12  35%  509 aa  MURD_WOLPM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  113::334     3e-12  28%  462 aa  MURD_SYNS9 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  121::237     3e-12  40%  466 aa  MURD_PARDP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   77::419     3e-12  28%  445 aa  MURD_NEIM0 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   41::314     3e-12  27%  449 aa  MURD_LEUMM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::309     3e-12  31%  437 aa  MURD_HAEIG RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::432     3e-12  29%  458 aa  MURD_CLOTE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::369     3e-12  31%  477 aa  MURC_XANCP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::369     3e-12  31%  477 aa  MURC_XANCB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::369     3e-12  31%  477 aa  MURC_XANC8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  116::372     3e-12  27%  485 aa  MURC_RICAE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  111::367     3e-12  28%  474 aa  MURC_NOVAD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::352     3e-12  26%  453 aa  MURC_LAWIP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   55::445     3e-12  24%  460 aa  MURC_BREBN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   75::304     4e-12  31%  431 aa  MURD_PETMO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::309     4e-12  31%  437 aa  MURD_HAEIN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  121::336     4e-12  33%  464 aa  MURD_DINSH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   90::250     4e-12  35%  456 aa  MURD_DESPS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::369     4e-12  31%  477 aa  MURC_XANAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     4e-12  28%  442 aa  MURC_STRP8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::356     4e-12  32%  468 aa  MURC_BORPD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::320     5e-12  27%  461 aa  MURD_SYNSC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   29::340     5e-12  27%  442 aa  MURC_STRPZ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRPG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRPF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRPD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRPC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRPB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRP6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRP3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     5e-12  27%  442 aa  MURC_STRP1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  170::355     5e-12  35%  476 aa  MURC_ROSCS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::362     5e-12  29%  469 aa  MURC_RHISN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::451     5e-12  30%  477 aa  MURC_DELAS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::359     5e-12  31%  465 aa  MURC_BURCM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::359     5e-12  31%  465 aa  MURC_BURA4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   88::441     6e-12  27%  451 aa  MURD_BACP2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::372     6e-12  28%  498 aa  MURC_RICTY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  117::327     8e-12  32%  467 aa  MURD_BRUME RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::352     8e-12  31%  478 aa  MURC_SYNJB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::340     8e-12  27%  442 aa  MURC_STRPM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   75::210     1e-11  36%  449 aa  MURD_STACT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   99::430     1e-11  27%  536 aa  MURC_WOLTR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     1e-11  27%  444 aa  MURC_STRSV RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   27::453     1e-11  28%  467 aa  MURC_RHOP5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::226     1e-11  38%  462 aa  MURD_SYNPX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   77::419     1e-11  27%  445 aa  MURD_NEIMB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  166::432     1e-11  29%  461 aa  MURD_NATTJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::309     1e-11  30%  437 aa  MURD_HAEI8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::327     1e-11  32%  467 aa  MURD_BRUSU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::327     1e-11  32%  467 aa  MURD_BRUAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::327     1e-11  32%  467 aa  MURD_BRUA2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  177::358     1e-11  29%  465 aa  MURC_SYNWW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  111::444     1e-11  25%  469 aa  MURC_SYNFM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::453     1e-11  29%  475 aa  MURC_RALEJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  182::363     1e-11  29%  474 aa  MURC_JANSC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::422     2e-11  30%  449 aa  MURD_STRSY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::422     2e-11  30%  449 aa  MURD_STRS2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   99::311     2e-11  31%  449 aa  MURD_RICFE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  161::424     2e-11  30%  450 aa  MURD_EUBE2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  120::344     2e-11  29%  471 aa  MURD_COLP3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::369     2e-11  33%  477 aa  MURC_XANOR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::369     2e-11  33%  477 aa  MURC_XANOP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::369     2e-11  33%  477 aa  MURC_XANOM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::378     2e-11  26%  486 aa  MURC_ERWCT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::450     2e-11  27%  464 aa  MURC_DINSH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  180::358     2e-11  27%  457 aa  MURC_CLOK5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  180::358     2e-11  27%  457 aa  MURC_CLOK1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::372     2e-11  28%  488 aa  MURC_AZOVD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  125::320     2e-11  26%  454 aa  MURD_THEPX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  125::320     2e-11  26%  454 aa  MURD_THEP3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::323     2e-11  29%  458 aa  MURD_CLOK5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::323     2e-11  29%  458 aa  MURD_CLOK1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   43::363     2e-11  27%  488 aa  MURC_SHEON RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::344     2e-11  29%  460 aa  MURC_PELPD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::351     2e-11  27%  457 aa  MURC_DESDA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   99::311     3e-11  30%  457 aa  MURD_RICTY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  209::312     3e-11  38%  587 aa  MURD_POLSJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   71::319     3e-11  27%  455 aa  MURD_PEDPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::433     3e-11  27%  450 aa  MURD_DESAA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::348     3e-11  30%  442 aa  MURD_BUCBP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   29::342     3e-11  28%  444 aa  MURC_STRPJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::375     3e-11  31%  488 aa  MURC_MYCUA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   68::365     3e-11  24%  468 aa  MURC_MARMM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  177::347     3e-11  29%  466 aa  MURC_CHLPD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::363     3e-11  29%  467 aa  MURC_BRAJA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::358     4e-11  28%  453 aa  MURD_STRU0 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::431     4e-11  27%  473 aa  MURD_NITMU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::421     4e-11  29%  447 aa  MURD_LEGPH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   71::293     4e-11  32%  438 aa  MURD_ANAMM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   94::347     4e-11  28%  469 aa  MURC_PROVI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::378     4e-11  27%  486 aa  MURC_PECCP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  136::468     4e-11  28%  482 aa  MURC_DEIRA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   86::350     4e-11  28%  475 aa  MURC_CHLTE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  107::308     5e-11  30%  439 aa  MURD_MANSM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::309     5e-11  30%  437 aa  MURD_HAEIE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::323     5e-11  31%  458 aa  MURD_CLOP1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   72::372     5e-11  29%  461 aa  MURD_ACIC5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   26::341     5e-11  28%  442 aa  MURC_STRTD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::346     5e-11  27%  447 aa  MURC_STRT2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   34::346     5e-11  27%  447 aa  MURC_STRT1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::452     5e-11  28%  478 aa  MURC_POLNA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   59::364     5e-11  27%  480 aa  MURC_GLUDA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::340     7e-11  32%  468 aa  MURD_PROM9 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::204     7e-11  40%  447 aa  MURD_LEGPL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::204     7e-11  40%  447 aa  MURD_LEGPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::327     7e-11  30%  465 aa  MURD_CLOCE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::295     7e-11  32%  469 aa  MURD_CAUSK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   49::422     7e-11  30%  450 aa  MURD_BACHD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   35::364     7e-11  28%  470 aa  MURC_RHOSK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   35::364     7e-11  28%  470 aa  MURC_RHOS4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::355     7e-11  25%  462 aa  MURC_PARD8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::391     7e-11  26%  470 aa  MURC_DESAD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  101::216     9e-11  41%  500 aa  MURD_RICCN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   29::342     9e-11  27%  444 aa  MURC_STRZP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     9e-11  27%  444 aa  MURC_STRZJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     9e-11  27%  444 aa  MURC_STRPI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  177::346     9e-11  30%  479 aa  MURC_PELPB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  155::370     1e-10  30%  440 aa  MURD_VIBCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  112::245     1e-10  36%  455 aa  MURD_SYMTH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  121::332     1e-10  34%  477 aa  MURD_RHORT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::417     1e-10  29%  441 aa  MURD_GLOVI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::327     1e-10  27%  466 aa  MURD_CLOTH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  175::359     1e-10  27%  461 aa  MURC_THICR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     1e-10  27%  444 aa  MURC_STRZT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     1e-10  27%  444 aa  MURC_STRR6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     1e-10  27%  444 aa  MURC_STRPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     1e-10  27%  444 aa  MURC_STRP4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     1e-10  27%  444 aa  MURC_STRP2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  123::363     1e-10  28%  484 aa  MURC_SHEAM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  190::362     1e-10  27%  476 aa  MURC_PSYWF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   81::354     1e-10  27%  461 aa  MURC_GEOSM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   81::354     1e-10  27%  461 aa  MURC_GEOBB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  177::346     1e-10  29%  471 aa  MURC_CHLP8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   59::342     1e-10  28%  479 aa  MURC_ACICJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  114::330     2e-10  29%  469 aa  MURD_PHEZH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   83::382     2e-10  26%  411 aa  MURD_HYDS0 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::323     2e-10  30%  458 aa  MURD_CLOPE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  127::321     2e-10  30%  454 aa  MURD_ALKOO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   29::342     2e-10  27%  444 aa  MURC_STRPN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::342     2e-10  27%  444 aa  MURC_STRP7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     2e-10  26%  488 aa  MURC_SHEB9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     2e-10  26%  488 aa  MURC_SHEB8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     2e-10  26%  488 aa  MURC_SHEB5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     2e-10  26%  488 aa  MURC_SHEB2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::364     2e-10  29%  470 aa  MURC_RHOS5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  119::370     2e-10  29%  482 aa  MURC_PSEPW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   40::359     2e-10  28%  481 aa  MURC_PSEFS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  111::352     2e-10  26%  464 aa  MURC_PELUB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::453     2e-10  28%  472 aa  MURC_METCA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-10  30%  465 aa  MURC_BURTA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  472::854     2e-10  23%  872 aa  CPHA_CYAA5 RecName: Full=Cyanophycin synthetase;       
   69::219     2e-10  38%  453 aa  MURD_METFK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  175::339     2e-10  28%  458 aa  MURC_PELCD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::343     2e-10  34%  465 aa  MURC_JANMA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-10  30%  465 aa  MURC_BURPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-10  30%  465 aa  MURC_BURP6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-10  30%  465 aa  MURC_BURP1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     2e-10  30%  465 aa  MURC_BURP0 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  155::370     3e-10  30%  440 aa  MURD_VIBC3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  164::360     3e-10  32%  449 aa  MURD_OCEIH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::323     3e-10  30%  458 aa  MURD_CLOPS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  160::402     3e-10  32%  505 aa  MURC_SYNY3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     3e-10  28%  491 aa  MURC_SALAR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   35::364     3e-10  27%  470 aa  MURC_RHOS1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   40::370     3e-10  28%  486 aa  MURC_PSESM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  119::370     3e-10  28%  482 aa  MURC_PSEPK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  119::370     3e-10  28%  482 aa  MURC_PSEP1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::395     3e-10  26%  436 aa  MURC_LACC3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     3e-10  26%  491 aa  MURC_ENT38 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     3e-10  27%  491 aa  MURC_ECOL5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     3e-10  31%  465 aa  MURC_BURMS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     3e-10  31%  465 aa  MURC_BURMA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     3e-10  31%  465 aa  MURC_BURM9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::359     3e-10  31%  465 aa  MURC_BURM7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::372     3e-10  26%  476 aa  MURC_ACTSZ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  160::331     3e-10  37%  454 aa  MURD_THEEB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  115::340     3e-10  26%  470 aa  MURD_PROMA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   36::317     3e-10  28%  445 aa  MURD_MACCJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::323     3e-10  30%  458 aa  MURD_CLONN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::335     3e-10  28%  469 aa  MURD_AGRT5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::344     3e-10  25%  445 aa  MURC_THELT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     3e-10  27%  488 aa  MURC_SHESM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   79::453     3e-10  30%  477 aa  MURC_RALEH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  192::364     3e-10  28%  479 aa  MURC_PSYA2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::361     3e-10  31%  485 aa  MURC_PSEU5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::353     3e-10  31%  481 aa  MURC_MARAV RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::378     3e-10  29%  491 aa  MURC_KLEP7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::467     3e-10  24%  493 aa  MURC_HAMD5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  117::335     4e-10  32%  466 aa  MURD_RHILO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  164::432     4e-10  29%  458 aa  MURD_CLOBA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   98::355     4e-10  28%  453 aa  MURD_CHRVO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  132::265     4e-10  33%  508 aa  MURD_BORA1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   43::363     4e-10  27%  488 aa  MURC_SHESR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     4e-10  27%  488 aa  MURC_SHESA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::363     4e-10  31%  469 aa  MURC_LEPCP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::462     4e-10  25%  484 aa  MURC_AERHH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  162::422     6e-10  30%  450 aa  MURD_STRGC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   64::301     6e-10  31%  443 aa  MURD_NOVAD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   68::223     6e-10  34%  453 aa  MURD_NITOC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::491     6e-10  28%  503 aa  MURC_RHOOB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     6e-10  28%  483 aa  MURC_PSEHT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::358     6e-10  30%  480 aa  MURC_PSEAE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::358     6e-10  30%  480 aa  MURC_PSEAB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::358     6e-10  30%  480 aa  MURC_PSEA8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::358     6e-10  30%  480 aa  MURC_PSEA7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   40::370     6e-10  28%  486 aa  MURC_PSE14 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  192::355     6e-10  31%  488 aa  MURC_PROM3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  177::346     6e-10  29%  473 aa  MURC_PELLD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     6e-10  25%  475 aa  MURC_HAEPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     6e-10  27%  491 aa  MURC_ESCF3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::441     6e-10  26%  457 aa  MURC_DESMR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     6e-10  29%  482 aa  MURC_ACIBY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     6e-10  29%  482 aa  MURC_ACIBT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     6e-10  29%  482 aa  MURC_ACIBS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     6e-10  29%  482 aa  MURC_ACIBC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     6e-10  29%  482 aa  MURC_ACIB5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     6e-10  29%  482 aa  MURC_ACIB3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::451     6e-10  29%  475 aa  MURC_ACIAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::237     8e-10  37%  467 aa  MURD_SILST RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   69::363     8e-10  25%  447 aa  MURD_PHOPR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  207::347     8e-10  33%  499 aa  MURD_NOSP7 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   72::433     8e-10  26%  471 aa  MURD_NITEU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   86::281     8e-10  29%  414 aa  MURD_FRAP2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   74::369     8e-10  27%  477 aa  MURC_XYLFT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   74::369     8e-10  27%  477 aa  MURC_XYLFM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   74::369     8e-10  27%  477 aa  MURC_XYLFA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   74::369     8e-10  27%  477 aa  MURC_XYLF2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::363     8e-10  27%  470 aa  MURC_XANP2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::341     8e-10  26%  443 aa  MURC_STRGC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  101::372     8e-10  27%  514 aa  MURC_SALTO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::453     8e-10  30%  471 aa  MURC_RALME RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   40::370     8e-10  28%  486 aa  MURC_PSEU2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  119::359     8e-10  29%  486 aa  MURC_PSEPF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  119::370     8e-10  28%  482 aa  MURC_PSEE4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     8e-10  27%  487 aa  MURC_PROMH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::363     8e-10  26%  468 aa  MURC_METSB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     8e-10  29%  491 aa  MURC_KLEP3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::378     8e-10  27%  491 aa  MURC_CITK8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   88::424     1e-09  27%  451 aa  MURD_BACLD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   45::376     1e-09  24%  486 aa  MURC_VIBSL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  192::364     1e-09  28%  479 aa  MURC_PSYCK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  119::370     1e-09  28%  482 aa  MURC_PSEPG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::369     1e-09  27%  475 aa  MURC_PARDP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  126::364     1e-09  30%  478 aa  MURC_MICAN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   95::395     1e-09  26%  436 aa  MURC_LACCB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  112::353     1e-09  25%  460 aa  MURC_GLOVI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   58::455     1e-09  27%  471 aa  MURC_AZOSE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   85::321     1e-09  29%  469 aa  MURD_SYNJA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   95::441     1e-09  27%  451 aa  MURD_GEOSW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   64::422     1e-09  26%  450 aa  MURD_CYTH3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   82::313     1e-09  26%  440 aa  MURD_BUCAT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   82::313     1e-09  26%  440 aa  MURD_BUCAI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   82::313     1e-09  26%  440 aa  MURD_BUCA5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::367     1e-09  27%  491 aa  MURC_SALCH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::330     1e-09  28%  434 aa  MURC_LACRD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  113::225     2e-09  37%  455 aa  MURD_CHRSD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   67::430     2e-09  26%  441 aa  MURD_ALCBS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   42::372     2e-09  25%  487 aa  MURC_PSYIN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  192::355     2e-09  27%  488 aa  MURC_PROMM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   76::371     2e-09  27%  473 aa  MURC_MARMS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   79::453     2e-09  29%  474 aa  MURC_CUPTR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  115::398     2e-09  24%  476 aa  MURC_CLAM3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  177::347     2e-09  27%  467 aa  MURC_CHLCH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::448     2e-09  28%  464 aa  MURC_BURP8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  158::314     2e-09  29%  450 aa  MURD_THETN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::214     2e-09  40%  471 aa  MURD_STRCO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   74::314     2e-09  32%  438 aa  MURD_OENOB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   59::204     2e-09  30%  442 aa  MURD_COXBU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   59::204     2e-09  30%  442 aa  MURD_COXBR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   59::204     2e-09  30%  442 aa  MURD_COXBN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   59::204     2e-09  30%  442 aa  MURD_COXB2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   59::204     2e-09  30%  442 aa  MURD_COXB1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::367     2e-09  27%  491 aa  MURC_SHISS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SHIF8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALTY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALTI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALSV RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALPK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALPC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALPB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALNS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALHS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALG2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALEP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALDC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_SALA4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::359     2e-09  28%  469 aa  MURC_LEGPL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::359     2e-09  28%  469 aa  MURC_LEGPH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::359     2e-09  28%  469 aa  MURC_LEGPC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::359     2e-09  28%  469 aa  MURC_LEGPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOUT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOSM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOSE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOLU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOLI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOLC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOL6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOK1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOHS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECODH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECOBW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO8A RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO81 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO7I RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO5E RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO57 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO55 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO45 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO27 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     2e-09  27%  491 aa  MURC_ECO24 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::363     2e-09  28%  467 aa  MURC_BURXL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  112::346     3e-09  27%  475 aa  MURC_THEEB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::344     3e-09  27%  468 aa  MURC_SYNS9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     3e-09  27%  491 aa  MURC_SHIDS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   46::377     3e-09  25%  487 aa  MURC_PHOPR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  187::365     3e-09  28%  474 aa  MURC_ALCBS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  162::358     4e-09  29%  450 aa  MURD_STRSV RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::330     4e-09  29%  469 aa  MURD_RHOPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  121::235     4e-09  39%  469 aa  MURD_PROMT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  144::337     4e-09  32%  447 aa  MURD_DESDG RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  101::351     4e-09  27%  456 aa  MURC_PORGI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  126::374     4e-09  29%  490 aa  MURC_IDILO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   58::450     4e-09  29%  463 aa  MURC_DECAR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   32::457     4e-09  25%  469 aa  MURC_CLOPH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   29::363     4e-09  28%  467 aa  MURC_BURPP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  178::307     5e-09  33%  440 aa  MURD_VIBF1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  129::323     5e-09  30%  454 aa  MURD_CLOPH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   81::350     5e-09  27%  440 aa  MURD_BUCAP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::329     5e-09  36%  455 aa  MURD_ANAVT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::350     5e-09  30%  464 aa  MURC_STRAW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     5e-09  27%  491 aa  MURC_SHIFL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     5e-09  27%  491 aa  MURC_SHIBS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::367     5e-09  27%  491 aa  MURC_SHIB3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  158::365     5e-09  25%  473 aa  MURC_PROMP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::364     5e-09  30%  469 aa  MURC_NEIMA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::363     5e-09  30%  468 aa  MURC_NEIG1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::341     5e-09  27%  437 aa  MURC_LACF3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  162::317     6e-09  31%  452 aa  MURD_STREM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  182::352     6e-09  27%  449 aa  MURD_STAS1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::335     6e-09  29%  463 aa  MURD_RHIME RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::432     6e-09  27%  458 aa  MURD_CLOBM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   86::225     6e-09  31%  451 aa  MURD_BACSK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   73::370     6e-09  26%  473 aa  MURC_TERTT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::364     6e-09  30%  469 aa  MURC_NEIMF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::363     6e-09  30%  468 aa  MURC_NEIM0 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  115::446     6e-09  24%  476 aa  MURC_CLAMS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  103::215     8e-09  37%  480 aa  MURD_SYNJB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  156::421     8e-09  25%  453 aa  MURD_GEOSF RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  119::326     8e-09  27%  462 aa  MURD_CLOAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   48::376     8e-09  23%  485 aa  MURC_VIBPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   97::347     8e-09  26%  466 aa  MURC_CHLL2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  107::307     1e-08  32%  438 aa  MURD_YERPS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  148::313     1e-08  30%  462 aa  MURD_TRIEI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   53::324     1e-08  28%  453 aa  MURD_SYNAS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::210     1e-08  37%  467 aa  MURD_STRAW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  116::225     1e-08  37%  467 aa  MURD_MESSB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  168::430     1e-08  29%  460 aa  MURD_ENTHR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::410     1e-08  27%  478 aa  MURC_STRM5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  127::378     1e-08  24%  482 aa  MURC_PASMU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::375     1e-08  30%  488 aa  MURC_MYCMM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   52::366     1e-08  24%  474 aa  MURC_CHLAD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  178::446     1e-08  26%  458 aa  MURC_ANADF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::218     1e-08  36%  437 aa  MURD_VIBPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::353     1e-08  26%  466 aa  MURD_NITWN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   89::324     1e-08  30%  459 aa  MURD_LACH4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   90::301     1e-08  32%  448 aa  MURD_GLUOX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  179::348     1e-08  31%  452 aa  MURD_GEOMG RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::332     1e-08  27%  471 aa  MURD_CAUCR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::332     1e-08  27%  471 aa  MURD_CAUCN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  125::376     1e-08  24%  486 aa  MURC_VIBCH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  125::376     1e-08  24%  486 aa  MURC_VIBC3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::410     1e-08  27%  478 aa  MURC_STRMK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  181::362     1e-08  25%  465 aa  MURC_SILPO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  123::363     1e-08  27%  488 aa  MURC_SHESW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  123::363     1e-08  27%  488 aa  MURC_SHEPC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   65::359     1e-08  25%  484 aa  MURC_PSEF5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::363     1e-08  25%  471 aa  MURC_METNO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   45::376     1e-08  24%  480 aa  MURC_MANSM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     1e-08  24%  476 aa  MURC_HAES2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     1e-08  24%  476 aa  MURC_HAES1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::341     1e-08  26%  448 aa  MURC_FLAPJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  472::854     1e-08  22%  873 aa  CPHA_SYNY3 RecName: Full=Cyanophycin synthetase;       
  118::215     2e-08  38%  458 aa  MURD_CLOBL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::215     2e-08  38%  458 aa  MURD_CLOBH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::215     2e-08  38%  458 aa  MURD_CLOB6 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::215     2e-08  38%  458 aa  MURD_CLOB1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::265     2e-08  32%  510 aa  MURD_BORPE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   67::310     2e-08  28%  444 aa  MURD_BLOFL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::378     2e-08  26%  492 aa  MURC_SERP5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  184::348     2e-08  29%  484 aa  MURC_MYCSS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  184::348     2e-08  29%  484 aa  MURC_MYCSK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  184::348     2e-08  29%  484 aa  MURC_MYCSJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  125::238     2e-08  38%  480 aa  MURD_TROW8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::231     2e-08  35%  466 aa  MURD_RHOPB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   90::415     2e-08  26%  432 aa  MURD_FUSNN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  101::401     2e-08  28%  420 aa  MURD_FERNB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::374     2e-08  31%  466 aa  MURD_CHLPB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  127::427     2e-08  22%  453 aa  MURD_CALS8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::315     2e-08  32%  462 aa  MURD_ANASP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::378     2e-08  26%  491 aa  MURC_YERE8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  188::347     2e-08  29%  486 aa  MURC_SYNPW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   72::364     2e-08  24%  489 aa  MURC_SHEHH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  178::351     2e-08  29%  456 aa  MURC_PORG3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::320     2e-08  32%  469 aa  MURC_NEIMB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  178::342     2e-08  29%  481 aa  MURC_GRABC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  183::442     2e-08  26%  458 aa  MURC_BACV8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  102::414     3e-08  24%  449 aa  MURD_THICR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     3e-08  28%  450 aa  MURD_STRTD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     3e-08  28%  450 aa  MURD_STRT2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     3e-08  28%  450 aa  MURD_STRT1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::330     3e-08  28%  466 aa  MURD_RHOP2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  122::238     3e-08  34%  506 aa  MURD_RHOFD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   99::324     3e-08  28%  456 aa  MURD_LACRJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   99::324     3e-08  28%  456 aa  MURD_LACRD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::245     3e-08  33%  435 aa  MURD_HAEDU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  155::421     3e-08  26%  452 aa  MURD_GEOSM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::265     3e-08  32%  508 aa  MURD_BORPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::265     3e-08  32%  510 aa  MURD_BORBR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   79::215     3e-08  34%  479 aa  MURD_BIFAA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   42::367     3e-08  25%  491 aa  MURC_YERPS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     3e-08  25%  491 aa  MURC_YERPP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     3e-08  25%  491 aa  MURC_YERPN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     3e-08  25%  491 aa  MURC_YERPE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     3e-08  25%  491 aa  MURC_YERPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::367     3e-08  25%  491 aa  MURC_YERP3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   66::376     3e-08  23%  485 aa  MURC_VIBHB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   43::363     3e-08  24%  485 aa  MURC_SHEFN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::361     3e-08  27%  480 aa  MURC_PSEMY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   61::466     3e-08  27%  495 aa  MURC_MYCLE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   61::466     3e-08  27%  495 aa  MURC_MYCLB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  125::238     4e-08  38%  480 aa  MURD_TROWT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::347     4e-08  32%  457 aa  MURD_MAGSA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   70::319     4e-08  28%  458 aa  MURD_LACF3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   79::314     4e-08  28%  445 aa  MURD_GRAFK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::215     4e-08  37%  458 aa  MURD_CLOBK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   43::363     4e-08  26%  479 aa  MURC_SHEDO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  118::372     4e-08  29%  503 aa  MURC_RHOSR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  184::458     4e-08  26%  482 aa  MURC_MYCS2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  195::379     4e-08  30%  486 aa  MURC_HALHL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   37::369     4e-08  25%  472 aa  MURC_HAHCH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  193::376     4e-08  26%  482 aa  MURC_ACIAD RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::218     5e-08  34%  437 aa  MURD_VIBHB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  164::323     5e-08  31%  458 aa  MURD_CLOBB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::424     5e-08  24%  451 aa  MURD_BACA2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   83::341     5e-08  28%  415 aa  MURD_AQUAE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::371     5e-08  27%  494 aa  MURC_MYCTU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::371     5e-08  27%  494 aa  MURC_MYCTA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::371     5e-08  27%  494 aa  MURC_MYCBT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::371     5e-08  27%  494 aa  MURC_MYCBP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  185::371     5e-08  27%  494 aa  MURC_MYCBO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   77::382     5e-08  26%  503 aa  MURC_COLP3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   66::360     7e-08  26%  438 aa  MURD_WIGBR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  178::307     7e-08  30%  440 aa  MURD_VIBFM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::211     7e-08  41%  470 aa  MURD_RHIL3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  153::315     7e-08  32%  449 aa  MURD_MICAN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  155::421     7e-08  25%  452 aa  MURD_GEOBB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::325     7e-08  28%  416 aa  MURD_FRATT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::325     7e-08  28%  416 aa  MURD_FRAT1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::323     7e-08  28%  458 aa  MURD_CLOBJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   42::462     7e-08  24%  484 aa  MURC_TOLAT RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  186::351     7e-08  28%  469 aa  MURC_SYNSC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  182::355     7e-08  28%  472 aa  MURC_PROMA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::363     7e-08  24%  471 aa  MURC_METS4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   96::190     9e-08  35%  416 aa  MURD_FRATW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::190     9e-08  35%  416 aa  MURD_FRATO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::190     9e-08  35%  416 aa  MURD_FRATM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::190     9e-08  35%  416 aa  MURD_FRATH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::190     9e-08  35%  416 aa  MURD_FRATF RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   95::378     9e-08  28%  490 aa  MURC_SODGM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   44::375     9e-08  24%  489 aa  MURC_SHESH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     9e-08  22%  475 aa  MURC_HAEI8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  172::366     9e-08  28%  474 aa  MURC_CHLAA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   42::462     9e-08  25%  484 aa  MURC_AERS4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  240::374     1e-07  30%  510 aa  MURF_MYCTU RecName:
  240::374     1e-07  30%  510 aa  MURF_MYCBO RecName:
   37::329     1e-07  27%  453 aa  MURD_TERTT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     1e-07  33%  450 aa  MURD_STRZP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     1e-07  33%  450 aa  MURD_STRP7 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  110::318     1e-07  28%  450 aa  MURD_PELCD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   96::190     1e-07  35%  417 aa  MURD_FRATN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::320     1e-07  26%  457 aa  MURD_ANATD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   29::360     1e-07  29%  463 aa  MURC_THIDA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   94::415     2e-07  27%  432 aa  MURD_THENN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::469     2e-07  27%  503 aa  MURD_RALEJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  184::444     2e-07  32%  455 aa  MURD_LISMO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  131::361     2e-07  26%  481 aa  MURC_NOSP7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::361     2e-07  27%  490 aa  MURC_MYCA9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     2e-07  22%  475 aa  MURC_HAEIG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  117::211     2e-07  41%  470 aa  MURD_RHIEC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  161::426     2e-07  25%  452 aa  MURD_ELUMP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  161::320     2e-07  32%  456 aa  MURD_CYAP8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  167::323     2e-07  31%  458 aa  MURD_CLOB8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  159::400     2e-07  31%  465 aa  MURD_CHLL2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  166::440     2e-07  24%  453 aa  MURC_BDEBA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  117::230     3e-07  37%  468 aa  MURD_XANAC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  129::422     3e-07  27%  451 aa  MURD_STRMU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::333     3e-07  29%  466 aa  MURD_BARHE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   44::364     3e-07  24%  489 aa  MURC_SHEPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::372     3e-07  22%  475 aa  MURC_HAEIN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   69::372     3e-07  22%  475 aa  MURC_HAEIE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  162::358     4e-07  30%  450 aa  MURD_STRZT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::304     4e-07  29%  436 aa  MURD_PHOLL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  158::424     4e-07  27%  456 aa  MURD_DESRM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   76::197     4e-07  29%  420 aa  MURD_CHLAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   31::363     4e-07  24%  468 aa  MURC_METEP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   31::363     4e-07  24%  468 aa  MURC_METC4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::363     4e-07  25%  465 aa  MURC_COXBU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::363     4e-07  25%  465 aa  MURC_COXBR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::363     4e-07  25%  465 aa  MURC_COXBN RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::363     4e-07  25%  465 aa  MURC_COXB2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::363     4e-07  25%  465 aa  MURC_COXB1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  132::502     4e-07  25%  521 aa  MURC_BIFAA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  115::212     5e-07  33%  312 aa  Y531_METTH RecName: Full=Uncharacterized protein MTH_531;
   23::78      5e-07  39%  454 aa  MURF_SYNY3 RecName:
  118::230     5e-07  37%  468 aa  MURD_XANOR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::230     5e-07  37%  468 aa  MURD_XANOM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::208     5e-07  33%  439 aa  MURD_SHEON RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     5e-07  30%  449 aa  MURD_LACLM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::324     5e-07  29%  459 aa  MURD_LACAC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   88::226     5e-07  36%  451 aa  MURD_GEOKA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  150::315     5e-07  27%  449 aa  MURD_CYAP7 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  180::445     5e-07  26%  451 aa  MURD_CLOD6 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   75::196     5e-07  29%  419 aa  MURD_CHLCV RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   44::375     5e-07  24%  484 aa  MURC_SHELP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  101::372     5e-07  27%  511 aa  MURC_SALAI RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  162::358     6e-07  30%  449 aa  MURD_LACLS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   62::327     6e-07  29%  462 aa  MURD_ANADE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  188::367     6e-07  27%  478 aa  MURC_MYCVP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     6e-07  22%  475 aa  MURC_ACTPJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     6e-07  22%  475 aa  MURC_ACTP7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   41::372     6e-07  22%  475 aa  MURC_ACTP2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  110::353     8e-07  27%  442 aa  MURD_VIBVY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  178::353     8e-07  28%  442 aa  MURD_VIBVU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  32%  450 aa  MURD_STRR6 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  32%  450 aa  MURD_STRPS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  32%  450 aa  MURD_STRPN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  32%  450 aa  MURD_STRPJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  32%  450 aa  MURD_STRPI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  30%  450 aa  MURD_STRP4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  32%  450 aa  MURD_STRP2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::358     8e-07  30%  450 aa  MURD_LACLA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  157::294     8e-07  32%  453 aa  MURD_GEOUR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  121::218     8e-07  34%  434 aa  MURD_DESDA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   66::350     8e-07  28%  440 aa  MURD_BLOPB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  125::376     8e-07  24%  486 aa  MURC_VIBVU RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  123::461     8e-07  26%  472 aa  MURC_THEFY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   88::349     8e-07  26%  462 aa  MURC_STRCO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   44::364     8e-07  24%  489 aa  MURC_SHEPW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::444     8e-07  27%  465 aa  MURC_RENSM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::444     8e-07  24%  454 aa  MURC_DESVV RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  175::444     8e-07  24%  454 aa  MURC_DESVH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  124::385     8e-07  29%  486 aa  MURC_CORGL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  124::385     8e-07  29%  486 aa  MURC_CORGB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   82::424     1e-06  24%  450 aa  MURD_PORGI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  163::319     1e-06  31%  458 aa  MURD_LACS1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  163::317     1e-06  30%  459 aa  MURD_LACCB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  163::317     1e-06  30%  459 aa  MURD_LACC3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::243     1e-06  43%  503 aa  MURD_BURCC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   31::363     1e-06  25%  468 aa  MURC_METPB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  121::369     1e-06  26%  477 aa  MURC_ACIC1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  162::358     1e-06  30%  450 aa  MURD_STRZJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::359     1e-06  32%  499 aa  MURD_RALSO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   82::424     1e-06  24%  450 aa  MURD_PORG3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::213     1e-06  32%  466 aa  MURD_NITHX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  184::444     1e-06  31%  455 aa  MURD_LISMF RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  184::356     1e-06  31%  455 aa  MURD_LISIN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  141::320     1e-06  28%  463 aa  MURD_LEPIN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  141::320     1e-06  28%  463 aa  MURD_LEPIC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::219     1e-06  35%  466 aa  MURD_BRAJA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  125::376     1e-06  24%  486 aa  MURC_VIBVY RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  173::348     1e-06  23%  454 aa  MURC_PARUW RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  260::334     1e-06  33%  803 aa  MUDD_CHLTR RecName: Full=Bifunctional enzyme murC/ddl;Includes:
  163::332     2e-06  30%  466 aa  MURD_ROSS1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  149::320     2e-06  30%  462 aa  MURD_LEPBL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  149::320     2e-06  30%  462 aa  MURD_LEPBJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   89::325     2e-06  23%  460 aa  MURD_LACDA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  118::376     2e-06  25%  502 aa  MURC_RHOE4 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  272::437     2e-06  25%  453 aa  MPL_HAEIN RecName:
  150::315     2e-06  29%  452 aa  MURD_SYNY3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  103::216     2e-06  31%  440 aa  MURD_RUBXD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   89::213     2e-06  37%  460 aa  MURD_LACGA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   89::325     2e-06  23%  460 aa  MURD_LACDB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  110::218     2e-06  31%  442 aa  MURD_ALISL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::395     3e-06  27%  423 aa  MURD_THEAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::216     3e-06  31%  470 aa  MURD_NITEC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  154::321     3e-06  30%  456 aa  MURD_CYAA5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  179::261     3e-06  35%  504 aa  MURD_BURP8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  101::389     3e-06  30%  489 aa  MURC_COREF RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  263::404     3e-06  28%  809 aa  MUDD_CHLPN RecName: Full=Bifunctional enzyme murC/ddl;Includes:
   86::317     4e-06  28%  448 aa  MURD_PSEAE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  160::346     4e-06  28%  455 aa  MURD_PELTS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  179::269     4e-06  40%  504 aa  MURD_BURPP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  106::363     4e-06  27%  469 aa  MURC_METPP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::451     4e-06  27%  477 aa  MURC_DIAST RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  120::471     4e-06  25%  487 aa  MURC_CORU7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  108::451     4e-06  27%  477 aa  MURC_ACISJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  176::243     5e-06  41%  503 aa  MURD_BURS3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   42::378     5e-06  24%  490 aa  MURC_BAUCH RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  192::376     5e-06  24%  487 aa  MURC_ALISL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  157::236     7e-06  38%  452 aa  MURD_GEOSL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  108::440     7e-06  25%  458 aa  MURC_ACIC5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  105::210     9e-06  31%  455 aa  MURD_MYXXD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  158::346     9e-06  30%  459 aa  MURD_DESOH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  151::218     9e-06  43%  453 aa  MURD_CYAP4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   73::230     9e-06  34%  402 aa  MURD_CAMJR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::243     9e-06  41%  503 aa  MURD_BURVG RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::243     9e-06  41%  502 aa  MURD_BURCM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  110::446     9e-06  23%  464 aa  MURC_LEIXX RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  103::195     1e-05  34%  430 aa  MURD_THESQ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  110::420     1e-05  27%  446 aa  MURD_HAHCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  179::269     1e-05  36%  504 aa  MURD_BURXL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::243     1e-05  41%  502 aa  MURD_BURA4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   49::364     1e-05  27%  501 aa  MURC_NOCFA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  263::338     1e-05  30%  811 aa  MUDD_CHLCV RecName: Full=Bifunctional enzyme murC/ddl;Includes:
  161::418     1e-05  24%  444 aa  MURD_PARUW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   36::426     1e-05  24%  454 aa  MURD_LACSS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::306     1e-05  28%  438 aa  MURD_ERWCT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::334     1e-05  33%  467 aa  MURD_CHLP8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     1e-05  42%  503 aa  MURD_BURCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     1e-05  42%  503 aa  MURD_BURCA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  184::343     1e-05  25%  467 aa  MURC_SYNPX RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  122::378     1e-05  28%  491 aa  MURC_PHOLL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  184::376     1e-05  29%  496 aa  MURC_MYCPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  124::226     2e-05  35%  466 aa  MURD_BARQU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  105::355     2e-05  24%  457 aa  MPL_ECOLI RecName:
  100::414     3e-05  24%  430 aa  MURD_THELT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     3e-05  42%  503 aa  MURD_BURM1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::217     3e-05  34%  481 aa  MURD_BIFLO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::236     3e-05  31%  481 aa  MURD_BIFLI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  104::217     3e-05  34%  481 aa  MURD_BIFLD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  185::371     3e-05  24%  474 aa  MURC_SACD2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   77::361     3e-05  24%  484 aa  MURC_PSEA6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   55::363     3e-05  25%  468 aa  MURC_METRJ RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  107::307     3e-05  30%  438 aa  MURD_YERPN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::307     3e-05  30%  438 aa  MURD_YERPE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::307     3e-05  30%  438 aa  MURD_YERPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  143::470     3e-05  25%  504 aa  MURD_RALME RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   38::213     3e-05  28%  460 aa  MURD_LACJO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  107::238     3e-05  30%  446 aa  MURD_BAUCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   67::351     3e-05  26%  478 aa  MURC_SYNP6 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::351     3e-05  26%  478 aa  MURC_SYNE7 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  103::195     4e-05  33%  430 aa  MURD_THEP1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  159::421     6e-05  26%  464 aa  MURD_CHLCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  112::200     7e-05  33%  465 aa  MURD_THEFY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  102::305     7e-05  33%  440 aa  MURD_LAWIP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   35::417     7e-05  25%  430 aa  FOLC_BACSU RecName: Full=Folylpolyglutamate synthase;       
  157::324     1e-04  30%  446 aa  MURD_PELPD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  103::195     1e-04  34%  430 aa  MURD_THEMA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  160::223     1e-04  39%  461 aa  MURD_ACAM1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  120::346     1e-04  24%  479 aa  MURC_SYNR3 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  127::261     2e-04  27%  474 aa  MURD_THIDA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::242     2e-04  35%  433 aa  MURD_DESVV RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::242     2e-04  35%  433 aa  MURD_DESVH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  173::260     2e-04  28%  466 aa  MURD_AZOSE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  192::376     2e-04  22%  487 aa  MURC_VIBFM RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  192::376     2e-04  22%  487 aa  MURC_VIBF1 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  232::391     2e-04  23%  454 aa  MURC_DESDG RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  187::224     2e-04  47%  466 aa  MURD_DEIGD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  151::195     3e-04  38%  417 aa  MURD_CHLPN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   73::176     3e-04  34%  402 aa  MURD_CAMJE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  182::372     3e-04  19%  475 aa  MURC_WIGBR RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  159::372     4e-04  29%  464 aa  MURD_CHLPD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   73::176     4e-04  34%  402 aa  MURD_CAMJJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
   73::176     4e-04  34%  402 aa  MURD_CAMJ8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  114::377     4e-04  23%  483 aa  MURC_BUCAP RecName: Full=Putative UDP-N-acetylmuramate--L-alanine
   34::266     5e-04  29%  598 aa  YG23_SCHPO RecName: Full=Uncharacterized protein C19F5.03;       
  223::316     5e-04  29% 1294 aa  VWA3B_HUMAN RecName: Full=von Willebrand factor A domain-containing
   73::230     5e-04  31%  402 aa  MURD_CAMJD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  117::225     6e-04  30%  471 aa  MURD_PSYCK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  159::371     6e-04  26%  464 aa  MURD_PELPB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     6e-04  40%  504 aa  MURD_BURTA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  139::229     8e-04  32%  517 aa  MURD_LEIXX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  157::223     8e-04  36%  446 aa  MURD_GEOLS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  162::228     8e-04  42%  465 aa  MURD_CHLTE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURPS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURP6 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURP1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURP0 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURMS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURMA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURM9 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
  176::225     8e-04  40%  504 aa  MURD_BURM7 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate
    1::494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
MURE_BACSU      ------------EPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
MURE_BACA2      ------------EPVQNDFHDPDITSIEMDSREVRKGSLFVCIKGYTVDGHDFAQKXXXXXXXXXXXEKE
MURE_BACLD      -------------PSYAGQEDPDITSIEMDSREVKTGSLFVCIKGYTVDGHDYARQXXXXXXXXXXXERE
MURE_LISMO      ------------------SETIEISHIAQDSRKVKPGTLFICIDGEVVDGHKFASRAVELGAVAIIAEKQ
MURE_LISMF      ------------------SETIEISHIAQDSRKVKPGTLFICIDGELVDGHQFASRAVELGAVAIIAEKQ
MURE_LISIN      ----------------------EVNQIAQDSRKVQPGTLFICIDGEIVDGHQFADRAVQLGAVAIIAEKQ
MURE_GEOTN      ---------------VHRGGNPDIVALEMDSRHVTPGSLFFCVKGFTVDGHDFAEQAVERGAVAIVAERP
MURE_BACAN      -------------------ENPEITSIEADSRKVKEGSLFVCMKGYTVDSHDFXXXXXXXXXXXXXXERP
MURE_BACCR      -------------------ENPEITSIEADSRKVKEGSLFVCMKGYTVDSHDFXXXXXXXXXXXXXXERP
MURE_GEOKA      ---------------VHHGGNPDIVALEMDSRRVASGSLFFCLKGFTVDGHDFXXXXXXXXXXXXXXXXX
MURE_LACPL      --------------------DFDVTMLTQDTREVQPGAMFIAVVGYHVDGHDLVDQAIEKGAKIIVASKP
MURE_BACHD      --------------------NPDIHSIHMDSREVVEGGLFFCIKGYTVDGHDYAQQAVSNGAVAVVSXXX
MURE1_OCEIH     ----------------------EITSLEMDSRKITSGSAFVCITGFTVDGHDYVDQAVKNGASAIFTSKP
MURE_ALKMQ      -----------------------IENIYYDSRKVTPNSLFICIEGFQTDGHHFIDQAIKKGAIAIVAQKD
MURE1_CLOAB     ----------------------EIDNLNYDSRKVNEKGLFFCIEGYTSDGHDFIDKAVEKGADVIVCTKV
MURE_THETN      ---------------IKGNPNVDISGVCYDSRKAKPKYLFIAIKGFKTDGLLYVEEAIKNGAVAVVTDRD
MURE_CLOD6      ----------------------DINNVQYDSRKVTKGTLFICIKGFVSDGHKYIKDAIEKGASAFIVEED
MURE_CLOBH      -----------------------------DSRKVKEGDLFVCIEGYATDGHKYAKKAYDNGAKVIVCEKD
MURE_CLOB1      -----------------------------DSRKVKEGDLFVCIEGYATDGHKYAKKAYDNGAKVIVCEKD
MURE_SYNWW      --------------------DREISGIAYDSRRVKPGDLFICISGLKSDGHLFAGQAIENGAVAVLAERQ
MURE_CLOTE      ---------------LNGNIEIDIENIQYDSRNIKKNDIFFAIQGYSTDGHKFIESAIEKGAKVIVFDKG
MURE_STAHJ      --------------------DINVTDITTDSRTASEGSIFVASKGYTVDSHKFCQNVVDQGAKVIVVNHQ
MURE_ALKOO      ------------------NMDIDIEDIYFDSRFVTQKSLFICIEGFKTTGSLYINEAIQRGAVAILSEKE
MURE_STAES      --------------------DIQVDDITTDSRTAKEGSLFVASKGYTVDSHKFCQNVVDQGCGIVVVNRE
MURE_STAEQ      --------------------DIQVDDITTDSRTAKEGSLFVASKGYTVDSHKFCQNVVDQGCGIVVVNRE
MURE_STAAS      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQSVADQGCKLVVVNKE
MURE_STAAW      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQSVADQGCKLVVVNKE
MURE_STAAN      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQGCKLVVVNKE
MURE_STAAM      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQGCKLVVVNKE
MURE_STAAC      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQGCKLVVVNKE
MURE_STAA8      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQGCKLVVVNKE
MURE_STAA3      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQGCKLVVVNKE
MURE_STAA1      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQGCKLVVVNKE
MURE_STAAR      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQSVADQGCKLVVVNKE
MURE_STAAB      ------------------SLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQSVADQGCKLVVVNKE
MURE_FUSNN      --------------------DRKYDGIEYDSRKIKENYIFVAFEGANVDGHNYIDSAVKNGATCIIVSKK
MURE_CLOPE      ---------------IKGNEESKVQNIRYDNRKIEQGDAFVCVKGFKVDGHSFIGDAIKKGAKTLIVQED
MURE_AQUAE      -----------------------VKGITLNSKEVKKGYLFFAIKGTRFDGHNFIREAEERGAYAVVVERP
MURE_PARD8      -------------PMLMGADNVDITNIQSDSRRVTKGSLFVAVRGTAVDGHAYMDSAIEKGAVAIVCEET
MURE_GEOSL      ----------------------EINGLYCDSRQVRSGGLFFALKGVASDGHDFIASARERGAVAVVLEDE
MURE_COXBU      --------------------DVLIKALQTDSRKIQPGDLFIAYPGLQVDGRDYIKEALDKKAAAVFYEAN
MURE_HAEIG      --------------------DIELHNMVLDSRKVKAGDLFVAIKGHQVDGNQFIDSALHSGASAVVSETE
MURE_HAEIE      --------------------DIELHNMVLDSRKVKAGDLFVAIKGHQVDGNQFIDSALHSGASAVVSETE
MURE_THEEB      ----------------------EVKSLRMNSWECEPGSLFIGMPGTRVEGGNFWPSXXXXXXXXXVVSPQ
MURE_HAEI8      --------------------DIELHNMVLDSRKVKAGDLFVAIKGHQVDGNQFIDSALHSGASAVVSETE
MURE_HAEIN      --------------------DIELHNMVLDSRKVKAGDLFVAIKGHQVDGNQFIDSALHSGASAVVSETE
MURE_BACFR      ---------------ITGNQDIEITGVDIDSRQVESGHLFMAMHGTQTDGHAYIPAAVEKGATAILCEEE
MURE_BACFN      ---------------ITGNQDIEITGVDIDSRQVESGHLFMAMHGTQTDGHAYIPAAVEKGATAILCEEE
MURE2_OCEIH     -----------------------ISSISHNSRQVDDNSLFICISGFTVDGHNFVAEAVENGATCIVAERE
MURE_CHLAB      ----------------------EVRNLTRDSRNVGVGDIFIAKQGKHCDGNDFSHLAVENGAIA-VASSI
MURE_GLOVI      --------------------DIDIAGLSTDSRQVQPGDLFIGLPGTRVDGSEFWPQAIAGGAAGLVISRG
MURE_PASMU      ----------------------ELTEMILDSRAVKQGCLFVALQGHQVDGRQYIPQAIAKGASAVLAETE
MURE_BACV8      ----------------------EISGINMDSRLIEPGHIFVAVKGTQTDGHTYIQKAIEKGARTVVCENL
MURE_CHLFF      ----------------------EVRNLTKDSRNIGFGDIFIANKGKRCDGNDFASLAVENGAIAVVSSIY
MURE_CYTH3      --------------SVSGRTDVDVTAICFDSRKVEKGSMFIAVRGVSSDGHSFIADVIQKGATAVVCEEE
MURE_CHLPD      -----------------------VSMISSDSRDVLPGALFIAVRGYSADGHRFIKSAVERGAAAVLCEEI
MURE_BACTN      ----------------------EITGVNIDSRLVEAGQLFMAMRGTQTDGHAYIPAAIQKGATAILCEEE
MURE_ACTP2      -----------------------LKQMTLDSRQVDEGDLFVALKGHQVDGRRFIQKAIEQGAALVLAEAE
MURE_GEOMG      ----------------------EIEGLYCDSRQVRSGGLFFALRGVATDGHDYIVASRDRGAVAVVVESR
MURE_CHLMU      -----------------------VRNLTRDSRCTGVGDIFIARQGQMCNGNDYSGQAVENGAIAILSSLY
MURE_PSEPK      ------------------SRDPLIRELTLDSRSVRPGDLFLAVPGAKVDGREHIXXXXXXXXXXXXYEEQ
MURE_SOLUE      -------------PLAPELAQTEVTGLAYDSRRVTPGVLFFAFPGSKADGREFXXXXXXXXXXXVISESL
MURE_SYNY3      -----------------------VTGLSTNSHACPPGTLFIGMPGTRVDGGEFWSGALEAGAAAVVSEKA
MURE_HAES1      -------------------RDIELQEMILDSRLANTGCLFVAIKGHRVDGREFIMQAIQNGASAVLFETD
MURE_CHLTR      -----------------------VRNLTRDSRCVGVGDIFIARQGQFCNGNDYSSQAVANGAIAVLSSLN
MURE_CHLTA      -----------------------VRNLTRDSRCVGVGDIFIARQGQFCNGNDYSSQAVANGAIAVLSSLN
MURE_XYLFT      -------------PDIPQARDVVISGLVMDSREVQPGDAFVAVAGFGVHGLCFIEDACARGAVAILFEPP
MURE_ANAVT      --------------------DTEVKGIKTNSHACGAGDLFIGMPGTRVDGGEFPXXXXXXXXXXXXXPQA
MURE_ALCBS      -----------------------LSGLQLDSRKVMPGDAFLAVQGVASDGRQFVSQXXXXXXXXXXXXXQ
MURE2_CLOAB     -----------------------IEGISYNSKKVKQNYVFVSIKGARFDGHDFIKEAAQNGAAAVIIDED
MURE_SYNE7      --------------------DLAITGLQTDSRRCQPGDLFLGMPGTQVDGGQFWPEXXXXXTPTALAQRP
MURE_VIBVU      --------------------DITVQSLELDSRQVKQGDTFVAIVGHVVDGRQYIEKAIEQGANAVIAQSR
MURE_VIBVY      --------------------DITVQSLELDSRQVKQGDTFVAIVGHVVDGRQYIEKAIEQGANAVIAQSR
MURE_CHLTE      -----------------------ITGVTCDSRAVTPGALFVAVRGLVADGHHFXXXXXXXXXXXXXXXEA
MURE_VIBCH      -----------------------ITHLELDSRLIKSGDTFVAIQGHAVDGRQFIDKAIAQGANLVLAEAD
MURE_VIBPA      -------------------------------RKVQPGTTFVALVGHVVDGRKFIASAIEKGANAVIAQAT
MURE_XYLFA      -------------PDIPQARDVVISGLVMDSREVQPGDXXXXXXXXXXHGLCFIEDACARGAVAILFEPP
MURE_CHRVO      ------------DPALLQQLGLPIKRVEADSRRVLPGDVFLACRGEYADGRDFIPAALEKGAAAVLWDEK
MURE_CHLCV      ----------------------EVRNLTKDSRNVGFGDIFIANKGKQFDGNDFSPLAIENGAIAIASSIY
MURE_ANASP      --------------------DAEVKGIKTNSHACGAGDLFIGMPGTRVDGGEFPXXXXXXXXXXXXXPQA
MURE_PROM1      --------------------NPEIKNLSTDSREIEKGDLFLGLDGEKVDGGTFWAKAIERGACAAIISKK
MURE_PROMT      --------------------NPEIKNLSTDSREIEKGDLFLGLDGEKVDGGNFWAKAIERGACAAIISKK
MURE_LEPIN      -------------PSGKNPDSIEIEYIQSDSRKTNKNDIFCVADSIGSKKKEFISNAK---ASLILLRTD
MURE_LEPIC      -------------PSGKNPDSIEIEYIQSDSRKTNKNDIFCVADSIGSKKKEFISNAK---ASLILLRTD
MURE_PORGI      --------------------EQEVSDIASDSRKATDGALFVAVRGTLTDGHRYIPQAYTQGCRAFVVEDL
MURE_PROMP      -----------------DLIDKEINNISFNSKEVQKGTLFLGMPGLNVDGGKYCXXXXXXXXXXXXXXXX
MURE_LAWIP      ----------------------------IDSRKVEKGCVFVALPGSSVDGGLFIPDAVSRGAAYIVCEVE
MURE_XANAC      -------------PDVALTHDVQVSGLVMDSRAVRPGDAFVAIAGFGAHGLGFVEQARANGAAAVLFEPP
MURE_RICRI      -------------------QQHNVKGLSINSKTVKDKDIFFAIKGRNTDGNDFIKDALSKGAVLVITXXX
MURE_RICCN      -------------------QQHNVKGLSINSKTVKDKDIFFAIKGQNTDGNDFIKDALSKGAVLVITXXX
MURE_RICPR      -----------------------IKGLSTNSKTVKEDEVFFAIKGQNVDGNDFINDALNNGAVLVITENK
MURE_ROSS1      ------------EPAHMPPVNPEIAGVVYDSRAVTPGALFVAYRGFHTDGHAYIPQALERGAAAVVYEDP
MURE_LEPBL      -------------PSGKNPDSVPIEYIQSDSRKTNPEDIFCVPESIGTKKGEFISNTK---ASVILLHRS
MURE_LEPBJ      -------------PSGKNPDSVPIEYIQSDSRKTNPEDIFCVPESIGTKKGEFISNTK---ASVILLHRS
MURE_STRAW      -------------------RDAEVTGITHDSRAVRPGDLYAALPGARLHGADFVTQAAGLGAVAVLADRA
MURE_RICMO      -------------------QQHKVKGLSINSKTVKDKDVFFAIKGRNTDGNAFIKDALSKGAVLVITXXX
MURE_RICTY      ----------------------KINGLSTNSQTVKENEVFFALKGQNVDGNDFINDALNNGAVLVITENK
MURE_BRUSU      ------------ELASGEAGEVEITGITSDSRAVQRGFLFAALKGVKADGAVFAADAVKRGAVAIIAGKD
MURE_HAEDU      -----------------------LKQMTLDSRQVTEGDLFIALKGHQCDGRQFIQNAIEQGAAIILAEAE
MURE_YERPE      -----------------DVPERALREMTLDSRIAAAGDLFVAVVGHQTDGRRYIPXXXXDGVAPDVSVAE
MURE_RICBR      -----------------------VKGLSNNSKTIKANDAFFAIK----NGNDFIADALEKGAALVITDDK
MURE_PSESM      -------------------RDPLIRELTLDSRNVRPGDLFLAVPGIKVDGRAHIADALKRXXXXXXXXXX
MURE_NITEU      --------------------DVKVRHLVADSRKLKPGDTFLACAGERHDARNDIPQAIARGVNAIIWEKQ
MURE_JANMA      -----------------------------DSRRIAQGDVFVAYPGDEADGRSYIANAIERGAQAVIYEAD
MURE_CHLPN      ----------------------EVRNLTRDSRCVSVGDIFIAHKGQRYDGNDFAVDALANGAIAIASSLY
MURE_RALSO      ---------------------PAGADLTSDTRKLKTGDVFVAYVLGNVDGRPHIPQAIEAGVSAVLAEAH
MURE_CORGL      -----------------------IAAIGLDSSSLPTSAIFAAVPGTRTHGAQFAGTAILTDAAGLEVLNE
MURE_PROMA      -------------------KDLIIDSISCDSRHISKGGLFFGLPGEKVDGGIFWRKALXXXXXXXXXQKD
MURE_COREF      -------------------QDLEIHNIGLDSSTLKKAPIFAAVPGSRKHGAEFADTDRAAGALAVLTDRD
MURE_ERWCT      -------------PWVQDAPACALREMILDSRVAAAGDLFVAIVGHKADGRRYIPXXXXXXXXXXXXXRE
MURE_RHIME      -----------------DAATIEIGGITADSRQVKPGDLFVAVAGSKADGAAYIADALSRGASXXXXXXX
MURE_PSEMY      -----------------------IRELTLDSRKVRPGDLFLAVPGTQQDGRXXXXXXXXXXXXXXPMHAE
MURE_THEMA      --------------------DLEITGVSNHSSKVKKGDLFICRRGEKFDSHEIIPEVMEKGAVAVVVERE
MURE_STRCO      ----------------------EITGITHDSRAVRPGDLYAALPGARLHGADFVTQAAGLGAAAVLTDXX
MURE_XANOR      -------------PDVALPHDVQVSGLVMDSRTVAPGDAFVAIAGFGAHGLGFVEQARANGATAVLFEPP
MURE_XANOM      -------------PDVALPHDVQVSGLVMDSRTVAPGDAFVAIAGFGAHGLGFVEQARANGATAVLFEPP
MURE_RICFE      -------------------QKHNVKGLSINSKTVKENDIFFAIKGQNVDGNDFINEVLNQAVALVITDNK
MURE_BLOFL      ---------------------PYLTGLELDSRNINFGNLFIAIQGYNTDGRLHIDDAINNGAVAILSENN
MURE_PHOLL      -----------------DAPVRELREMTLDSRKSSAGDLFVAIKGHQTDGRHYIPXXXDNGTVQIMH---
MURE_NEIMA      --------------------------LHSDSRQIKQGDIFVACPGEYADGRSYIPAAVANGAAFVFWDDD
MURE_SALPA      ----------------------ELREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXEAK
MURE_ECO57      -------------PWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXKGEATDGEIRE
MURE_SALTY      ----------------------ELREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_SALTI      ----------------------ELREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_SALCH      ----------------------ELREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_ECOL6      -------------PWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_SHIFL      -------------PWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_SHEON      --------------------------LTLDSRAIRRGDVFLALPGHKVDGRQFIDKALAQGATAVLVHTD
MURE_ECOLI      -------------PWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_ENT38      -------------PWVQNVPARALREMVLDSRVAASGDLFVAVVGHQADGRRYXXXXXXXXXXXXXXXXK
MURE_MYCTU      ------------------TEDRTVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVVAEIA
MURE_MYCBO      ------------------TEDRTVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVVAEIA
MURE_SYNPX      --------------------DPQLTSITSDSRLVGEGSLFLGLPGERFDGGRFWRQXXXXXXXXXXXELP
MURE_BUCBP      -----------------------ISGIQSDSRLVKPGYLFCVLKKKNIETNKHMIHAIKNGAKIILYDKK
MURE_ZYMMO      -------------------KDYPVLGFAVDSRKVAKGFVFGAFPGAKVNGEDFIEKXXXXXXXXXXXRPE
MURE_AGRT5      -----------------------------DSRKAAPGSLFVAVAGTXXXXXXXXXXXXXXXXXXXXXXXX
MURE_TREDE      -----------------------INSVEYDSRKVKKGAAFFALPGIHTDGKKFINSAIENGAVCIFYEGD
MURE_BORBU      ---------------VKGSLDLEISGVTYSSKLVLPRFVFFALPGIHFDGHDFIEIAIQKGSNVVVCSRD
MURE_NEIMB      --------------------------LHSDSRQIKQGDIFVACPGEYADGRSYIPAAVANGAAFVFWDDD
MURE_MESSB      -----------------------ISGLASDSRRVNAGDLFFALQGSKXXXXXXXXXXXXXXXXXXXXXPG
MURE_BUCAI      -------------PWIKNIPKKYISNLKMDSRTLTPGDLFIAVPGIKKDGRHFIVQAINKKAAAILCETK
MURE_SYNPW      -----------------------VTALTCDSRCVGQGSLFIGLPGERVDGGSFPXXXXXXXXXVLIGEQA
MURE_CAUCR      --------------------DPVIAGVTADSRKVTTGWLFAALPGTKVDGRDFXXXXXXXXXXXXXXXXX
MURE_HELHP      ----------------------------------------------------------------------
MURE_PROMM      --------------------NPSLAMVSCDSRSVAQGCLFLGLPGEQVDGGSFWRQXXXXXXXXXXXXXX
MURE_PSEAE      -------------------RDLLIRELTLDSRGVRPGDLFLAVPGGRQDGRXXXXXXXXXXXXXXXXXXX
MURE_BRUME      ------------ELAPGEAGEVEITGITSDSRAVQRGFLFAALXXXXXXXXXXXXXXXXXXXXXXXXXXD
MURE_ACISJ      -------------------------TLQTDSRLIQPGDGFIAWPGAATDGRAHVGDAVARGAAACLVECE
MURE_BUCAP      -------------PWIKNTPQKKFSNLSLDSRKLTSKDVFIAIKGTKKDGNDFIFEAVKKRVVAILSETE
MURE_BORAP      ---------------VKGSLDLEISGVTYSSKLVLPGFVFFALPGIRFDGHDFIEMAIQNGSNVIVHSRD
MURE_XANCP      -------------PDVALARDVQVSGLVMDSRAVRPGDAFVXXXXXXXXXXXXXXXXXXXXXXXILFEXX
MURE_XANC8      -------------PDVALARDVQVSGLVMDSRAVRPGDAFVXXXXXXXXXXXXXXXXXXXXXXXILFEXX
MURE_MYCPA      --------------------DVTVTGVTLRAQDVLPGDLFAALPGATTHGARHAAEAIERGAVAVVAQLT
MURE_MYCA1      --------------------DVTVTGVTLRAQDVLPGDLFAALPGATTHGARHAAEAIERGAVAVVAQLT
MURE_MYCLE      --------------------DIPVTGVTLRAQEVLSGDLFAALAGASTHGARYAGVALERGAVAVVAELT
MURE_SODGM      -------------PWVPNAPGRVLREMTLDSRTAAAGDLFVAVAGHQTDGRRYIPXXXXXXXXXXXXXRE
MURE_SYNS3      --------------------DAVIESITCDSRCVGPGSVFIGLPGGRVDGGSFWPKALVDXXXXXXXXXX
MURE_RHILO      ------------------SADLEVTGISSDSRQVKPGVVFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
MURE_DEIRA      -------------PETDPQTDTEVTGVTHNAAWVQPGSAFVAIRGAKFDGHSFMXXXXXXXXXXXXXXXX
MURE_BORGA      ---------------VKGSLDLEISGVTYSSKLVLPRYVFFALPGIRFDGHDFIETAIQKGSNVIVCSRD
MURE_ALHEH      ---------------LTDADDRPVGGLAVDSRDIEPGFVFVALRGSRHHXXXXXXXXXXXXXXXXXWEPA
MURE_ANAMM      ----------------------QASGITADSRSVKPGFIFVCL---SEAAKGFVPDAVKAGAKFIVAGNH
MURE_TREPA      ----------------------DVSSIAYDSRAVREGSVFFALRGTHAHGAQYIHAAIDAGACAIVHDCP
MURE_HELPJ      ----------------------------------------------------------------------
MURE_WOLSU      ----------------------------------------------------------------------
MURE_HELPY      ----------------------------------------------------------------------
MURE_BRAJA      ----------------------EVTGVALDSRVVRPGDLFFALAGSKTXXXXXXXXXXXXXXXXXXXXXX
MURE_LEIXX      ----------------------------------------------------------------------
MURE_LACDB      --------------AVQDTVQTIMEAVSYDSRDVQNNSLFFC-KGAGFRP-TYLTMAKENGAIAYVAEQP
MURE_LACDA      --------------AVQDTVQTIMEAVSYDSRDVQNNSLFFC-KGAGFRP-TYLTMAKENGAIAYVAEQP
MURE_WIGBR      ---------------------------------------FIALYGNCNHGKNFIFEAIKNGSSIILIETK
MURE_STRTD      --------------------------LSYDSRDITPSTLFFAKAGFKLE---FLESAVQAGLGFYVAEKD
MURE_STRT2      --------------------------LSYDSRDITPSTLFFAKAGFKLE---FLESAVQAGLGFYVAEKD
MURE_STRT1      --------------------------LSYDSRDITPSTLFFAKAGFKLE---FLESAVQAGLGFYVAEKD
MURE_LACS1      ---------------VVNEQKLTFENVTYDSRKVSDNTLFFCKGNFKPS---YLTSALEKGATAYVSEQK
MURE_STRMU      --------------------NPEVAHISYDSRDIKASTLFF-VKGATFK-KEFLEKAIESGLTFYVAEKD
MURE_STRSY      --------------------DVQFDALSYDSRTVSPMTLFFA-KGLAFK-KEFLEKAIEAGLAFYVSEIN
MURE_STRS2      --------------------DVQFDALSYDSRTVSPMTLFFA-KGLAFK-KEFLEKAIEAGLAFYVSEIN
MURE_LACC3      --------------AIQNTEDVDMTGIAYDSRKVSGPTLFFC-KGDKFRPI-YLSMAKDNGARTYVAEKP
MURE_CAMJE      ----------------------------------------------------------------------
MURE_LACRD      ---------------VSNLTDFTATSVSYDSRKVKSGTLFFCKGNFLPK---YLASAKEKGAIAYVAEKE
MURE_STRR6      -------------------------SISYDSRKVTEDTLFFA-KGAAFK-KEYLLSAITQGLAWYVAEKD
MURE_STRP2      -------------------------SISYDSRKVTEDTLFFA-KGAAFK-KEYLLSAITQGLAWYVAEKD
MURE_STRSV      -------------------------SISYDSREADASTLFF-VKGEAFK-KEFLEKAVSVGLRFYISETD
MURE_LACAC      --------------AVQDTVATKMDYVSYDSRDIQTNTLFFC-KGAGFRP-TYLSMAKSNGANCYVAEQP
MURE_STRPN      -------------------------SISYDSRKVTEDTLFFA-KGAAFK-KEYLLSAITQGLAWYVAEKD
MURE_STRPF      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRPG      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRPD      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRPC      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRP8      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRP6      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRP1      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRP3      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_STRPM      --------------------------LSYDSRQVDGKTLFFA-KGATFKA-DYLKEAITNGLQLYISEVD
MURE_ENTFA      ----------------------EVTALSYDSRDVTAETLFFC-KGLNFK-EIYLENAVKDGLEIYVSEVP
MURE_LACSS      --------------ALNGDSNLNMTGIAYDSRKVTADTLFFCKGNFRPV---FLTNAKEAGAVTYVAEQP
MURE_TROW8      ----------------NQFSDRFVSGITQIAQSVERDDIFVAFQGKTRHGVEFLDQ-VQSCAAVLTDNKG
MURE_TROWT      ----------------NQFSDRFVSGITQIAQSVERDDIFVAFQGKTRHGVEFLDQ-VQSCAAVLTDNKG
MURE_STRA3      ----------------NWTQNVTFNALSYDSRQISSDTLFFA-KGATFK-KEYLDSAITAGLSFYVSEID
MURE_STRA1      ----------------NWTQNVTFNALSYDSRQISSDTLFFA-KGATFK-KEYLDSAITAGLSFYVSEID
MURE_STRA5      ----------------NWTQNVTFNALSYDSRQISSDTLFFA-KGATFK-KEYLDSAITAGLSFYVSETD
MURE_LACLS      ----------------NWPKEVNFDQLSYDSRKSTKDTLFFA------KGLNFKKEYLTDLEAAFVSEFD
MURE_LACLM      ----------------NWPKEVNFDQLSYDSRKSTKDTLFFA------KGLNFKKEYLTDLEAAFVSEFD
MURE_LACLA      ----------------NWPKEVNFDQLSYDSRKSTENTLFFA------KGLNFKKEYLTDLEAAFVSEFD
MURE_BIFLO      ------------DPARIASADEPFAGITYDTRKVTPGTLLCCKGQFKAE---YLNGIDEAGLAAYVAETE
MURF_BUCBP      -----------------------IHSITTDTRKITPKCLFIALIGKNFDAHMFVNEAISKGAAALLLEKQ
MURC_AQUAE      ----------------------------------------------------------------------
MURC_DESHY      --------------------------------------------------------------------RA
MURC_GEOUR      --------------------------------------------GYKVSGSDLRKTEITERLEGLGGERE
MURC_ALKMQ      --------------------------------------------GYHISGSDMKEKLRDHGAEIFIGHAS
MURC_DESAH      --------------------------------------------GYRVSGSDLKLSAITQRLASCGATKD
MURC_DICTD      ---------------------------------------YICVRGYEVSGSDIQERLKSKGVKIYKGHNP
MURC_CLOB6      ----------------------------------------------------------------------
MURC_STACT      ------------------------------------------VQGSDIDQYVFTEKALRNKGIKILPFNP
MURC_CLOP1      --------------------------------------------GYKVSGSDSKESEITNGAKIYIGHQD
MURF_ECOLI      --------------------DITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAGGAGALLVSRP
MURC_CLOBL      ----------------------------------------------------------------------
MURC_CLOBH      ----------------------------------------------------------------------
MURC_CLOB1      ----------------------------------------------------------------------
MURC_GEOTN      --------------------------------------------GYTVQGSDFTQKALEERGIPVLPFSK
MURC_CLOPS      --------------------------------------------GYKVSGSDSKESEITNGAKIYIGHQD
MURC_CLOPE      --------------------------------------------GYKVSGSDSKESEITNGAKIYIGHQD
MURF_RICCN      --------------------------VQFNSKDVKKGNLFIALQGNR-DGHDYVLDAIDKGAAAVIISKR
MURC_CLOBK      ----------------------------------------------------------------------
MURC_CLOB8      --------------------------------------------GYSVSGSDFKDSAISSGAEIYIGHRR
MURD_IDILO      -------------------------------------------------------------ADLIIASPG
MURC_CALS8      ----------------------------------------------------------------------
MURC_CLOBM      ----------------------------------------------------------------------
MURC_CLOBJ      ----------------------------------------------------------------------
MURF_RICMO      --------------------------VQFNSKDVKKGDLFIALQGNR-DGHDYVLDAIDKGAAAVIISKQ
MURC_CLOTH      ----------------------DIRSSNITSKLEKKG-----IKIYT--GH--SEENIKD-ADLVVYTAA
MURF_HAEIN      -------------------ENVQVEKINTDTRKSVSNSLFFALKGEKFDAHQYLDQAVSQGALALVVQQE
MURC_STAAW      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAU      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAT      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAS      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAN      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAM      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAE      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAAC      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAA9      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAA8      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAA3      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAA2      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_STAA1      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_DESAA      ----------------------------------------------------------------------
MURC_STAAR      ------------------------------------------VQGSDIENYVFTEVALRNKGIKILPFDA
MURC_BACLD      ----------------------------------------------------------------------
MURC_GEOSW      ---------------------------------------------YTVQGSDFTQKALEERGIPILPFNK
MURC_GEOKA      --------------------------------------------GYTVQGSDFTQKALEEGYTVIAGNAF
MURC_BACHD      ----------------------------------------------------FQKENIKEGQQVVVSAAY
MURC_RHORT      ----------------------------------------------------------------------
MURF_RICPR      ------------------SNSVNCNEVQFNSKDVKKGDLFIALQGNR-DGHDYIQDAIDKGATAVIVSKQ
MURC_SULSY      ----------------------------------------------------------------------
MURC_PARL1      --------------------------------------------GYTVQGSDLADSANVKGIKVFIGQKA
MURC_FRATM      ----------------------------------------------------------------------
MURC_BACP2      --------------------------------------------GYTVQGSDFTQKALEERNIKILPFDP
MURC_ALKOO      ----------------------------------------------------------------------
MURC_PEDPA      -------------------------------------------EGYKVEGSDFTQKGLEAAGIKILPFDP
MURC_FRATH      ----------------------------------------------------------------------
MURC_FRATF      ----------------------------------------------------------------------
MURC_EUBE2      ----------------------------------------------------------------------
MURC_CLOTE      ----------------------------------------------------------------------
MURC_ANOFW      ----------------------------------------------------------------IVAARE
MURC_THETN      ----------------------------------------------------------------------
MURD_BACCR      ---------------------------------------------------------LERNISLVVKNPG
MURC_FRATT      ----------------------------------------------------------------------
MURC_FRAT1      ----------------------------------------------------------------------
MURC_BACSU      --------------------------------------------GYTVQGSDFTQTALEKRNITILPFSA
MURD_ZYMMO      ------------------------------------------------------------GISAFVVSPG
MURD_BACC4      ---------------------------------------------------------LERNISLVVKNPG
MURC_OCEIH      ----------------------------------------------------------------------
MURC_MESSB      --------------------------------------------GYHVQGSDQAENANEKGIKAFIAENL
MURC_LISW6      ------------------------------------------VQGSDVDKYFFTQKALEEKQIPIMTFSA
MURC_LISMO      ------------------------------------------VQGSDVDKYFFTQKALEEKQIPIMTFSA
MURC_FRATW      ----------------------------------------------------------------------
MURD_STAAW      ----------------------------------------------------------------------
MURD_STAAU      ----------------------------------------------------------------------
MURD_STAAT      ----------------------------------------------------------------------
MURD_STAAS      ----------------------------------------------------------------------
MURD_STAAR      ----------------------------------------------------------------------
MURD_STAAN      ----------------------------------------------------------------------
MURD_STAAM      ----------------------------------------------------------------------
MURD_STAAE      ----------------------------------------------------------------------
MURD_STAAC      ----------------------------------------------------------------------
MURD_STAAB      ----------------------------------------------------------------------
MURD_STAA9      ----------------------------------------------------------------------
MURD_STAA8      ----------------------------------------------------------------------
MURD_STAA3      ----------------------------------------------------------------------
MURD_STAA2      ----------------------------------------------------------------------
MURD_STAA1      ----------------------------------------------------------------------
MURC_LISMF      ------------------------------------------VQGSDVDKYFFTQKALEEKQIPIMTFSA
MURC_LISMC      ------------------------------------------VQGSDVDKYFFTQKALEEKQIPIMTFSA
MURC_LISIN      ------------------------------------------VQGSDVDKYFFTQKALEEKQIPIMTERA
MURD_BACHK      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACC3      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACC2      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACAH      ---------------------------------------------------------LERNISLVVKNPG
MURC_STAHJ      ------------------------------------------VQGSDIEKYVFTEVALKNKGIKILPFNA
MURC_OCHA4      -------------------------------------------------------------AEVVVVSTA
MURC_ENTFA      -------------------------------------------KGYNVQGSDFTQRDLEKSGVPILPFNA
MURC_WOLWR      ----------------------------------------------------------------------
MURC_HYPNA      ------------------------------------------------------------GAGTVIISTA
MURC_BARQU      ----------------------------------------------------------------------
MURD_BACCZ      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACC0      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACAN      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACAC      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACAA      ---------------------------------------------------------LERNISLVVKNPG
MURC_MOOTA      ----------------------------------------------------------------------
MURC_LISMH      ------------------------------------------VQGSDVDKYFFTQKALEEKQIPIMTFSA
MURC_STAES      ------------------------------------------VQGSDIESYVFTEVALRNKGIKILPFDA
MURC_STAEQ      ------------------------------------------VQGSDIESYVFTEVALRNKGIKILPFDA
MURF_BUCAI      -----------------------INEIVIDTKKIIPGCLFIALIGRKFDAHIFIHDALKKKCAAFVTQKN
MURD_STRA5      ----------------------------------KLGAIVTVNDGKPFDENPTAQSLLEEGIKVVCGSHP
MURD_STRA1      ----------------------------------KLGAIVTVNDGKPFDENPTAQSLLEEGIKVVCGSHP
MURD_BACCQ      ---------------------------------------------------------LERNISLVVKNPG
MURC_FRATN      ----------------------------------------------------------------------
MURC_CHRVO      ----------------------------------------------------------------------
MURD_STAHJ      ----------------------------------------------------------------------
MURD_BACWK      ---------------------------------------------------------LERNISLVVKNPG
MURD_BACC1      ---------------------------------------------------------LERNISLVVKNPG
MURC_UNCTG      ----------------------------------------------------------------------
MURC_PERMH      -------------------------------------------------GHD--PKNVD-GADVVVYSSA
MURC_GEOSF      ---------------------------------------------------------VERADVVVISSAV
MURC_RHIEC      ----------------------------------------------------------------------
MURC_POLSJ      ---------------------------------------------------------------AVVTSTA
MURC_AZOSB      -------------------------------------------------GHDAAN--VEAADALVVSTAV
MURC_ANATD      ----------------------------------------------------------------------
MURD_BACC7      ---------------------------------------------------------LERNISLVVKNPG
MURC_GRAFK      ----------------------------------------------------------------------
MURD_STRA3      ----------------------------------KLGAIVTVNDGKPFDENPTAQSLLEEGIKVVCGSHP
MURC_FRAP2      ----------------------------------------------------------------------
MURD_EXIS2      -----------------------------------------------------------DGTDLIVKNPG
MURC_WOLPM      ----------------------------------------------------------------------
MURC_RHOCS      ----------------------------------------------------------------------
MURC_RHILO      ----------------------------------------------------------------------
MURC_PELTS      ----------------------------------------------------------------------
MURC_CLOAB      ------------------------------------------VSGSDMNGSPMIDKLKEHGAEIYLGHNE
MURF_BACSU      -----------------------IHGVATDTRKLEQHQLFIPLKGERFDGHSFVEQAFEAGVAAVLWDRS
MURD_LEUCK      ----------------------------------------------------------------------
MURC_STAS1      ------------------------------------------VQGSDIKNYVFTEVALKNNGIKILPFDA
MURC_LEUMM      ------------------------------------------VLGSDIDTYTYTQAPLEAAGIKILTARN
MURC_EXISA      ----------------------------------------------------------------------
MURC_DESPS      ----------------------------------------------------------------------
MURC_BACCN      -----------------------ISILPFDKNNIKEGQVIIAGNAFP-DTHE-----------EIMAAKE
MURC_LACAC      ----------------------------------------------------------------------
MURC_BARHE      ----------------------------------------------------------------------
MURC_BACCQ      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURD_SOLUE      --------------------------------------------------------AVFEGYDLIVPSPD
MURC_NITEC      --------------------------------------------------------AAENSADAVVISTA
MURC_ERYLH      -------------------------------------------------GH--APENIEN-AAVVVTSTA
MURC_BRASB      ----------------------------------------LCNLGYTVQGSDASDNAAENGADVVVVSTA
MURC_ACIF5      -------------------------------------------------GHEAANV---RGADVVVISSA
MURC_ACIF2      -------------------------------------------------GHEAANV---RGADVVVISSA
MURD_BACFR      -----------------------------------------------LDGHGIAWEEGRHTEEQILSADE
MURD_BACFN      -----------------------------------------------LDGHGIAWEEGRHTEEQILSADE
MURD_BACCN      ---------------------------------------------------------LERNIALVVKNPG
MURC_SYNAS      ----------------------------------------------------------------------
MURC_RHIL3      ----------------------------------------------------------------------
MURC_FUSNN      ----------------------------------------------------------------------
MURC_ACAM1      ----------------------------------------------------------------------
MURC_RHOFD      ----------------------------------------------TYVGHEAAHVA---GADAVVTSTA
MURC_METFK      --------------------------------------------------------AVKDDNPEVVAARE
MURC_LACDB      ----------------------------------------------------------------------
MURC_LACDA      ----------------------------------------------------------------------
MURC_BRASO      ----------------------------------------LCNLGYTVQGSDASDNAAENGADVVVVSTA
MURC_BARBK      ----------------------------------------------------------------------
MURC_ANASK      --------------------------------------------GYTVSGSDLRESETTRRLAGLAAENV
MURC_ANAD2      --------------------------------------------GYTVSGSDLRESETTRRLAGLAAENV
MURC_AGRT5      -------------------------------------------------------------AEVVVVSTA
MURD_STAES      ----------------------------------------------------------------------
MURC_PHEZH      -------------------------------------------------GHD--AKNVE-GAYAIVYSTA
MURC_LACPL      -------------------------------------------KGYQVEGSDIEQYTTQKGLAAVIAGNS
MURC_CLONN      ----------------------------------------------------------------------
MURC_CLOD6      ----------------------------------------ICIKGYQVSGSDLLDKLRDQGATIYIGQKK
MURC_CLOBA      ----------------------------------------------------------------------
MURC_BACSK      ----------------------------------------------------FSRDNIKNGQHVIVSAAY
MURC_BACHK      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACCZ      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACC7      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACC3      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACC1      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACC0      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACAN      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACAH      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACAC      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_BACAA      -----------------------ISILPFDKSNVKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURC_ANADE      --------------------------------------------GYTVSGSDLRESETTRRLAGLAAENV
MURC_ALHEH      ----------------------------------------------------------------------
MURC_POLNS      --------------------------------------------GYQVSGSDLAEGAVTKRTEAVVISTA
MURC_NITMU      -------------------------------------------------GH--ARTHVESADAVVTSTAI
MURC_LACGA      ----------------------------------------------------------------------
MURC_BACCR      ----------------------------------------------------FDKNNVEEGQVIIAGNAF
MURC_BACC4      ----------------------------------------------------FDKNNVEEGQVIIAGNAF
MURC_BACA2      ----------------------------------------------------------------------
MURC_MAGSM      -------------------------------------------------------QAIE-GADAVVTSSA
MURC_MACCJ      -------------------------------------------KGITI--LPFNQENIKEGMTIIAGNAF
MURC_CLOBB      --------------------------------------------GYKVSGSDFKESEILSGADIYIGHSE
MURC_BACC2      ----------------------------------------------------FDKNNVEEGQVIIAGNAF
MURC_OENOB      ----------------------------------------------------------------------
MURC_LYSSC      ----------------------------------------------------------------------
MURC_LACS1      ------------------------------------------VLGSDIDKYTFTQRGLENAGIKILPFDE
MURC_BACWK      -----------------------ISILPFDKNNIKEGQVIIAGNAFP-DTHE-----------EIVAAKE
MURD_STAEQ      ----------------------------------------------------------------------
MURD_ACIB5      ----------------------------------------------------------------------
MURD_ACIB3      ----------------------------------------------------------------------
MURC_SALRD      ----------------------------------------------------------------------
MURC_NITEU      --------------------------------------------------------AAENSADAVVISTA
MURC_HYDS0      ----------------------------------------------------------------------
MURD_WOLTR      ----------------------------------------------------------------------
MURD_ACIBC      ----------------------------------------------------------------------
MURC_ROSS1      ------------------------------------------------DGHDPAWIA---GADALVATSA
MURC_MAGSA      ----------------------------------------------------------------------
MURC_LACJO      ----------------------------------------------------------------------
MURD_ROSDO      ----------------------------------------------------------------------
MURC_RICBR      ----------------------------------------------------------------------
MURC_RICB8      ----------------------------------------------------------------------
MURC_RALSO      --------------------------------------------GYRVTGSDLGQSAATQGANAVVVSTA
MURD_PROMP      ----------------------------------------------------------------------
MURD_ACIBT      ----------------------------------------------------------------------
MURC_THESQ      ----------------------------------------------------------------------
MURC_THEMA      ----------------------------------------------------------------------
MURC_SHEVI      -------------------------------------------EGYRLSGSDIAENAVTHGTDVVVVSTA
MURC_PROAC      ----------------------------------------------------------------------
MURC_LACBA      -------------------------------------------KGFKVQGSDFTQRGLEQAGIDVMAFDE
MURC_FLAJ1      ----------------------------------------------------------------------
MURC_DESRM      --------------------------------------------GYQVSGSDIKRSAVNNEIDAVVYSTA
MURC_BURM1      --------------------------------------------GYQVSGSDLARNAVTDGANAVVVSTA
MURC_THEP1      ----------------------------------------------------------------------
MURC_RUTMC      ----------------------------------------------------------------------
MURC_ROSDO      ----------------------------------------------------------------------
MURC_BURVG      --------------------------------------------GYEVSGSDLSRNAVTDGANAVVVSTA
MURC_AGRVS      ----------------------------------------------------------------------
MURD_ALKMQ      ----------------------------------------------------------------------
MURC_VESOH      ----------------------------------------------------------------------
MURC_SPHWW      --------------------------------------------GYKVQGSDVAESYVVEGAAVVVTSTA
MURC_LACSS      ----------------------------------------------------------------------
MURC_CAUCR      -------------------------------------------------GHDAAHV---EGASAIVYSTA
MURC_CAUCN      -------------------------------------------------GHDAAHV---EGASAIVYSTA
MURC_BORA1      --------------------------------------------GYTVSGSDLSESTVENDADAIVTSTA
MURC_BART1      ----------------------------------------------------------------------
MURD_PROMM      ----------------------------------------------------------------------
MURD_DESHD      ----------------------------------------------------------------------
MURC_LARHH      ----------------------------------------------------------------------
MURC_CHLPB      ----------------------------------------------------------------------
MURC_BURS3      --------------------------------------------GYEVSGSDLSRNAVTDGANAVVVSTA
MURC_BURCJ      --------------------------------------------GYAVSGSDLSRNAVTDGANAVVVSTA
MURC_BRUSU      -------------------------------------------------------------AEVIVVSTA
MURC_BRUSI      -------------------------------------------------------------AEVIVVSTA
MURC_BRUO2      -------------------------------------------------------------AEVIVVSTA
MURC_BRUME      -------------------------------------------------------------AEVIVVSTA
MURC_BRUMB      -------------------------------------------------------------AEVIVVSTA
MURC_BRUC2      -------------------------------------------------------------AEVIVVSTA
MURC_BRUAB      -------------------------------------------------------------AEVIVVSTA
MURC_BRUA2      -------------------------------------------------------------AEVIVVSTA
MURC_BRUA1      -------------------------------------------------------------AEVIVVSTA
MURC_LEUCK      ----------------------------------------------------------------------
MURC_CAUSK      -------------------------------------------------GHDAAHV---EGASAIVYSTA
MURC_BUCBP      -----------------------------------------------------------NRSDVIVISSA
MURD_RHOS5      ----------------------------------------------------------------------
MURD_BACSU      -----------------------------------------------------AQKLSEKGIEVVCGEHP
MURC_VEREI      ----------------------------------------------------------------------
MURC_VARPS      ----------------------------------------------------------------------
MURD_BACTN      ----------------------------------------------------------------------
MURC_RICFE      ----------------------------------------------------------------------
MURD_NEIMA      -----------------------------------------------------------------ISERQ
MURC_ZYMMO      ----------------------------------------------------------------------
MURC_SILST      ----------------------------------------------------------------------
MURC_RICAH      ----------------------------------------------------------------------
MURC_MYXXD      ----------------------DLRESDITRRLVRMGATFF-------EGHR-AQNLIQADVVVISSAVR
MURC_LACH4      ----------------------------------------------------------------------
MURC_EXIS2      ----------------------------------------------------------------------
MURC_EUBR3      ----------------------------------------------------------------------
MURC_CYAP7      ----------------------------------------------------------------------
MURC_ACIBL      --------------------------------------------GYKVSGSDLKPSAVTEGAEVVVTSSA
MURD_PROM5      ----------------------------------------------------------------------
MURD_BDEBA      ----------------------------------------------------------------------
MURD_ACIAD      ----------------------------------------------------------------------
MURC_STRMU      ------------------------------------------VQGSDVDKYYFTQHGLEKAGIPILPFAE
MURC_RHOPT      ----------------------------------------LCNLGYTVQGSDASESANVNGADVLVVSTA
MURC_POLSQ      -------------------------------------------------------------AEAVVISTA
MURC_CORDI      ----------------------------------------------------------------------
MURD_RHOSK      ----------------------------------------------------------------------
MURD_RHOS4      ----------------------------------------------------------------------
MURD_RHOS1      ----------------------------------------------------------------------
MURD_DESHY      ----------------------------------------------------------------------
MURC_RUBXD      ----------------------------------------------------------------------
MURC_RHOPA      ----------------------------------------LCNLGYTVQGSDASESANVNGADVLVVSTA
MURC_CYTH3      ----------------------------------------------------------------------
MURC_AZOC5      --------------------------------------------GYTVQGSDVAENANENGIAVTVGHKA
MURD_JANSC      ----------------------------------------------------------------------
MURC_LACLA      ----------------------------------------------------------------------
MURC_GLUOX      -------------------------------------------------GHDAANLG---DAQVVVTSTA
MURC_BORPA      -------------------------------------------------GHDRANVA---GAGAIVTSTA
MURC_BORBR      -------------------------------------------------GHDRANVA---GAGAIVTSTA
CPHA_SYNY8      ----------------------------------------------------------------------
MURD_RICBR      ----------------------------------------------------------------------
MURD_PASMU      ----------------------------------------------------------------------
MURC_STREM      ----------------------------------------------------------------------
MURC_STRE4      ----------------------------------------------------------------------
MURC_BORPE      -------------------------------------------------GHDRANVA---GAGAIVTSTA
MURC_BEII9      --------------------------------------------GYHVQGSDAAENAPENDAAVVVVSTA
MURF_STRTO      ----------------------------LDSRQAEPGGLFVAFAGEHADGHDYAEXXXXXXXXXXLGSRP
MURD_NEIG2      -----------------------------------------------------------------ISERQ
MURC_SYNS3      ----------------------------------------------------------------------
MURC_STRS7      ----------------------------------------------------------------------
MURC_RICRS      ----------------------------------------------------------------------
MURC_RICRO      ----------------------------------------------------------------------
MURC_RHOPB      ----------------------------------------LCNLGYTVQGSDASEGAAENGADVVVVSTA
MURC_GEOSL      ----------------------------------------------------------------------
MURC_DICT6      ----------------------------------------------------------------------
MURC_BURCH      --------------------------------------------GYAVSGSDLSRNAVTDGANAVVVSTA
MURC_BURCA      --------------------------------------------GYAVSGSDLSRNAVTDGANAVVVSTA
MURD_SHEVI      ----------------------------------------------------------------------
MURD_NEIG1      -----------------------------------------------------------------ISERQ
MURD_CARHZ      ----------------------------------------------------------------------
MURC_SINMW      ----------------------------------------------------------------------
MURC_RICPU      ----------------------------------------------------------------------
MURC_RALPJ      ------------------------------------------------------------GANAVVVSTA
MURC_DICNV      ----------------------------------------------------------------------
MURD_NEIMF      -----------------------------------------------------------------ISERQ
MURC_THENN      ----------------------------------------------------------------------
MURC_RICM5      ----------------------------------------------------------------------
MURC_RICCN      ----------------------------------------------------------------------
MURC_RHOPS      ----------------------------------------LCNLGYTVQGSDASESANVNGADVLVVSTA
MURC_RHOP2      ----------------------------------------LCNLGYTVQGSDASESAADNGADVLVVSTA
MURC_ORITB      ----------------------------------------------------------------------
MURC_GEOLS      ----------------------------------------------------------------------
MURC_CARHZ      -------------------------------------------KGYRVSGSDLKEKLRAEGITVFIGHRE
MURC_BURCC      --------------------------------------------GYAVSGSDLSRNAVTDGANAVVVSTA
CPHA_ANAVT      ----------------------------------------------------------------------
CPHA_ANASP      ----------------------------------------------------------------------
MURD_STRPZ      ----------------------------------------------------------------------
MURD_STRPY      ----------------------------------------------------------------------
MURD_STRPM      ----------------------------------------------------------------------
MURD_STRPG      ----------------------------------------------------------------------
MURD_STRPF      ----------------------------------------------------------------------
MURD_STRPD      ----------------------------------------------------------------------
MURD_STRPC      ----------------------------------------------------------------------
MURD_STRPB      ----------------------------------------------------------------------
MURD_STRP8      ----------------------------------------------------------------------
MURD_STRP6      ----------------------------------------------------------------------
MURD_STRP3      ----------------------------------------------------------------------
MURD_STRP1      ----------------------------------------------------------------------
MURD_ACIBL      ----------------------------------------------------------------------
MURC_SYMTH      ----------------------------------------------------------------------
MURC_LACLM      ----------------------------------------------------------------------
MURD_SILPO      ----------------------------------------------------------------------
MURC_STRA3      ----------------------------------------------------------------------
MURC_RICCK      ----------------------------------------------------------------------
MURC_PROA2      ----------------------------------------------------------------------
MURC_LACLS      ----------------------------------------------------------------------
MURC_BRAHW      --------------------------------------------GFTITGSDLAKTAIEDDVTAVVTSSA
MURC_STRSY      ------------------------------------------VQGSDVEKYYFTQRGLEQAGIQILPFDE
MURC_STRS2      ------------------------------------------VQGSDVEKYYFTQRGLEQAGIQILPFDE
MURC_STRA5      ----------------------------------------------------------------------
MURC_STRA1      ----------------------------------------------------------------------
MURF_TREPA      --------------------------VSFDSRAVVPRDLFIPLRGAHVDGHTFVEEALQKGAVATLIDQR
MURD_RICPR      ----------------------------------------------------------------------
MURD_PROVI      ----------------------------------------------------------------------
MURC_SORC5      ----------------------------------------------------------------------
MURC_SOLUE      ------------------------------------------------------------GARALVVSSA
MURC_RHIME      ----------------------------------------------------------------------
MURC_NITHX      ----------------------------------------LCNLGYTVQGSDASEGAAENGADVLVVSTA
MURC_CYAA5      ----------------------------------------------------------------------
MURF_BORBU      -----------------------VSFYSLDSREIKNDSLYFAYKGNKVDGFSFVKYLIDLGVKCFACSRE
MURC_STRGG      ----------------------------------------------------------------------
MURC_NITWN      ----------------------------------------LCNLGYTVQGSDASEKGVKNGADVLVVSTA
MURC_GEOMG      ----------------------------------------------------------------------
MURC_ENTS8      -------------------------------------------EGYQISGSDLAPNAVTQQLTALGAENV
MURC_DESOH      ----------------------------------------------------------------------
MURD_SPHAL      -----------------------------------------------------------------IAAHA
MURC_XANC5      ----------------------------------------------------------------------
MURC_SYNJA      ----------------------------------------------------------------------
MURC_SPHAL      --------------------------------------------GYRVQGSDIADSYVENGVAVVVTSTA
MURC_RICPR      ----------------------------------------------------------------------
MURD_WOLPM      ----------------------------------------------------------------------
MURD_SYNS9      ----------------------------------------------------------------------
MURD_PARDP      ----------------------------------------------------------------------
MURD_NEIM0      -----------------------------------------------------------------ISERQ
MURD_LEUMM      ---------------------------EFDAQDATYRSLLAA--DVTLIGTDNAE-TLDSTYDYLIKNPG
MURD_HAEIG      ----------------------------------------------------------------------
MURD_CLOTE      ----------------------------------------------------------------------
MURC_XANCP      ----------------------------------------------------------------------
MURC_XANCB      ----------------------------------------------------------------------
MURC_XANC8      ----------------------------------------------------------------------
MURC_RICAE      ----------------------------------------------------------------------
MURC_NOVAD      ----------------------------------------------------------------------
MURC_LAWIP      ----------------------------------------------------------------------
MURC_BREBN      -------------------------------------------------GHNAAHV---EGADSIVYSTS
MURD_PETMO      -------------------------------------------------------------AAKIIFENN
MURD_HAEIN      ----------------------------------------------------------------------
MURD_DINSH      ----------------------------------------------------------------------
MURD_DESPS      ----------------------------------------------------------------------
MURC_XANAC      ----------------------------------------------------------------------
MURC_STRP8      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_BORPD      --------------------------------------------GYTISGSDLQESAVTRGAGAIVTSTA
MURD_SYNSC      ----------------------------------------------------------------------
MURC_STRPZ      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRPG      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRPF      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRPD      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRPC      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRPB      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRP6      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRP3      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_STRP1      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURC_ROSCS      ----------------------------------------------------------------------
MURC_RHISN      ----------------------------------------------------------------------
MURC_DELAS      ----------------------------------------------------------------------
MURC_BURCM      ----------------------------------------------------------------------
MURC_BURA4      ----------------------------------------------------------------------
MURD_BACP2      ----------------------------------------------------------------------
MURC_RICTY      ----------------------------------------------------------------------
MURD_BRUME      ----------------------------------------------------------------------
MURC_SYNJB      ----------------------------------------------------------------------
MURC_STRPM      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPFSE
MURD_STACT      ----------------------------------------------------------------IVKNPG
MURC_WOLTR      ----------------------------------------------------------------------
MURC_STRSV      ------------------------------------------VQGSDVDKYYFTQRGLEQAGISILPFDE
MURC_RHOP5      ----------------------------------------LCNLGYTVQGSDASESAAENGADVVVVSTA
MURD_SYNPX      ----------------------------------------------------------------------
MURD_NEIMB      -----------------------------------------------------------------ISERQ
MURD_NATTJ      ----------------------------------------------------------------------
MURD_HAEI8      ----------------------------------------------------------------------
MURD_BRUSU      ----------------------------------------------------------------------
MURD_BRUAB      ----------------------------------------------------------------------
MURD_BRUA2      ----------------------------------------------------------------------
MURC_SYNWW      ----------------------------------------------------------------------
MURC_SYNFM      ----------------------------------------------------------------------
MURC_RALEJ      --------------------------------------------GYKVSGSDVGSNAATRRLASLGASTA
MURC_JANSC      ----------------------------------------------------------------------
MURD_STRSY      ----------------------------------------------------------------------
MURD_STRS2      ----------------------------------------------------------------------
MURD_RICFE      ----------------------------------------------------------------------
MURD_EUBE2      ----------------------------------------------------------------------
MURD_COLP3      ----------------------------------------------------------------------
MURC_XANOR      ----------------------------------------------------------------------
MURC_XANOP      ----------------------------------------------------------------------
MURC_XANOM      ----------------------------------------------------------------------
MURC_ERWCT      -------------------------------------------EGYEISGSDLAPNAVTQQLTKLGAQXA
MURC_DINSH      ----------------------------------------------------------------------
MURC_CLOK5      ----------------------------------------------------------------------
MURC_CLOK1      ----------------------------------------------------------------------
MURC_AZOVD      ----------------------------------------------------------------------
MURD_THEPX      ----------------------------------------------------------------------
MURD_THEP3      ----------------------------------------------------------------------
MURD_CLOK5      ----------------------------------------------------------------------
MURD_CLOK1      ----------------------------------------------------------------------
MURC_SHEON      -------------------------------------------EGYVVSGSDIAQNAVTDRLCLLGAKTA
MURC_PELPD      --------------------------------------------GYKVSGSDLRGSDITERLARLGAEKD
MURC_DESDA      ----------------------------------------------------------------------
MURD_RICTY      ----------------------------------------------------------------------
MURD_POLSJ      ----------------------------------------------------------------------
MURD_PEDPA      ----------------------------------------------------------QNKIELIVKNPG
MURD_DESAA      -------------------------------------------------------------ADLIVISPG
MURD_BUCBP      ----------------------------------------------------------------------
MURC_STRPJ      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_MYCUA      ----------------------------------------------------------------------
MURC_MARMM      -----------------------------------------------------------DGAGAIVVSSA
MURC_CHLPD      ----------------------------------------------------------------------
MURC_BRAJA      ----------------------------------------------------------------------
MURD_STRU0      ----------------------------------------------------------------------
MURD_NITMU      ----------------------------------------------------------------------
MURD_LEGPH      ----------------------------------------------------------------------
MURD_ANAMM      ----------------------------------------------------------------------
MURC_PROVI      ----------------------------------------------------------------------
MURC_PECCP      -------------------------------------------EGYEISGSDLAPNAVELGAQIYFHHRA
MURC_DEIRA      ----------------------------------------------------------------------
MURC_CHLTE      ----------------------------------------------------------------------
MURD_MANSM      ----------------------------------------------------------------------
MURD_HAEIE      ----------------------------------------------------------------------
MURD_CLOP1      ----------------------------------------------------------------------
MURD_ACIC5      ----------------------------------------------------------------IVVSPG
MURC_STRTD      --------------------------------------------GYKVQGSDFTQRGLEQAGIPILPFDE
MURC_STRT2      ------------------------------------------VQGSDVEKYYFTQRGLEQAGIPILPFDE
MURC_STRT1      ------------------------------------------VQGSDVEKYYFTQRGLEQAGIPILPFDE
MURC_POLNA      ----------------------------------------------------------------------
MURC_GLUDA      -------------------------------------------------GHDAANLGA---AQVVVTSTA
MURD_PROM9      ----------------------------------------------------------------------
MURD_LEGPL      ----------------------------------------------------------------------
MURD_LEGPA      ----------------------------------------------------------------------
MURD_CLOCE      ----------------------------------------------------------------------
MURD_CAUSK      ----------------------------------------------------------------------
MURD_BACHD      -----------------------------------------------------AQKLQKEGIHVVCGEKE
MURC_RHOSK      --------------------------------------------GYRVQGSDITERLVSLGATFFEGQRA
MURC_RHOS4      --------------------------------------------GYRVQGSDITERLVSLGATFFEGQRA
MURC_PARD8      ----------------------------------------------------------------------
MURC_DESAD      ----------------------------------------------------------------------
MURD_RICCN      ----------------------------------------------------------------------
MURC_STRZP      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRZJ      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRPI      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_PELPB      ----------------------------------------------------------------------
MURD_VIBCH      ----------------------------------------------------------------------
MURD_SYMTH      ----------------------------------------------------------------------
MURD_RHORT      ----------------------------------------------------------------------
MURD_GLOVI      ----------------------------------------------------------------------
MURD_CLOTH      ----------------------------------------------------------------------
MURC_THICR      ----------------------------------------------------------------------
MURC_STRZT      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRR6      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRPS      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRP4      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRP2      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_SHEAM      ----------------------------------------------------------------------
MURC_PSYWF      ----------------------------------------------------------------------
MURC_GEOSM      ----------------------------------------------------------------------
MURC_GEOBB      ----------------------------------------------------------------------
MURC_CHLP8      ----------------------------------------------------------------------
MURC_ACICJ      -------------------------------------------------GHDAANLG---NAQVVVVSTA
MURD_PHEZH      ----------------------------------------------------------------------
MURD_HYDS0      ----------------------------------------------------------------------
MURD_CLOPE      ----------------------------------------------------------------------
MURD_ALKOO      ----------------------------------------------------------------------
MURC_STRPN      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_STRP7      ------------------------------------------VQGSDVEKYYFTQRGLEQAGITILPEKN
MURC_SHEB9      -------------------------------------------EGYQVSGSDIAQNAVTDRLCLLGAKIQ
MURC_SHEB8      -------------------------------------------EGYQVSGSDIAQNAVTDRLCLLGAKIQ
MURC_SHEB5      -------------------------------------------EGYQVSGSDIAQNAVTDRLCLLGAKIQ
MURC_SHEB2      -------------------------------------------EGYQVSGSDIAQNAVTDRLCLLGAKIQ
MURC_RHOS5      ----------------------------------------------------------------------
MURC_PSEPW      ----------------------------------------------------------------------
MURC_PSEFS      --------------------------------------------GYQVSGSDLKESPVENAAEALVVSSA
MURC_PELUB      ----------------------------------------------------------------------
MURC_METCA      ----------------------------------------------------------------------
MURC_BURTA      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
CPHA_CYAA5      ----------------------------------------------------------------------
MURD_METFK      -------------------------------------------------------------AELIVASPG
MURC_PELCD      ----------------------------------------------------------------------
MURC_JANMA      --------------------------------------------GYTVSGSDLGSNAIELGAKAIVTSTA
MURC_BURPS      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_BURP6      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_BURP1      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_BURP0      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURD_VIBC3      ----------------------------------------------------------------------
MURD_OCEIH      ----------------------------------------------------------------------
MURD_CLOPS      ----------------------------------------------------------------------
MURC_SYNY3      ----------------------------------------------------------------------
MURC_SALAR      ----------------------------------------------------------------------
MURC_RHOS1      --------------------------------------------GYRVQGSDITERLVSLGATFFEGQRA
MURC_PSESM      --------------------------------------------GYEVSGSDLKGSAVENGADVLVVSSA
MURC_PSEPK      ----------------------------------------------------------------------
MURC_PSEP1      ----------------------------------------------------------------------
MURC_LACC3      ----------------------------------------------------------------------
MURC_ENT38      ----------------------------------------------------------------------
MURC_ECOL5      ----------------------------------------------------------------------
MURC_BURMS      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_BURMA      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_BURM9      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_BURM7      --------------------------------------------GYQVSGSDLARNAVTEGANAVVVSTA
MURC_ACTSZ      ----------------------------------------------------------------------
MURD_THEEB      ----------------------------------------------------------------------
MURD_PROMA      ----------------------------------------------------------------------
MURD_MACCJ      --------------TVNDGKDVSQTEQYRELTEM----------GITVIGGHHPLSLLEH-TTLIVKNPG
MURD_CLONN      ----------------------------------------------------------------------
MURD_AGRT5      ----------------------------------------------------------------------
MURC_THELT      ----------------------------------------------------------------------
MURC_SHESM      -------------------------------------------EGYVVSGSDIAQNAVTDRLCLLGAKTA
MURC_RALEH      ----------------------------------------------------------------------
MURC_PSYA2      ----------------------------------------------------------------------
MURC_PSEU5      ----------------------------------------------------------------------
MURC_MARAV      ----------------------------------------------------------------------
MURC_KLEP7      ----------------------------------------------------------------------
MURC_HAMD5      ----------------------------------------------------------------------
MURD_RHILO      ----------------------------------------------------------------------
MURD_CLOBA      ----------------------------------------------------------------------
MURD_CHRVO      ----------------------------------------------------------------------
MURD_BORA1      ----------------------------------------------------------------------
MURC_SHESR      -------------------------------------------EGYVVSGSDIAQNAVTDRLCLLGAKTA
MURC_SHESA      -------------------------------------------EGYVVSGSDIAQNAVTDRLCLLGAKTA
MURC_LEPCP      ----------------------------------------------------------------------
MURC_AERHH      -------------------------------------------EGYQVTGSDLARNAVTNEASVVVVSTA
MURD_STRGC      ----------------------------------------------------------------------
MURD_NOVAD      ------------------------------------------------------------GFAGVVVSPG
MURD_NITOC      --------------------------------------------------------------AALIAEAE
MURC_RHOOB      ----------------------------------------------------------------------
MURC_PSEHT      -------------------------------------------EGYRITGSDIAHSAMENNANVVVVSSA
MURC_PSEAE      ----------------------------------------------------------------------
MURC_PSEAB      ----------------------------------------------------------------------
MURC_PSEA8      ----------------------------------------------------------------------
MURC_PSEA7      ----------------------------------------------------------------------
MURC_PSE14      --------------------------------------------GYEVSGSDLKGSAVENGADVLVVSSA
MURC_PROM3      ----------------------------------------------------------------------
MURC_PELLD      ----------------------------------------------------------------------
MURC_HAEPS      -------------------------------------------EGYQISGSDIADGAVENGASVVVASSA
MURC_ESCF3      ----------------------------------------------------------------------
MURC_DESMR      ----------------------------------------------------------------------
MURC_ACIBY      ----------------------------------------------------------------------
MURC_ACIBT      ----------------------------------------------------------------------
MURC_ACIBS      ----------------------------------------------------------------------
MURC_ACIBC      ----------------------------------------------------------------------
MURC_ACIB5      ----------------------------------------------------------------------
MURC_ACIB3      ----------------------------------------------------------------------
MURC_ACIAC      ----------------------------------------------------------------------
MURD_SILST      ----------------------------------------------------------------------
MURD_PHOPR      -------------------------------------------------------------ADLIVASPG
MURD_NOSP7      ----------------------------------------------------------------------
MURD_NITEU      --------------------------------------------------------AISPGVAVALVQAA
MURD_FRAP2      ----------------------------------------------------------------------
MURC_XYLFT      ------------------------------------------------------------GTDCVVVSSA
MURC_XYLFM      ------------------------------------------------------------GTDCVVVSSA
MURC_XYLFA      ------------------------------------------------------------GTDCVVVSSA
MURC_XYLF2      ------------------------------------------------------------GTDCVVVSSA
MURC_XANP2      ----------------------------------------------------------------------
MURC_STRGC      ------------------------------------------VQGSDVDKYYFTQRGLEQAGIKILADYE
MURC_SALTO      ----------------------------------------------------------------------
MURC_RALME      ----------------------------------------------------------------------
MURC_PSEU2      --------------------------------------------GYEVSGSDLKGSAVENGADVLVVSSA
MURC_PSEPF      ----------------------------------------------------------------------
MURC_PSEE4      ----------------------------------------------------------------------
MURC_PROMH      -------------------------------------------EGYAISGSDLAQQLVALGATIYFNHRP
MURC_METSB      --------------------------------------------GYSVQGSDAAENAADNDAEVVVVSTA
MURC_KLEP3      ----------------------------------------------------------------------
MURC_CITK8      ----------------------------------------------------------------------
MURD_BACLD      ----------------------------------------------------------------------
MURC_VIBSL      -------------------------------------------EGYQITGSDIAQRLVSKGATVYVGHQX
MURC_PSYCK      ----------------------------------------------------------------------
MURC_PSEPG      ----------------------------------------------------------------------
MURC_PARDP      ----------------------------------------------------------------------
MURC_MICAN      ----------------------------------------------------------------------
MURC_LACCB      ----------------------------------------------------------------------
MURC_GLOVI      ----------------------------------------------------------------------
MURC_AZOSE      --------------------------------------------------------AAENGADAVVISTA
MURD_SYNJA      ----------------------------------------------------------------------
MURD_GEOSW      ----------------------------------------------------------------------
MURD_CYTH3      -------------------------------------------------------------AQLIVKSPG
MURD_BUCAT      ----------------------------------------------------------------------
MURD_BUCAI      ----------------------------------------------------------------------
MURD_BUCA5      ----------------------------------------------------------------------
MURC_SALCH      ----------------------------------------------------------------------
MURC_LACRD      ----------------------------------------------------------------------
MURD_CHRSD      ----------------------------------------------------------------------
MURD_ALCBS      -------------------------------------------------------------ARRLIVSPG
MURC_PSYIN      -------------------------------------------EGYKISGSDIAENPVVRGASVVVVSTA
MURC_PROMM      ----------------------------------------------------------------------
MURC_MARMS      -------------------------------------------------------------AHVIVVSTA
MURC_CUPTR      ----------------------------------------------------------------------
MURC_CLAM3      ----------------------------------------------------------------------
MURC_CHLCH      ----------------------------------------------------------------------
MURC_BURP8      --------------------------------------------GYQVSGSDLSRNAVTEGANAVVVSTA
MURD_THETN      ----------------------------------------------------------------------
MURD_STRCO      ----------------------------------------------------------------------
MURD_OENOB      -----------------------------------------------------------------IIKKA
MURD_COXBU      ----------------------------------------------------FSEKLL-NEAQEIILSPG
MURD_COXBR      ----------------------------------------------------FSEKLL-NEAQEIILSPG
MURD_COXBN      ----------------------------------------------------FSEKLL-NEAQEIILSPG
MURD_COXB2      ----------------------------------------------------FSEKLL-NEAQEIILSPG
MURD_COXB1      ----------------------------------------------------FSEKLL-NEAQEIILSPG
MURC_SHISS      ----------------------------------------------------------------------
MURC_SHIF8      ----------------------------------------------------------------------
MURC_SALTY      ----------------------------------------------------------------------
MURC_SALTI      ----------------------------------------------------------------------
MURC_SALSV      ----------------------------------------------------------------------
MURC_SALPK      ----------------------------------------------------------------------
MURC_SALPC      ----------------------------------------------------------------------
MURC_SALPB      ----------------------------------------------------------------------
MURC_SALPA      ----------------------------------------------------------------------
MURC_SALNS      ----------------------------------------------------------------------
MURC_SALHS      ----------------------------------------------------------------------
MURC_SALG2      ----------------------------------------------------------------------
MURC_SALEP      ----------------------------------------------------------------------
MURC_SALDC      ----------------------------------------------------------------------
MURC_SALA4      ----------------------------------------------------------------------
MURC_LEGPL      ----------------------------------------------------------------------
MURC_LEGPH      ----------------------------------------------------------------------
MURC_LEGPC      ----------------------------------------------------------------------
MURC_LEGPA      ----------------------------------------------------------------------
MURC_ECOUT      ----------------------------------------------------------------------
MURC_ECOSM      ----------------------------------------------------------------------
MURC_ECOSE      ----------------------------------------------------------------------
MURC_ECOLU      ----------------------------------------------------------------------
MURC_ECOLI      ----------------------------------------------------------------------
MURC_ECOLC      ----------------------------------------------------------------------
MURC_ECOL6      ----------------------------------------------------------------------
MURC_ECOK1      ----------------------------------------------------------------------
MURC_ECOHS      ----------------------------------------------------------------------
MURC_ECODH      ----------------------------------------------------------------------
MURC_ECOBW      ----------------------------------------------------------------------
MURC_ECO8A      ----------------------------------------------------------------------
MURC_ECO81      ----------------------------------------------------------------------
MURC_ECO7I      ----------------------------------------------------------------------
MURC_ECO5E      ----------------------------------------------------------------------
MURC_ECO57      ----------------------------------------------------------------------
MURC_ECO55      ----------------------------------------------------------------------
MURC_ECO45      ----------------------------------------------------------------------
MURC_ECO27      ----------------------------------------------------------------------
MURC_ECO24      ----------------------------------------------------------------------
MURC_BURXL      --------------------------------------------GYQVSGSDLTSNAITDGANAVVVSTA
MURC_THEEB      ----------------------------------------------------------------------
MURC_SYNS9      ----------------------------------------------------------------------
MURC_SHIDS      ----------------------------------------------------------------------
MURC_PHOPR      -------------------------------------------EGYRISGSDLAPNAVTNGASVVVVSTA
MURC_ALCBS      ----------------------------------------------------------------------
MURD_STRSV      ----------------------------------------------------------------------
MURD_RHOPA      ----------------------------------------------------------------------
MURD_PROMT      ----------------------------------------------------------------------
MURD_DESDG      ----------------------------------------------------------------------
MURC_PORGI      ----------------------------------------------------------------------
MURC_IDILO      ----------------------------------------------------------------------
MURC_DECAR      --------------------------------------------------------AAENGADAVVISTA
MURC_CLOPH      -------------------------------------------KGFTVSGSDAKDSKIVDGITIFIGQKA
MURC_BURPP      --------------------------------------------GYQVSGSDLTSNAITDGANAVVVSTA
MURD_VIBF1      ----------------------------------------------------------------------
MURD_CLOPH      ----------------------------------------------------------------------
MURD_BUCAP      ----------------------------------------------------------------------
MURD_ANAVT      ----------------------------------------------------------------------
MURC_STRAW      --------------------------------------------------------------------RA
MURC_SHIFL      ----------------------------------------------------------------------
MURC_SHIBS      ----------------------------------------------------------------------
MURC_SHIB3      ----------------------------------------------------------------------
MURC_PROMP      ----------------------------------------------------------------------
MURC_NEIMA      ----------------------------------------------------------------------
MURC_NEIG1      ----------------------------------------------------------------------
MURC_LACF3      ----------------------------------------------------------------------
MURD_STREM      ----------------------------------------------------------------------
MURD_STAS1      ----------------------------------------------------------------------
MURD_RHIME      ----------------------------------------------------------------------
MURD_CLOBM      ----------------------------------------------------------------------
MURD_BACSK      ----------------------------------------------------------------------
MURC_TERTT      -----------------------------------------------------------HGVDVVVNSSA
MURC_NEIMF      ----------------------------------------------------------------------
MURC_NEIM0      ----------------------------------------------------------------------
MURC_CLAMS      ----------------------------------------------------------------------
MURD_SYNJB      ----------------------------------------------------------------------
MURD_GEOSF      ----------------------------------------------------------------------
MURD_CLOAB      ----------------------------------------------------------------------
MURC_VIBPA      ----------------------EITGSDLSENPVTER---LVSKGATVFGH---QASNVEKASVVVVSTA
MURC_CHLL2      ----------------------------------------------------------------------
MURD_YERPS      ----------------------------------------------------------------------
MURD_TRIEI      ----------------------------------------------------------------------
MURD_SYNAS      -------------------------------------------------GEDHGQ-SVELADYGISALAQ
MURD_STRAW      ----------------------------------------------------------------------
MURD_MESSB      ----------------------------------------------------------------------
MURD_ENTHR      ----------------------------------------------------------------------
MURC_STRM5      ----------------------------------------------------------------------
MURC_PASMU      ----------------------------------------------------------------------
MURC_MYCMM      ----------------------------------------------------------------------
MURC_CHLAD      -------------------------------------------------GHD---PAYVRGADAVLATAA
MURC_ANADF      ----------------------------------------------------------------------
MURD_VIBPA      ----------------------------------------------------------------------
MURD_NITWN      ----------------------------------------------------------------------
MURD_LACH4      -----------------------------------------------------------------MVKKA
MURD_GLUOX      ----------------------------------------------------------------------
MURD_GEOMG      ----------------------------------------------------------------------
MURD_CAUCR      ----------------------------------------------------------------------
MURD_CAUCN      ----------------------------------------------------------------------
MURC_VIBCH      ----------------------------------------------------------------------
MURC_VIBC3      ----------------------------------------------------------------------
MURC_STRMK      ----------------------------------------------------------------------
MURC_SILPO      ----------------------------------------------------------------------
MURC_SHESW      ----------------------------------------------------------------------
MURC_SHEPC      ----------------------------------------------------------------------
MURC_PSEF5      ----------------------------------------------------FIGHRAENAANALVVSSA
MURC_METNO      --------------------------------------------GYTVQGSDAARRLAEKGIRTFVGHRG
MURC_MANSM      -------------------------------------------EGYAVTGSDIAESAVTNRLISLGAKIH
MURC_HAES2      -------------------------------------------EGYQVTGSDIAENAVTSGASVVVVSSA
MURC_HAES1      -------------------------------------------EGYQVTGSDIAESAVTSGASVVVVSSA
MURC_FLAPJ      ----------------------------------------------------------------------
CPHA_SYNY3      ----------------------------------------------------------------------
MURD_CLOBL      ----------------------------------------------------------------------
MURD_CLOBH      ----------------------------------------------------------------------
MURD_CLOB6      ----------------------------------------------------------------------
MURD_CLOB1      ----------------------------------------------------------------------
MURD_BORPE      -------------------------------------------------------------------ERN
MURD_BLOFL      -------------------------------------------------------------ANLIVVSPG
MURC_SERP5      ----------------------------------------------------------------------
MURC_MYCSS      ----------------------------------------------------------------------
MURC_MYCSK      ----------------------------------------------------------------------
MURC_MYCSJ      ----------------------------------------------------------------------
MURD_TROW8      ----------------------------------------------------------------------
MURD_RHOPB      ----------------------------------------------------------------------
MURD_FUSNN      ----------------------------------------------------------------------
MURD_FERNB      ----------------------------------------------------------------------
MURD_CHLPB      ----------------------------------------------------------------------
MURD_CALS8      ----------------------------------------------------------------------
MURD_ANASP      ----------------------------------------------------------------------
MURC_YERE8      ----------------------------------------------------------------------
MURC_SYNPW      ----------------------------------------------------------------------
MURC_SHEHH      -------------------------------------------------GHDASQV---KGMDVVVVSTA
MURC_PORG3      ----------------------------------------------------------------------
MURC_NEIMB      ----------------------------------------------------------------------
MURC_GRABC      ----------------------------------------------------------------------
MURC_BACV8      ----------------------------------------------------------------------
MURD_THICR      ----------------------------------------------------------------------
MURD_STRTD      ----------------------------------------------------------------------
MURD_STRT2      ----------------------------------------------------------------------
MURD_STRT1      ----------------------------------------------------------------------
MURD_RHOP2      ----------------------------------------------------------------------
MURD_RHOFD      ----------------------------------------------------------------------
MURD_LACRJ      ----------------------------------------------------------------------
MURD_LACRD      ----------------------------------------------------------------------
MURD_HAEDU      ----------------------------------------------------------------------
MURD_GEOSM      ----------------------------------------------------------------------
MURD_BORPA      -------------------------------------------------------------------ERN
MURD_BORBR      -------------------------------------------------------------------ERN
MURD_BIFAA      ----------------------------------------------------------------------
MURC_YERPS      -------------------------------------------EGYQISGSDLAPNSVTQHLTALGAQRP
MURC_YERPP      -------------------------------------------EGYQISGSDLAPNSVTQHLTALGAQRP
MURC_YERPN      -------------------------------------------EGYQISGSDLAPNSVTQHLTALGAQRP
MURC_YERPE      -------------------------------------------EGYQISGSDLAPNSVTQHLTALGAQRP
MURC_YERPA      -------------------------------------------EGYQISGSDLAPNSVTQHLTALGAQRP
MURC_YERP3      -------------------------------------------EGYQISGSDLAPNSVTQHLTALGAQRP
MURC_VIBHB      -------------------------------------------KGATVFGH---QASNVEKASVVVVSTA
MURC_SHEFN      -------------------------------------------EGYQISGSDIAINSVTERLASLGAKTA
MURC_PSEMY      ----------------------------------------------------FIGHAAENAEQALVVSSA
MURC_MYCLE      -------------------------------------------------GHDASLDLLPGGATAVITIRT
MURC_MYCLB      -------------------------------------------------GHDASLDLLPGGATAVITIRT
MURD_TROWT      ----------------------------------------------------------------------
MURD_MAGSA      ----------------------------------------------------------------------
MURD_LACF3      ----------------------------------------------------------EEGFDLVVKNPG
MURD_GRAFK      ----------------------------------------------------------------------
MURD_CLOBK      ----------------------------------------------------------------------
MURC_SHEDO      -------------------------------------------EGYHISGSDIATNSVTDGAKVIIGHHH
MURC_RHOSR      ----------------------------------------------------------------------
MURC_MYCS2      ----------------------------------------------------------------------
MURC_HALHL      ----------------------------------------------------------------------
MURC_HAHCH      -------------------------------------------QGYEISGSDLKESATTRGANVVVTSSA
MURC_ACIAD      ----------------------------------------------------------------------
MURD_VIBHB      ----------------------------------------------------------------------
MURD_CLOBB      ----------------------------------------------------------------------
MURD_BACA2      ----------------------------------------------------------------------
MURD_AQUAE      ----------------------------------------------------------------------
MURC_MYCTU      ----------------------------------------------------------------------
MURC_MYCTA      ----------------------------------------------------------------------
MURC_MYCBT      ----------------------------------------------------------------------
MURC_MYCBP      ----------------------------------------------------------------------
MURC_MYCBO      ----------------------------------------------------------------------
MURC_COLP3      -----------------------------------------------VIGHQ-AENVVQ--ASVIVVSTA
MURD_WIGBR      -------------------------------------------------------------AKLIIISPG
MURD_VIBFM      ----------------------------------------------------------------------
MURD_RHIL3      ----------------------------------------------------------------------
MURD_MICAN      ----------------------------------------------------------------------
MURD_GEOBB      ----------------------------------------------------------------------
MURD_FRATT      ----------------------------------------------------------------------
MURD_FRAT1      ----------------------------------------------------------------------
MURD_CLOBJ      ----------------------------------------------------------------------
MURC_TOLAT      -------------------------------------------EGYQISGSDIANNRVTHGASVVVVSTA
MURC_SYNSC      ----------------------------------------------------------------------
MURC_PROMA      ----------------------------------------------------------------------
MURC_METS4      --------------------------------------------GYTVQGSDAAKRLAEKGIRTFVGHRA
MURD_FRATW      ----------------------------------------------------------------------
MURD_FRATO      ----------------------------------------------------------------------
MURD_FRATM      ----------------------------------------------------------------------
MURD_FRATH      ----------------------------------------------------------------------
MURD_FRATF      ----------------------------------------------------------------------
MURC_SODGM      ----------------------------------------------------------------IVAAKE
MURC_SHESH      -------------------------------------------EGYKLSGSDIAENAVTHGADVVVVSTA
MURC_HAEI8      -------------------------------------------EGYQISGSDIADGVVTQGASVVVVSSA
MURC_CHLAA      ----------------------------------------------------------------------
MURC_AERS4      -------------------------------------------EGYQVTGSDLARNAVTERLASLGAHTA
MURF_MYCTU      ----------------------------------------------------------------------
MURF_MYCBO      ----------------------------------------------------------------------
MURD_TERTT      ----------------------------VDTREHPPGADELMALNNKVDHHFGAVEQPQINAAEIVLSPG
MURD_STRZP      ----------------------------------------------------------------------
MURD_STRP7      ----------------------------------------------------------------------
MURD_PELCD      ----------------------------------------------------------------------
MURD_FRATN      ----------------------------------------------------------------------
MURD_ANATD      ----------------------------------------------------------------------
MURC_THIDA      --------------------------------------------GYAVSGSDLADNAVTQGADAVVTSTA
MURD_THENN      ----------------------------------------------------------------------
MURD_RALEJ      ----------------------------------------------------------------------
MURD_LISMO      ----------------------------------------------------------------------
MURC_NOSP7      ----------------------------------------------------------------------
MURC_MYCA9      -----------------------------DAKE-SRGVLALRARGALVNGHDGALDLLPGGPTVVVTTHA
MURC_HAEIG      -------------------------------------------EGYQISGSDIADGVVTQGASVVVVSSA
MURD_RHIEC      ----------------------------------------------------------------------
MURD_ELUMP      ----------------------------------------------------------------------
MURD_CYAP8      ----------------------------------------------------------------------
MURD_CLOB8      ----------------------------------------------------------------------
MURD_CHLL2      ----------------------------------------------------------------------
MURC_BDEBA      ----------------------------------------------------------------------
MURD_XANAC      ----------------------------------------------------------------------
MURD_STRMU      ----------------------------------------------------------------------
MURD_BARHE      ----------------------------------------------------------------------
MURC_SHEPA      -------------------------------------------EGYKLSGSDIAQSAVTERLAQLXXSTA
MURC_HAEIN      -------------------------------------------------GH--AEEHIE-GASVVVVSSA
MURC_HAEIE      -------------------------------------------------GH--AEEHIE-GASVVVVSSA
MURD_STRZT      ----------------------------------------------------------------------
MURD_PHOLL      ----------------------------------------------------------------------
MURD_DESRM      ----------------------------------------------------------------------
MURD_CHLAB      ----------------------------------------------------------------------
MURC_METEP      --------------------------------------------GYTVQGSDANDNAAENGIRTFVGHRX
MURC_METC4      --------------------------------------------GYTVQGSDANDNAAENGIRTFVGHRX
MURC_COXBU      ----------------------------------------------------------------------
MURC_COXBR      ----------------------------------------------------------------------
MURC_COXBN      ----------------------------------------------------------------------
MURC_COXB2      ----------------------------------------------------------------------
MURC_COXB1      ----------------------------------------------------------------------
MURC_BIFAA      ----------------------------------------------------------------------
Y531_METTH      ----------------------------------------------------------------------
MURF_SYNY3      ----------------NLSEDIRINNICTDTRSLVSGDLFLALRGESFDGHSFIPQALTAGAIAVVTDRP
MURD_XANOR      ----------------------------------------------------------------------
MURD_XANOM      ----------------------------------------------------------------------
MURD_SHEON      ----------------------------------------------------------------------
MURD_LACLM      ----------------------------------------------------------------------
MURD_LACAC      ----------------------------------------------------------------------
MURD_GEOKA      ----------------------------------------------------------------------
MURD_CYAP7      ----------------------------------------------------------------------
MURD_CLOD6      ----------------------------------------------------------------------
MURD_CHLCV      ----------------------------------------------------------------------
MURC_SHELP      -------------------------------------------EGYRLSGSDIAENAVTEGADVVVVSTA
MURC_SALAI      ----------------------------------------------------------------------
MURD_LACLS      ----------------------------------------------------------------------
MURD_ANADE      -------------------------------------------------GHDAADFT---GADLVVASPG
MURC_MYCVP      ----------------------------------------------------------------------
MURC_ACTPJ      -------------------------------------------EGYQISGSDIAEGPVEAGAKVFIGHQA
MURC_ACTP7      -------------------------------------------EGYQISGSDIAEGPVEAGAKVFIGHQA
MURC_ACTP2      -------------------------------------------EGYQISGSDIAEGPVEAGAKVFIGHQA
MURD_VIBVY      ----------------------------------------------------------------------
MURD_VIBVU      ----------------------------------------------------------------------
MURD_STRR6      ----------------------------------------------------------------------
MURD_STRPS      ----------------------------------------------------------------------
MURD_STRPN      ----------------------------------------------------------------------
MURD_STRPJ      ----------------------------------------------------------------------
MURD_STRPI      ----------------------------------------------------------------------
MURD_STRP4      ----------------------------------------------------------------------
MURD_STRP2      ----------------------------------------------------------------------
MURD_LACLA      ----------------------------------------------------------------------
MURD_GEOUR      ----------------------------------------------------------------------
MURD_DESDA      ----------------------------------------------------------------------
MURD_BLOPB      -------------------------------------------------------------ATLIVVSPG
MURC_VIBVU      ----------------------------------------------------------------------
MURC_THEFY      ----------------------------------------------------------------------
MURC_STRCO      --------------------------------------------------------------------RA
MURC_SHEPW      -------------------------------------------EGYQLSGSDIAENTVTDRLSQLGAVIH
MURC_RENSM      ------------------------------------------------------------GADTVVISTA
MURC_DESVV      ----------------------------------------------------------------------
MURC_DESVH      ----------------------------------------------------------------------
MURC_CORGL      ----------------------------------------------------------------------
MURC_CORGB      ----------------------------------------------------------------------
MURD_PORGI      ----------------------------------------------------------------------
MURD_LACS1      ----------------------------------------------------------------------
MURD_LACCB      ----------------------------------------------------------------------
MURD_LACC3      ----------------------------------------------------------------------
MURD_BURCC      ----------------------------------------------------------------------
MURC_METPB      --------------------------------------------GYTVQGSDANDNASENGIRTFVGHRX
MURC_ACIC1      ----------------------------------------------------------------------
MURD_STRZJ      ----------------------------------------------------------------------
MURD_RALSO      ----------------------------------------------------------------------
MURD_PORG3      ----------------------------------------------------------------------
MURD_NITHX      ----------------------------------------------------------------------
MURD_LISMF      ----------------------------------------------------------------------
MURD_LISIN      ----------------------------------------------------------------------
MURD_LEPIN      ----------------------------------------------------------------------
MURD_LEPIC      ----------------------------------------------------------------------
MURD_BRAJA      ----------------------------------------------------------------------
MURC_VIBVY      ----------------------------------------------------------------------
MURC_PARUW      ----------------------------------------------------------------------
MUDD_CHLTR      ----------------------------------------------------------------------
MURD_ROSS1      ----------------------------------------------------------------------
MURD_LEPBL      ----------------------------------------------------------------------
MURD_LEPBJ      ----------------------------------------------------------------------
MURD_LACDA      ----------------------------------------------------------------------
MURC_RHOE4      ----------------------------------------------------------------------
MPL_HAEIN       ----------------------------------------------------------------------
MURD_SYNY3      ----------------------------------------------------------------------
MURD_RUBXD      ----------------------------------------------------------------------
MURD_LACGA      -----------------------------------------------------------------MVEKA
MURD_LACDB      ----------------------------------------------------------------------
MURD_ALISL      ----------------------------------------------------------------------
MURD_THEAB      ----------------------------------------------------------------------
MURD_NITEC      ----------------------------------------------------------------------
MURD_CYAA5      ----------------------------------------------------------------------
MURD_BURP8      ----------------------------------------------------------------------
MURC_COREF      --------------------------------------------------------------------RA
MUDD_CHLPN      ----------------------------------------------------------------------
MURD_PSEAE      ----------------------------------------------------------------------
MURD_PELTS      ----------------------------------------------------------------------
MURD_BURPP      ----------------------------------------------------------------------
MURC_METPP      ----------------------------------------------------------------------
MURC_DIAST      ----------------------------------------------------------------------
MURC_CORU7      ----------------------------------------------------------------------
MURC_ACISJ      ----------------------------------------------------------------------
MURD_BURS3      ----------------------------------------------------------------------
MURC_BAUCH      -------------------------------------------EGYQISGSDLVQNKVTKHLVALIKFQH
MURC_ALISL      ----------------------------------------------------------------------
MURD_GEOSL      ----------------------------------------------------------------------
MURC_ACIC5      ----------------------------------------------------------------------
MURD_MYXXD      ----------------------------------------------------------------------
MURD_DESOH      ----------------------------------------------------------------------
MURD_CYAP4      ----------------------------------------------------------------------
MURD_CAMJR      ----------------------------------------------------------------------
MURD_BURVG      ----------------------------------------------------------------------
MURD_BURCM      ----------------------------------------------------------------------
MURC_LEIXX      ----------------------------------------------------------------------
MURD_THESQ      ----------------------------------------------------------------------
MURD_HAHCH      ----------------------------------------------------------------------
MURD_BURXL      ----------------------------------------------------------------------
MURD_BURA4      ----------------------------------------------------------------------
MURC_NOCFA      -----------------------------DAKE-SRGVLALRARGAQVRGHDAALDLLPGGPTAVVTTAA
MUDD_CHLCV      ----------------------------------------------------------------------
MURD_PARUW      ----------------------------------------------------------------------
MURD_LACSS      --------------TVNDGQDQEDTPAVAELRAL----------GATVITGSHPVALFEEGFHYLFKNPG
MURD_ERWCT      ----------------------------------------------------------------------
MURD_CHLP8      ----------------------------------------------------------------------
MURD_BURCH      ----------------------------------------------------------------------
MURD_BURCA      ----------------------------------------------------------------------
MURC_SYNPX      ----------------------------------------------------------------------
MURC_PHOLL      ----------------------------------------------------------------------
MURC_MYCPA      ----------------------------------------------------------------------
MURD_BARQU      ----------------------------------------------------------------------
MPL_ECOLI       ----------------------------------------------------------------------
MURD_THELT      ----------------------------------------------------------------------
MURD_BURM1      ----------------------------------------------------------------------
MURD_BIFLO      ----------------------------------------------------------------------
MURD_BIFLI      ----------------------------------------------------------------------
MURD_BIFLD      ----------------------------------------------------------------------
MURC_SACD2      ----------------------------------------------------------------------
MURC_PSEA6      -------------------------------------------------------------ANVVVVSSA
MURC_METRJ      ----------------------------------------------TFVGHD--AKNVEE-AALVVVSTA
MURD_YERPN      ----------------------------------------------------------------------
MURD_YERPE      ----------------------------------------------------------------------
MURD_YERPA      ----------------------------------------------------------------------
MURD_RALME      ----------------------------------------------------------------------
MURD_LACJO      ----------------NDKKD-----LSNDDRAAELGKLGVRV----ISGYHPVEIFDEEKFDYLVKNPG
MURD_BAUCH      ----------------------------------------------------------------------
MURC_SYNP6      ---------------------------------------------------EFFQEAVSAGSTAIHAHNE
MURC_SYNE7      ---------------------------------------------------EFFQEAVSAGSTAIHAHNE
MURD_THEP1      ----------------------------------------------------------------------
MURD_CHLCH      ----------------------------------------------------------------------
MURD_THEFY      ----------------------------------------------------------------------
MURD_LAWIP      ----------------------------------------------------------------------
FOLC_BACSU      ----------------------------------------------------------------------
MURD_PELPD      ----------------------------------------------------------------------
MURD_THEMA      ----------------------------------------------------------------------
MURD_ACAM1      ----------------------------------------------------------------------
MURC_SYNR3      ----------------------------------------------------------------------
MURD_THIDA      ----------------------------------------------------------------------
MURD_DESVV      ----------------------------------------------------------------------
MURD_DESVH      ----------------------------------------------------------------------
MURD_AZOSE      ----------------------------------------------------------------------
MURC_VIBFM      ----------------------------------------------------------------------
MURC_VIBF1      ----------------------------------------------------------------------
MURC_DESDG      ----------------------------------------------------------------------
MURD_DEIGD      ----------------------------------------------------------------------
MURD_CHLPN      ----------------------------------------------------------------------
MURD_CAMJE      ----------------------------------------------------------------------
MURC_WIGBR      ----------------------------------------------------------------------
MURD_CHLPD      ----------------------------------------------------------------------
MURD_CAMJJ      ----------------------------------------------------------------------
MURD_CAMJ8      ----------------------------------------------------------------------
MURC_BUCAP      ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
VWA3B_HUMAN     ----------------------------------------------------------------------
MURD_CAMJD      ----------------------------------------------------------------------
MURD_PSYCK      ----------------------------------------------------------------------
MURD_PELPB      ----------------------------------------------------------------------
MURD_BURTA      ----------------------------------------------------------------------
MURD_LEIXX      ----------------------------------------------------------------------
MURD_GEOLS      ----------------------------------------------------------------------
MURD_CHLTE      ----------------------------------------------------------------------
MURD_BURPS      ----------------------------------------------------------------------
MURD_BURP6      ----------------------------------------------------------------------
MURD_BURP1      ----------------------------------------------------------------------
MURD_BURP0      ----------------------------------------------------------------------
MURD_BURMS      ----------------------------------------------------------------------
MURD_BURMA      ----------------------------------------------------------------------
MURD_BURM9      ----------------------------------------------------------------------
MURD_BURM7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
MURE_BACSU      VDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
MURE_BACA2      LDVDVPVIIVRRSQRALSVLSDAFYGQPTKQLQLIGITGTNGKTSTTHMVDEIFKKAGRQTGLIGTMYIK
MURE_BACLD      VDADVPVIIIRHTKRALAVLSDAFYGQPTKQLRLIGITGTNGKTSTSHMVEEIFRKAGSRTGLIGTMYTK
MURE_LISMO      VDVSIPVIYVRDSKRAMAMLADYFYGSPTQALKLVGITGTNGKTTVSHLVEQIVRENGEQTGLIGTMYRK
MURE_LISMF      LDVSIPVIYVRDSKRAMAMLADYFYGSPTQALKLVGITGTNGKTTVSHLVEQIVRENGEQTGLIGTMYRK
MURE_LISIN      LDVSVPVLYVRDSKRAMAMLADYFYGSPTQALKLVGITGTNGKTTVSHLVEQIVRENGEQTGLIGTMYRK
MURE_GEOTN      LSXXXXXXXXXDSRRAMAILADAFYGQPTHRLHLIXXXXXXXXXXXXHIIEQVARKAGKKIGLIGTVGTK
MURE_BACAN      IDVDVPVVLVKNTFRSLAVLADYFYGQPTHKLHLXXXXXXXXXXXXXXXMDEIMRAHGHKTGLIGTINMK
MURE_BACCR      IDVDVPVVLVKNTFRSLAVLADYFYGQPTHKLHLXXXXXXXXXXXXXXXMDEIMRAHGHKTGLIGTINMK
MURE_GEOKA      XXXXXXXXXXXXXXXAMAILADAFYGRPTHRLHLIXXXXXXXXXXXXSIIEQIARKTGKKTGLIGTVHIK
MURE_LACPL      LDVNVPVIYVENTERAMAILADVFYGAPSQKMRMIXXXXXXXXXXXXHLIEQIYRDQQQATGLIGTMYRK
MURE_BACHD      XXXXXXXXXXXXXXXAMAQVATKFYGEPTNDLQLIGVTGTNGKTTITHLIEKIMQDQGKMTGLIGTMYTK
MURE1_OCEIH     LEYGVPIIQVEDTNRALAMLAVKYYDYPTKHFPLIXXXXXXXXXXXXYLLDKIFEYHQKKAGVIGTIQVK
MURE_ALKMQ      MTGGVTWVQVKDTRQVMAQLGSTFYGRPSQHLELIGVTGTNGKTSTTYMIKKILENHERKVGLIGTIANW
MURE1_CLOAB     PKKNCTVVKVEDGRKAMAVMGANFYDNPSHKLKLIGITGTNGKTTSTYMMKSMLESSGYKVGLIGTIANY
MURE_THETN      ISEGVTVVLVEDARAAMAKIASNFYNNPTSKLTLIGITGTNGKTSVTYMLKAILEQQNNKVGLVGTIQNM
MURE_CLOD6      VAIKGCTFIVKDTRKDMAKVADNFYNHPSQKFNVIGVTGTNGKTSITTILNEILTLNKNKVGLIGTIKIF
MURE_CLOBH      LEKDCTIIKVSDSRKALAIMSSNYYGNPSXXXXXXXXXXXXXXXXSTFMMKAILEKAGYKVGLLGTIANY
MURE_CLOB1      LEKDCTIIKVSDSRKALAIMSSNYYGNPSXXXXXXXXXXXXXXXXSTFMMKAILEKAGYKVGLLGTIANY
MURE_SYNWW      LDTGATLLTTPDTRSALALLAANYYGRPSKSIRVVAVXXXXXXXXXXDLIKAILEEAGKKTAIMGTLYAQ
MURE_CLOTE      FEKDITFIKVKNSRKALAVAASNYYGNPKDKLKLIGVTGTNGKTTSTFMIKSILEEAGFKVGLMGTILNY
MURE_STAHJ      QDINVTQVIVPDTLRVASLLAHTLYDFPSHQLTTIGVTGTNGKTSIATMIHLIYRGLGKGSAYLGTNGFQ
MURE_ALKOO      IAIETTTIKVENSRKALAAVASRFYKFPTNTLKLVGVTGTNGKTSITYMVKSILGYYNINVGLIGTISNW
MURE_STAES      LELNVTQVVVPDTLRVASLLAHELYEFPSHQLTTYGVTGTNGKTSIATMIHLIYRKLNKNSAYLGTNGFQ
MURE_STAEQ      LELNVTQVVVPDTLRVASLLAHELYEFPSHQLTTYGVTGTNGKTSIATMIHLIYRKLNKNSAYLGTNGFQ
MURE_STAAS      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAAW      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAAN      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAAM      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAAC      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAA8      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAA3      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAA1      LPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAAR      LSANVTQVVVPDTLRVASILAHTLFDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_STAAB      LPANVTQVVVPDTLRVASILAHTLFDYPSHQLVTFGVTGTNGKTSIATMIHLIQRKLQKNSAYLGTNGFQ
MURE_FUSNN      VEMNVSYILIDDIRHKLGYIASNFYEWPQRKLKIIGVTGTNGKTSSTYMIEKLMGDIPITR--IGTIEYK
MURE_CLOPE      VSVDITIIKVRDTRKALAIMSSNYFGNPKDXXXXXXXXXXXXXXXSAFIIKSILEKAGFMTGLIGTIANY
MURE_AQUAE      VSSKVPVIIVEDTRKALGKSAHEFFGKPSERLNVXXXXXXXXXXXXXHLIEKILLEAGEKTGLIGTIYYR
MURE_PARD8      LEGRCSFIVVKDSAEALGLLVSRWYGDPSRKLMLVGVTGTNGKTTIATLLYEMFRKMGHKVGLLSTVCNY
MURE_GEOSL      TRAGMEWIRVGDARLAMSRMAALFYGQPTDGVPVVXXXXXXXXXXXXYLVEAIMSRAGIPAAVLGTISYR
MURE_COXBU      IQTKVPLIPFENLQHRIGEIAARFYDDPSCEMEIIGITGTNGKTSCAQFIAQALQSQGIRCGVIGTLGYG
MURE_HAEIG      LSSNVPVVKYHQLARHLSSLADVFYDSPSKNLTLVGVTGTNGKTTISQLLAQWAELLGHRAAVMGTIGNG
MURE_HAEIE      LSSNVPVVKYHQLARHLSSLADVFYDSPSKNLTLVGVTGTNGKTTISQLLAQWAELLGLRAAVMGTIGNG
MURE_THEEB      AEGEACVIVVPDIERACGRLAAAFYNYPSQHLSLLXXXXXXXXXXXXHLVEHLLNRVGYPTALLGTLYSR
MURE_HAEI8      LSSNVPVVKYYQLARHLSSLADVFYDSPSKNLTLVGVTGTNGKTTISQLLAQWAELLGHRAAVMGTIGNG
MURE_HAEIN      LSSNVPVVKYYQLAHHLSSLADVFYDSPSNNLTLVGVTGTNGKTTISQLLAQWAELLGHRAAVMGTIGNG
MURE_BACFR      LAEGVTYIQVADSEDAVGKAATTFYGNPSSKLELVGVTGTNGKTTIATLLYNTFRYFGYKVGLISTVCNY
MURE_BACFN      LAEGVTYIQVADSEDAVGKAATTFYGNPSSKLELVGVTGTNGKTTIATLLYNTFRYFGYKVGLISTVCNY
MURE2_OCEIH     VNLDTTLIIVPDTNKAIATLAATFYKHPSHNLTIYGXXXXXXXXXXXXXXXHLLTDNELSTALIGTNGFQ
MURE_CHLAB      YNPFLPVVIISSDLPRLEALAAKYYGHPSQKLCVVGITGTNGKTTVSHLIKLLFDACDKPAGLIGTIEHI
MURE_GLOVI      VEAAVPVIRVPDVVGTCARLASAYYDFPARKLTLAXXXXXXXXXXXXHLIENLLQ-AQAPTGLVGTLYSR
MURE_PASMU      IEQGVPIISFYQLGSHLSALAGLFYDNPSHKLTLVGVTGTNGKTTISQLLAQWTTLLGHRSAVMGTIGNG
MURE_BACV8      PETNVTYIKVNDTEDVVGKLATTFYGDPTSKLELVGVTGTNGKTTIATLLYNMFRKFGYKTGLISTVCNY
MURE_CHLFF      NPFLSVVQIISPNLSLLEALAAKYYNYPSRKLCVVGITGTNGKTTVSHLIKFLFDACDKPSGLIGTIEHI
MURE_CYTH3      STADCTIIQVKDSAEALGMIASNFYDSPSSKLXXXXXXXXXXXXXXXXXXYRLFRKLGYKTGLLSTVENI
MURE_CHLPD      PDASLPYLRVEDXXXXXXXXXXXFYGFASDALHVIGVTGTNGKTTTARLITAMLNACGIRTGYIGTNLCT
MURE_BACTN      PVAGITYIQVKDSEDAVGKIATTFYGNPTSQFELVGVTGTNGKTTIATLLYNTFRYFGYKVGLISTVCNY
MURE_ACTP2      IELDAKVVLVPNLARILSEIAGAFYANPSEKLTLVGVTGTNGKTTSAQLLAQWHNLLGGKSAVMGTIGNG
MURE_GEOMG      VPEGMTWLKVDDXXXXXXXXXXXFYGNPTDGIPVVXXXXXXXXXXXXYLVEAVMARAGIPVAVLGTISYR
MURE_CHLMU      NPFLSVVQIVTEDLTALEALAARFYNDPSKRLDVIGVTGTNGKTTVSALARELMEYKGRCTGLVGTIEHI
MURE_PSEPK      GATDVPLIPVKGLIAQLSDIAGRFYGEPSRQLNLVGVTGTNGKTSVTQLVAQALDLLGQRCGLIGTLGTG
MURE_SOLUE      ADLAARWIQVEHGRHALALAARTFFGRPDERXXXXXXXXXXXXXXXXXXXDSVLRAAGGVTAMIGTIEYH
MURE_SYNY3      LQKFPPVIAVPDLVPVCAGLAAAFYQHPAQTLQLXXXXXXXXXXXXSHLIEYFLNQQQRSSALLGTLYTR
MURE_HAES1      LEQNIPLIAYYELSKHLSHIADRFYSSPSQRLTLVGVTGTNGKTTIAQLLAQWTQILGHTSAVMGTIGNG
MURE_CHLTR      PFLSVVQIIAEDPIALEASLAARFYNNPSRHLDVIGITGTNGKTTVSCLVRELMERSGRRTGLIGTIEHI
MURE_CHLTA      PFLSVVQIIAEDPIALEASLAARFYNNPSRHLDVIGITGTNGKTTVSCLVRELMERSGRRTGLIGTIEHI
MURE_XYLFT      APQGVSVAIAVHGLRALGAMADRFHGHPSQAMTMVGVTGTNGKTSTVQLLAQAWHRLGVRSATCGTLGVG
MURE_ANAVT      VEKNPPVISSNNMTKXXXXXXXXFYGYPGQKLKLXXXXXXXXXXXXXHLIEFFLTKAQLSTALMGTLYTR
MURE_ALCBS      QEQAVPRVNFPGLSRSVGELAARWYGEPGSAMNVVGVTGTNGKTSITWFLRDALNALGHRCALVGTLGLG
MURE2_CLOAB     FHENTTLVKVKNSKVALACLCNLFYEEPSRELNLXXXXXXXXXXXXIHYIRDMLEAFGNSTGTIGTLGYE
MURE_SYNE7      LSANPEACLILSDQMPVTAIAAAFYNQPAQTLKLIXXXXXXXXXXXXHLVEHFLNAADTKTALLGTLYNR
MURE_VIBVU      YQQNVVIVYLEKLDEKLSQLAGRLYQHP--EMSLIGVTGTNGKTTITQLIAQWLELAGQKAAVMGTTGNG
MURE_VIBVY      YQQNVVIVYLEKLDEKLSQLAGRLYQHP--EMSLIGVTGTNGKTTITQLIAQWLELAGQKAAVMGTTGNG
MURE_CHLTE      YSDSVTWLVVPDARKALAELSKAFYGNASDKLMLIGVTGTNGKTTTARLVTSMLNASGVAAGYIGTGLCR
MURE_VIBCH      AQAGVPVIYLAELGQHLSELAGRLYGGHHN--QLIGVTGTNGKTTITQLIAQWLELLGHKAAVMGTTGNG
MURE_VIBPA      IDIDIPVVYLDALDKCLSEIAGQLYTYPDMKL--IGVTGTNGKTTITQLIAQWIGLVGSKAAVMGTTGNG
MURE_XYLFA      APQGVSVAIAVHGLRALGAMADRFHGHPSQAMTMVGVTGTNGKTSTVQLLAQAWHCLGVRSATCGTLGVG
MURE_CHRVO      AEWQAPNLAVPNLRERAGIVAAHVLGLPSRDLTVVGITGTNGKTSISHWLAQAFSLLGQKAALIGTVGNG
MURE_CHLCV      NPFLSVVQIVSSNLPQLEALSAKYYNYPSKKLCIXXXXXXXXXXXXSHLIKTLFDGCNKPSGLIGTIEHV
MURE_ANASP      VEKNPPVISSNNMTKXXXXXXXXFYGYPGQKLKLXXXXXXXXXXXXXHLIEFFLTKAKLSTALMGTLYTR
MURE_PROM1      ASLEDPVVILPEPVSLMGKLAADFWGKPSSEICLXXXXXXXXXXXXSFLIEFLTTSLGHPSALFGTLINR
MURE_PROMT      ASLEDPVVILPEPVSLMGKLAADFWGKPSSEICLXXXXXXXXXXXXSFLIEFLTTSLGHPSALFGTLINR
MURE_LEPIN      SNVLNDLLEVMNSSKIFGRIASFLLGHPSKDLDIVAVTGTNGKTSLTNILFSLAKDQGINCGLIGTIGVK
MURE_LEPIC      SNVLNDLLEVMNSSKIFGRIASFLLGHPSKDLDIVAVTGTNGKTSLTNILFSLAKDQGINCGLIGTIGVK
MURE_PORGI      PDEKPEFVQVSDTAEXXXXXXXXXXGHPSRHXXXXXXXXXXXXXXXXXXLYRLFRKMGYKAGLVSTVCNY
MURE_PROMP      XKQKIGILVIEDNLDYIQIVSE-FWNRPSRKLKLIGVTGTNGKTTITFXXXXXXXXXXXXTALFGTLFNR
MURE_LAWIP      YCGSAIPIVVDDPRYTLGRLARIFYNTGNLSMPIIGVTGTNGKTTITYLLEYLFRAKGNRTGVIGTIAYR
MURE_XANAC      APDGLPVAIAVPGLRALGVMADQFHGRPSQAMRMVGVTGTNGKTSXXXXXXXXXXXXXXXXXXXXXXXXX
MURE_RICRI      XXXXXXXXXXXXXXQALYEAIEIFY--PKKPKDLIAVTGTNGKSSVVSYIAQTYSLLGKKAASIGTIGVE
MURE_RICCN      XXXXXXXXXXXXXXQALYEAIEIFY--PKKPKDLIAVTGTNGKSSVVSYIAQTYSLLGKKAASIGTIGVE
MURE_RICPR      NNTAIDVIYVEDVHKALYEAIEIFY--PKKPKNLISVTGTNGKSSVVSYIAQAYSLLKKKAAFIGTIGLE
MURE_ROSS1      ADGRVPVPALRXXXXXXXXXXXXFYGHPGRRMRIVXXXXXXXXXXXXXXXSVALEAGGAITGLMGTVDFK
MURE_LEPBL      SNISIDVLECEEDPEQLQGRIASFLGHPSKTLEIVAVTGTNGKTSLTNILFALAKDQGKICGLIGTIGVK
MURE_LEPBJ      SNISIDVLECEEDPEQLQGRIASFLGHPSKTLEIVAVTGTNGKTSLTNILFALAKDQGKICGLIGTIGVK
MURE_STRAW      AATGLPVLVVDDPRGRMGELAATIYGHPGRDLLQXXXXXXXXXXXXAYLIEGGLRTV-RSTGLIGTVEMR
MURE_RICMO      XXXXXXXXXXXXXXQALHEAIEIFY--PKKPKNLIAVTGTNGKSSVVSYIAQTHSLLGKKAASIGTIGVE
MURE_RICTY      KNTVIDVIYVEDVYEALYEAIEIFY--PKKPKNLISVTGTNGKSSVVSYIAQTYFLLRKKAAFIGTIGLE
MURE_BRUSU      TDAGVPVLHVDDPRHVLAIAAAQFYGKQPEVM--VAVTGTSGKTSVASFTRQIWAYAGFPAANIGTTGVF
MURE_HAEDU      SDQDCKVITVPRLAERLSAIADSFYASPSAKLKLXXXXXXXXXXXXAQLLAQWHNLLGGHSAVMGTIGNG
MURE_YERPE      IH-GVPVIYLRNLNQHLSTLAGQFYHQPGAALRLXXXXXXXXXXXXXQLLAQWSQALGETSAVMGTVGNG
MURE_RICBR      KNTTNKVIFVEDIKETLHEAIELFY--PKKPKTMIAVTGTNGKSSVVSYIAQIYSLIGQKAASIGT----
MURE_PSESM      XXTDVPLIPVKGLAAQLSDVAGRFYGDPSRSLNLVGVTGTNGKTSVTQLVAQALDALGQRCGIVGTLGTG
MURE_NITEU      PEWKIPNLGVAGLRHEAGKIASEAYGHPSRHLWLVGITGTNGKTTCSQWYAQAMAALGKKTAVIGTLGHG
MURE_JANMA      AEWDVAHLAIDDLKEHAGEIAAAYYAHPDRSMFTVAITGTNGKTSCAQWLGSALSRLGQPTAVIGTLGVG
MURE_CHLPN      NPFLSVVQIITPNLEELEALSAKYYEYPSSKLHXXXXXXXXXXXXXXCLIKALLDSYQKPSGLLGTIEHI
MURE_RALSO      ADAPARILPVDGLSELAGPLAAQWYAVPPDALRVIGVTGTNGKTSCSQWIAQALSRQGERCAVVGTLGTG
MURE_CORGL      AGETRPVIVVDDVRAVLGAASSSIYGDPSKDFTLIGVXXXXXXXXXXYLLEKGLMEAGHKVGLIGTTGTR
MURE_PROMA      PPSNEDMVFVVSDPVAMGEMASVFWKRPSSQIDLIXXXXXXXXXXXXYLIEHLCKQSGITSALFGTLYNR
MURE_COREF