[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB13610.1

[Show Plain Result]


## Summary of Sequence Search
    1::442
   80::356     3e-34  38%  361 aa  ELYA_BACHD RecName: Full=Thermostable alkaline protease;       
   62::378     7e-34  38%  382 aa  SUBT_BACAM RecName: Full=Subtilisin BPN';       
  148::399     1e-29  38%  401 aa  THES_BACSJ RecName: Full=Thermophilic serine proteinase;       
   40::259     2e-29  48%  326 aa  ISP_PAEPO RecName: Full=Intracellular serine protease;       
    9::265     2e-27  39%  269 aa  SUBB_BACLE RecName: Full=Subtilisin BL;       
  165::395     3e-27  42%  491 aa  YCT5_YEAST RecName: Full=Putative subtilase-type proteinase
  196::444     4e-27  40%  451 aa  PSP3_SCHPO RecName: Full=Subtilase-type proteinase psp3;       
  172::415     1e-26  43%  533 aa  PEPC_ASPNG RecName: Full=Subtilisin-like serine protease pepC;     
   19::270     3e-26  37%  274 aa  SUBD_BACLI RecName: Full=Subtilisin DY;         EC=3.4.21.62;
  218::512     5e-26  39% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       
    1::377     7e-26  33%  381 aa  SUBT_BACSU RecName: Full=Subtilisin E;         EC=3.4.21.62;Flags:
    1::377     7e-26  32%  381 aa  SUBT_BACST RecName: Full=Subtilisin J;         EC=3.4.21.62;Flags:
    1::377     1e-25  32%  381 aa  SUBT_BACSA RecName: Full=Subtilisin amylosacchariticus;       
    1::377     1e-25  33%  381 aa  SUBN_BACNA RecName: Full=Subtilisin NAT;       
  131::356     1e-25  38%  645 aa  SUBE_BACSU RecName: Full=Minor extracellular protease epr;       
  124::375     3e-25  37%  379 aa  SUBT_BACLI RecName: Full=Subtilisin Carlsberg;       
  204::470     3e-25  42%  478 aa  YSP3_YEAST RecName: Full=Subtilisin-like protease 3;       
  413::634     3e-25  41% 1398 aa  PLS_PYRFU RecName: Full=Pyrolysin;         EC=3.4.21.-;Flags:
  171::409     8e-25  40%  534 aa  PROA_VIBAL RecName: Full=Alkaline serine exoprotease A;       
  131::341     2e-24  40%  382 aa  ALP_LECPS RecName: Full=Alkaline serine protease ver112;       
  160::442     4e-24  40%  595 aa  BPRX_DICNO RecName: Full=Extracellular subtilisin-like protease;   
    9::271     2e-23  37%  275 aa  SUBT_BACPU RecName: Full=Subtilisin;         EC=3.4.21.62;AltName:
   41::259     2e-23  42%  319 aa  ISP1_BACSU RecName: Full=Major intracellular serine protease;      
   29::277     3e-23  34%  279 aa  THET_THEVU RecName: Full=Thermitase;         EC=3.4.21.66;
  120::376     1e-22  36%  380 aa  PRTM_BACSK RecName: Full=M-protease;         EC=3.4.21.-;Flags:
  179::594     2e-22  43%  806 aa  SUBV_BACSU RecName: Full=Minor extracellular protease vpr;       
    9::265     3e-22  36%  269 aa  SUBS_BACLE RecName: Full=Subtilisin Savinase;       
  120::376     3e-22  36%  380 aa  ELYA_BACCS RecName: Full=Alkaline protease;       
  120::376     3e-22  36%  380 aa  ELYA_BACAO RecName: Full=Alkaline protease;       
  150::382     8e-22  39%  530 aa  HLY_HAL17 RecName: Full=Halolysin;         EC=3.4.21.-;AltName:
  149::333     1e-21  39%  485 aa  SUB1_NANOT RecName: Full=Subtilisin-like protease 1;       
  149::333     1e-21  39%  485 aa  SUB1_MICCA RecName: Full=Subtilisin-like protease 1;       
  316::560     1e-21  39%  635 aa  PRTB_YEAST RecName: Full=Cerevisin;         EC=3.4.21.48;AltName:
   40::269     2e-21  38%  321 aa  ISP_BACCS RecName: Full=Intracellular alkaline protease;       
  212::438     3e-21  37%  467 aa  ISP6_SCHPO RecName: Full=Sexual differentiation process putative
  133::361     7e-21  40%  422 aa  TKSU_PYRKO RecName: Full=Tk-subtilisin;         EC=3.4.21.-;Flags:
  154::381     1e-20  39%  513 aa  AQL1_THEAQ RecName: Full=Aqualysin-1;       
  163::468     7e-20  38%  603 aa  BPRV_DICNO RecName: Full=Extracellular basic protease;       
  139::356     1e-19  37%  388 aa  CUDP_METAN RecName: Full=Cuticle-degrading protease;       
  458::684     2e-19  38%  894 aa  WPRA_BACSU RecName: Full=Cell wall-associated protease;       
  138::400     5e-19  41%  465 aa  SPL1_ENCCU RecName: Full=Putative subtilisin-like proteinase 1;    
  142::386     3e-18  39%  420 aa  SUBT_BACS9 RecName: Full=Subtilisin;         EC=3.4.21.62;Flags:
  158::389     4e-18  42%  412 aa  SUB6_TRIVC RecName: Full=Subtilisin-like protease 6;       
   70::374     4e-18  32%  378 aa  ELYA_BACYA RecName: Full=Alkaline elastase YaB;       
  158::389     5e-18  41%  412 aa  SUB6_TRISD RecName: Full=Subtilisin-like protease 6;       
  158::389     5e-18  41%  412 aa  SUB6_TRIRU RecName: Full=Subtilisin-like protease 6;       
  159::385     7e-18  39%  410 aa  SEPR_THESR RecName: Full=Extracellular serine proteinase;       
  146::395     2e-17  37%  395 aa  SUB5_NANOT RecName: Full=Subtilisin-like protease 5;       
  158::389     3e-17  43%  412 aa  SUB6_ARTBE RecName: Full=Subtilisin-like protease 6;       
  158::389     3e-17  41%  412 aa  SUB6_TRITO RecName: Full=Subtilisin-like protease 6;       
  158::389     3e-17  41%  412 aa  SUB6_TRIEQ RecName: Full=Subtilisin-like protease 6;       
  153::396     1e-16  37%  403 aa  ORYZ_ASPFL RecName: Full=Oryzin;         EC=3.4.21.63;AltName:
  153::366     1e-16  41%  406 aa  SUB6_NANOT RecName: Full=Subtilisin-like protease 6;       
  150::396     3e-16  36%  403 aa  ORYZ_ASPOR RecName: Full=Oryzin;         EC=3.4.21.63;AltName:
  152::356     4e-16  36%  404 aa  SMP1_MAGPO RecName: Full=Subtilisin-like proteinase Mp1;       
  147::330     6e-16  36%  396 aa  SUB5_TRIVC RecName: Full=Subtilisin-like protease 5;       
  147::330     6e-16  36%  396 aa  SUB5_TRIRU RecName: Full=Subtilisin-like protease 5;       
  147::330     6e-16  36%  396 aa  SUB5_ARTBE RecName: Full=Subtilisin-like protease 5;       
  147::330     8e-16  36%  396 aa  SUB5_TRITO RecName: Full=Subtilisin-like protease 5;       
  147::330     8e-16  36%  396 aa  SUB5_TRIEQ RecName: Full=Subtilisin-like protease 5;       
  167::465     1e-15  38%  580 aa  EXPR_XANCP RecName: Full=Extracellular protease;       
  152::389     2e-15  38%  409 aa  ALP_TRIAT RecName: Full=Alkaline proteinase;         Short=ALP;    
  151::367     7e-15  38%  402 aa  ALP_CEPAC RecName: Full=Alkaline proteinase;         Short=ALP;    
  151::334     4e-14  37%  399 aa  SUB4_TRIRU RecName: Full=Subtilisin-like protease 4;       
  151::334     5e-14  37%  399 aa  SUB4_TRIVC RecName: Full=Subtilisin-like protease 4;       
  151::334     5e-14  37%  399 aa  SUB4_TRITO RecName: Full=Subtilisin-like protease 4;       
  149::332     5e-14  37%  394 aa  SUB4_TRIEQ RecName: Full=Subtilisin-like protease 4;       
  151::334     5e-14  37%  399 aa  SUB4_ARTBE RecName: Full=Subtilisin-like protease 4;       
  149::333     8e-14  40%  507 aa  SUB1_TRIEQ RecName: Full=Subtilisin-like protease 1;       
  138::243     8e-14  46%  387 aa  PRTR_TRIAL RecName: Full=Proteinase R;         EC=3.4.21.-;Flags:
   20::164     1e-13  39%  221 aa  YZ18_AQUAE RecName: Full=Uncharacterized protein aq_aa18;
  149::333     1e-13  40%  507 aa  SUB1_TRITO RecName: Full=Subtilisin-like protease 1;       
  149::333     1e-13  40%  504 aa  SUB1_TRIRU RecName: Full=Subtilisin-like protease 1;       
  149::333     3e-13  40%  399 aa  SUB1_TRIVC RecName: Full=Subtilisin-like protease 1;       
  149::333     3e-13  40%  399 aa  SUB1_ARTBE RecName: Full=Subtilisin-like protease 1;       
  151::334     4e-13  36%  399 aa  SUB4_NANOT RecName: Full=Subtilisin-like protease 4;       
  208::446     4e-13  33% 1052 aa  MBTP1_CRIGR RecName: Full=Membrane-bound transcription factor
  150::385     5e-13  34%  403 aa  ORYZ_ASPFU RecName: Full=Oryzin;         EC=3.4.21.63;AltName:
  216::374     9e-13  37%  397 aa  SUB3_TRIVC RecName: Full=Subtilisin-like protease 3;       
  216::360     9e-13  39%  397 aa  SUB3_TRIRU RecName: Full=Subtilisin-like protease 3;       
  216::374     9e-13  37%  397 aa  SUB3_ARTBE RecName: Full=Subtilisin-like protease 3;       
  183::433     9e-13  36%  536 aa  SPM1_MAGGR RecName: Full=Subtilisin-like proteinase Spm1;       
  179::414     9e-13  34%  691 aa  PCSK9_RAT RecName: Full=Proprotein convertase subtilisin/kexin type
  208::446     9e-13  33% 1052 aa  MBTP1_RAT RecName: Full=Membrane-bound transcription factor site-1
  208::446     9e-13  33% 1052 aa  MBTP1_MOUSE RecName: Full=Membrane-bound transcription factor
  208::446     9e-13  33% 1052 aa  MBTP1_HUMAN RecName: Full=Membrane-bound transcription factor
  216::360     3e-12  39%  397 aa  SUB3_TRIEQ RecName: Full=Subtilisin-like protease 3;       
  216::360     4e-12  39%  397 aa  SUB3_TRITO RecName: Full=Subtilisin-like protease 3;       
  247::529     6e-12  32%  662 aa  PRCA_ANAVT RecName: Full=Calcium-dependent protease;       
  183::438     6e-12  33%  694 aa  PCSK9_MOUSE RecName: Full=Proprotein convertase subtilisin/kexin
  176::465     6e-12  34%  937 aa  PCSK6_RAT RecName: Full=Proprotein convertase subtilisin/kexin type
  135::218     7e-12  55%  384 aa  PRTK_TRIAL RecName: Full=Proteinase K;       
  195::484     7e-12  34%  969 aa  PCSK6_HUMAN RecName: Full=Proprotein convertase subtilisin/kexin
  237::507     1e-11  31% 1249 aa  TPP2_HUMAN RecName: Full=Tripeptidyl-peptidase 2;       
  149::374     3e-11  35%  397 aa  SUB3_NANOT RecName: Full=Subtilisin-like protease 3;       
  149::374     3e-11  35%  397 aa  SUB3_MICCA RecName: Full=Subtilisin-like protease 3;       
  237::507     4e-11  31% 1249 aa  TPP2_RAT RecName: Full=Tripeptidyl-peptidase 2;       
  237::507     4e-11  31% 1262 aa  TPP2_MOUSE RecName: Full=Tripeptidyl-peptidase 2;       
  160::336     4e-11  35%  421 aa  SUB2_TRIEQ RecName: Full=Subtilisin-like protease 2;       
  122::313     4e-11  35%  783 aa  FURI1_XENLA RecName: Full=Furin-1;         EC=3.4.21.75;AltName:
  247::529     5e-11  31%  662 aa  PRCA_ANASP RecName: Full=Calcium-dependent protease;       
  294::566     6e-11  30% 1274 aa  TPP2_SCHPO RecName: Full=Putative tripeptidyl-peptidase P8A3.12c;  
  160::336     6e-11  35%  421 aa  SUB2_TRITO RecName: Full=Subtilisin-like protease 2;       
  161::337     8e-11  36%  423 aa  SUB2_NANOT RecName: Full=Subtilisin-like protease 2;       
  164::453     1e-10  30%  814 aa  KEX2_YEAST RecName: Full=Kexin;         EC=3.4.21.61;AltName:
  407::666     1e-10  31% 1679 aa  FUR2_DROME RecName: Full=Furin-like protease 2;       
  346::607     2e-10  29% 1441 aa  TPP2_DROME RecName: Full=Tripeptidyl-peptidase 2;       
  237::507     2e-10  30% 1249 aa  TPP2_BOVIN RecName: Full=Tripeptidyl-peptidase 2;       
  156::411     2e-10  30%  753 aa  NEC1_BOVIN RecName: Full=Neuroendocrine convertase 1;       
  160::339     5e-10  35%  422 aa  SUB2_TRIVC RecName: Full=Subtilisin-like protease 2;       
  471::564     5e-10  45% 1167 aa  C5AP_STRPY RecName: Full=C5a peptidase;       
  471::564     5e-10  45% 1150 aa  C5AP_STRP8 RecName: Full=C5a peptidase;       
  471::564     5e-10  45% 1184 aa  C5AP_STRP6 RecName: Full=C5a peptidase;       
  473::566     5e-10  45% 1169 aa  C5AP_STRP3 RecName: Full=C5a peptidase;       
  471::564     5e-10  45% 1181 aa  C5AP_STRP1 RecName: Full=C5a peptidase;       
  160::339     7e-10  36%  422 aa  SUB2_ARTBE RecName: Full=Subtilisin-like protease 2;       
  194::333     9e-10  35%  757 aa  SUBL_ARATH RecName: Full=Subtilisin-like protease;       
  160::339     9e-10  35%  424 aa  SUB2_TRIRU RecName: Full=Subtilisin-like protease 2;       
   45::419     2e-09  29%  678 aa  PCSK4_RAT RecName: Full=Proprotein convertase subtilisin/kexin type
   45::419     2e-09  28%  655 aa  PCSK4_MOUSE RecName: Full=Proprotein convertase subtilisin/kexin
  156::411     3e-09  29%  637 aa  NEC2_RAT RecName: Full=Neuroendocrine convertase 2;       
  150::446     3e-09  31%  728 aa  SUB2_DEIRA RecName: Full=Probable subtilase-type serine protease
  177::443     3e-09  31%  692 aa  PCSK9_PANPA RecName: Full=Proprotein convertase subtilisin/kexin
  182::428     3e-09  33% 1696 aa  PCSK5_BRACL RecName: Full=Proprotein convertase subtilisin/kexin
  156::411     3e-09  29%  637 aa  NEC2_MOUSE RecName: Full=Neuroendocrine convertase 2;       
  175::441     4e-09  31%  690 aa  PCSK9_PONPY RecName: Full=Proprotein convertase subtilisin/kexin
  151::440     6e-09  29%  756 aa  KEX1_KLULA RecName: Full=KEX1 protease;         EC=3.4.21.-;Flags:
  177::443     8e-09  31%  692 aa  PCSK9_PANTR RecName: Full=Proprotein convertase subtilisin/kexin
  177::443     8e-09  31%  692 aa  PCSK9_MACNE RecName: Full=Proprotein convertase subtilisin/kexin
  177::443     8e-09  31%  692 aa  PCSK9_MACMU RecName: Full=Proprotein convertase subtilisin/kexin
  177::443     8e-09  31%  692 aa  PCSK9_HUMAN RecName: Full=Proprotein convertase subtilisin/kexin
  175::441     8e-09  31%  690 aa  PCSK9_GORGO RecName: Full=Proprotein convertase subtilisin/kexin
  177::443     8e-09  31%  692 aa  PCSK9_COLGU RecName: Full=Proprotein convertase subtilisin/kexin
  163::455     8e-09  36% 1877 aa  PCSK5_RAT RecName: Full=Proprotein convertase subtilisin/kexin type
  163::455     8e-09  36% 1877 aa  PCSK5_MOUSE RecName: Full=Proprotein convertase subtilisin/kexin
  198::317     8e-09  36%  731 aa  CUCM1_CUCME RecName: Full=Cucumisin;         EC=3.4.21.25;AltName:
  157::412     1e-08  29%  638 aa  NEC2_PONAB RecName: Full=Neuroendocrine convertase 2;       
  157::412     1e-08  29%  638 aa  NEC2_PIG RecName: Full=Neuroendocrine convertase 2;       
  157::412     1e-08  29%  638 aa  NEC2_HUMAN RecName: Full=Neuroendocrine convertase 2;       
  204::323     1e-08  37%  749 aa  XSP1_ARATH RecName: Full=Xylem serine proteinase 1;       
  157::412     2e-08  29%  638 aa  NEC2_BOVIN RecName: Full=Neuroendocrine convertase 2;       
   42::252     2e-08  35%  293 aa  PRTT_TRIAL RecName: Full=Proteinase T;         EC=3.4.21.-;Flags:
  161::453     2e-08  35%  913 aa  PCSK5_HUMAN RecName: Full=Proprotein convertase subtilisin/kexin
  145::402     5e-08  30%  755 aa  PCSK4_HUMAN RecName: Full=Proprotein convertase subtilisin/kexin
  161::316     8e-08  34%  427 aa  SUB2_MICCA RecName: Full=Subtilisin-like protease 2;       
  156::411     2e-07  31%  752 aa  NEC1_RAT RecName: Full=Neuroendocrine convertase 1;       
  156::411     2e-07  31%  753 aa  NEC1_HUMAN RecName: Full=Neuroendocrine convertase 1;       
  156::411     3e-07  31%  753 aa  NEC1_MUSCO RecName: Full=Neuroendocrine convertase 1;       
  156::411     3e-07  31%  753 aa  NEC1_MOUSE RecName: Full=Neuroendocrine convertase 1;       
  152::257     4e-07  33%  400 aa  SUB7_TRIVO RecName: Full=Subtilisin-like protease 7;       
  152::257     4e-07  33%  400 aa  SUB7_TRISD RecName: Full=Subtilisin-like protease 7;       
  152::257     4e-07  33%  400 aa  SUB7_TRIRU RecName: Full=Subtilisin-like protease 7;       
  109::360     5e-07  32%  400 aa  SUB7_NANOT RecName: Full=Subtilisin-like protease 7;       
  200::475     5e-07  28%  924 aa  KEX2_CANAL RecName: Full=Kexin;         EC=3.4.21.61;AltName:
  189::362     5e-07  30%  943 aa  BLI4_CAEEL RecName: Full=Endoprotease bli-4;       
  152::361     7e-07  35%  401 aa  SUB7_TRITO RecName: Full=Subtilisin-like protease 7;       
  152::361     7e-07  35%  401 aa  SUB7_TRIEQ RecName: Full=Subtilisin-like protease 7;       
  153::241     9e-07  39%  709 aa  KRP1_SCHPO RecName: Full=Dibasic-processing endoprotease;       
  140::397     9e-07  32%  793 aa  FURIN_RAT RecName: Full=Furin;         EC=3.4.21.75;AltName:
   66::148     1e-06  35% 1045 aa  PRTS_SERMA RecName: Full=Extracellular serine protease;       
  140::397     2e-06  32%  793 aa  FURIN_MOUSE RecName: Full=Furin;         EC=3.4.21.75;AltName:
  140::397     3e-06  32%  794 aa  FURIN_HUMAN RecName: Full=Furin;         EC=3.4.21.75;AltName:
  361::476     5e-06  38% 1101 aa  FUR1C_DROME RecName: Full=Furin-like protease 1, isoform 1-CRR;    
  361::476     5e-06  38% 1269 aa  FUR11_DROME RecName: Full=Furin-like protease 1, isoforms 1/1-X/2; 
  140::397     6e-06  32%  797 aa  FURIN_BOVIN RecName: Full=Furin;         EC=3.4.21.75;AltName:
  156::257     8e-06  33%  400 aa  SUB7_TRIVC RecName: Full=Subtilisin-like protease 7;       
  156::257     8e-06  33%  400 aa  SUB7_ARTBE RecName: Full=Subtilisin-like protease 7;       
   66::398     8e-06  35% 1045 aa  PRTT_SERMA RecName: Full=Extracellular serine protease;       
  175::441     8e-06  28%  690 aa  PCSK9_LAGLA RecName: Full=Proprotein convertase subtilisin/kexin
  298::472     1e-05  33%  976 aa  XPR6_YARLI RecName: Full=Dibasic-processing endoprotease;       
  175::441     1e-05  28%  690 aa  PCSK9_ATEGE RecName: Full=Proprotein convertase subtilisin/kexin
  180::419     1e-05  36% 1962 aa  P3P_LACLS RecName: Full=PIII-type proteinase;       
  180::419     1e-05  36% 1902 aa  P2P_LACPA RecName: Full=PII-type proteinase;       
  180::419     1e-05  36% 1902 aa  P2P_LACLC RecName: Full=PII-type proteinase;       
  180::419     1e-05  36% 1902 aa  P1P_LACLC RecName: Full=PI-type proteinase;       
  638::696     4e-05  47% 1906 aa  TAGB_DICDI RecName: Full=Prestalk-specific protein tagB;       
  175::441     4e-05  29%  686 aa  PCSK9_SAGLB RecName: Full=Proprotein convertase subtilisin/kexin
  595::625     5e-05  61% 1825 aa  TAGD_DICDI RecName: Full=Serine protease/ABC transporter tagD;     
  580::610     7e-05  58% 1741 aa  TAGC_DICDI RecName: Full=Prestalk-specific protein tagC;       
  175::441     9e-05  28%  690 aa  PCSK9_CALJA RecName: Full=Proprotein convertase subtilisin/kexin
  176::442     1e-04  28%  691 aa  PCSK9_SAIBB RecName: Full=Proprotein convertase subtilisin/kexin
  266::454     1e-04  31%  461 aa  EPIP_STAEP RecName: Full=Epidermin leader peptide-processing serine
  176::269     1e-04  39%  684 aa  PCSK9_CALMO RecName: Full=Proprotein convertase subtilisin/kexin
    1::442

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxLRETVLQLYKPFKWTPCFLHKFFETKLQNRKKMSVIIEFEEGCHETGFQM
ELYA_BACHD      ----------------------------------------------------------------------
SUBT_BACAM      ----------------------------------------------------------------------
THES_BACSJ      ----------------------------------------------------------------------
ISP_PAEPO       ----------------------------------------------------------------------
SUBB_BACLE      ----------------------------------------------------------------------
YCT5_YEAST      ----------------------------------------------------------------------
PSP3_SCHPO      ----------------------------------------------------------------------
PEPC_ASPNG      ----------------------------------------------------------------------
SUBD_BACLI      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBT_BACSU      --------------------MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAM
SUBT_BACST      --------------------MRSKKLWISLLFALTLIFTMAFSNMSVQAAGKSSTEKKYIVGFKQTMSAM
SUBT_BACSA      --------------------MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAM
SUBN_BACNA      --------------------MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAM
SUBE_BACSU      ----------------------------------------------------------------------
SUBT_BACLI      ----------------------------------------------------------------------
YSP3_YEAST      ----------------------------------------------------------------------
PLS_PYRFU       ----------------------------------------------------------------------
PROA_VIBAL      ----------------------------------------------------------------------
ALP_LECPS       ----------------------------------------------------------------------
BPRX_DICNO      ----------------------------------------------------------------------
SUBT_BACPU      ----------------------------------------------------------------------
ISP1_BACSU      ----------------------------------------------------------------------
THET_THEVU      ----------------------------------------------------------------------
PRTM_BACSK      ----------------------------------------------------------------------
SUBV_BACSU      ----------------------------------------------------------------------
SUBS_BACLE      ----------------------------------------------------------------------
ELYA_BACCS      ----------------------------------------------------------------------
ELYA_BACAO      ----------------------------------------------------------------------
HLY_HAL17       ----------------------------------------------------------------------
SUB1_NANOT      ----------------------------------------------------------------------
SUB1_MICCA      ----------------------------------------------------------------------
PRTB_YEAST      ----------------------------------------------------------------------
ISP_BACCS       ----------------------------------------------------------------------
ISP6_SCHPO      ----------------------------------------------------------------------
TKSU_PYRKO      ----------------------------------------------------------------------
AQL1_THEAQ      ----------------------------------------------------------------------
BPRV_DICNO      ----------------------------------------------------------------------
CUDP_METAN      ----------------------------------------------------------------------
WPRA_BACSU      ----------------------------------------------------------------------
SPL1_ENCCU      ----------------------------------------------------------------------
SUBT_BACS9      ----------------------------------------------------------------------
SUB6_TRIVC      ----------------------------------------------------------------------
ELYA_BACYA      ----------------------------------------------------------------------
SUB6_TRISD      ----------------------------------------------------------------------
SUB6_TRIRU      ----------------------------------------------------------------------
SEPR_THESR      ----------------------------------------------------------------------
SUB5_NANOT      ----------------------------------------------------------------------
SUB6_ARTBE      ----------------------------------------------------------------------
SUB6_TRITO      ----------------------------------------------------------------------
SUB6_TRIEQ      ----------------------------------------------------------------------
ORYZ_ASPFL      ----------------------------------------------------------------------
SUB6_NANOT      ----------------------------------------------------------------------
ORYZ_ASPOR      ----------------------------------------------------------------------
SMP1_MAGPO      ----------------------------------------------------------------------
SUB5_TRIVC      ----------------------------------------------------------------------
SUB5_TRIRU      ----------------------------------------------------------------------
SUB5_ARTBE      ----------------------------------------------------------------------
SUB5_TRITO      ----------------------------------------------------------------------
SUB5_TRIEQ      ----------------------------------------------------------------------
EXPR_XANCP      ----------------------------------------------------------------------
ALP_TRIAT       ----------------------------------------------------------------------
ALP_CEPAC       ----------------------------------------------------------------------
SUB4_TRIRU      ----------------------------------------------------------------------
SUB4_TRIVC      ----------------------------------------------------------------------
SUB4_TRITO      ----------------------------------------------------------------------
SUB4_TRIEQ      ----------------------------------------------------------------------
SUB4_ARTBE      ----------------------------------------------------------------------
SUB1_TRIEQ      ----------------------------------------------------------------------
PRTR_TRIAL      ----------------------------------------------------------------------
YZ18_AQUAE      ----------------------------------------------------------------------
SUB1_TRITO      ----------------------------------------------------------------------
SUB1_TRIRU      ----------------------------------------------------------------------
SUB1_TRIVC      ----------------------------------------------------------------------
SUB1_ARTBE      ----------------------------------------------------------------------
SUB4_NANOT      ----------------------------------------------------------------------
MBTP1_CRIGR     ----------------------------------------------------------------------
ORYZ_ASPFU      ----------------------------------------------------------------------
SUB3_TRIVC      ----------------------------------------------------------------------
SUB3_TRIRU      ----------------------------------------------------------------------
SUB3_ARTBE      ----------------------------------------------------------------------
SPM1_MAGGR      ----------------------------------------------------------------------
PCSK9_RAT       ----------------------------------------------------------------------
MBTP1_RAT       ----------------------------------------------------------------------
MBTP1_MOUSE     ----------------------------------------------------------------------
MBTP1_HUMAN     ----------------------------------------------------------------------
SUB3_TRIEQ      ----------------------------------------------------------------------
SUB3_TRITO      ----------------------------------------------------------------------
PRCA_ANAVT      ----------------------------------------------------------------------
PCSK9_MOUSE     ----------------------------------------------------------------------
PCSK6_RAT       ----------------------------------------------------------------------
PRTK_TRIAL      ----------------------------------------------------------------------
PCSK6_HUMAN     ----------------------------------------------------------------------
TPP2_HUMAN      ----------------------------------------------------------------------
SUB3_NANOT      ----------------------------------------------------------------------
SUB3_MICCA      ----------------------------------------------------------------------
TPP2_RAT        ----------------------------------------------------------------------
TPP2_MOUSE      ----------------------------------------------------------------------
SUB2_TRIEQ      ----------------------------------------------------------------------
FURI1_XENLA     ----------------------------------------------------------------------
PRCA_ANASP      ----------------------------------------------------------------------
TPP2_SCHPO      ----------------------------------------------------------------------
SUB2_TRITO      ----------------------------------------------------------------------
SUB2_NANOT      ----------------------------------------------------------------------
KEX2_YEAST      ----------------------------------------------------------------------
FUR2_DROME      ----------------------------------------------------------------------
TPP2_DROME      ----------------------------------------------------------------------
TPP2_BOVIN      ----------------------------------------------------------------------
NEC1_BOVIN      ----------------------------------------------------------------------
SUB2_TRIVC      ----------------------------------------------------------------------
C5AP_STRPY      ----------------------------------------------------------------------
C5AP_STRP8      ----------------------------------------------------------------------
C5AP_STRP6      ----------------------------------------------------------------------
C5AP_STRP3      ----------------------------------------------------------------------
C5AP_STRP1      ----------------------------------------------------------------------
SUB2_ARTBE      ----------------------------------------------------------------------
SUBL_ARATH      ----------------------------------------------------------------------
SUB2_TRIRU      ----------------------------------------------------------------------
PCSK4_RAT       ---------------------------------------------------------EAERLARKFGFVN
PCSK4_MOUSE     ---------------------------------------------------------EAERLARKFGFVN
NEC2_RAT        ----------------------------------------------------------------------
SUB2_DEIRA      ----------------------------------------------------------------------
PCSK9_PANPA     ----------------------------------------------------------------------
PCSK5_BRACL     ----------------------------------------------------------------------
NEC2_MOUSE      ----------------------------------------------------------------------
PCSK9_PONPY     ----------------------------------------------------------------------
KEX1_KLULA      ----------------------------------------------------------------------
PCSK9_PANTR     ----------------------------------------------------------------------
PCSK9_MACNE     ----------------------------------------------------------------------
PCSK9_MACMU     ----------------------------------------------------------------------
PCSK9_HUMAN     ----------------------------------------------------------------------
PCSK9_GORGO     ----------------------------------------------------------------------
PCSK9_COLGU     ----------------------------------------------------------------------
PCSK5_RAT       ----------------------------------------------------------------------
PCSK5_MOUSE     ----------------------------------------------------------------------
CUCM1_CUCME     ----------------------------------------------------------------------
NEC2_PONAB      ----------------------------------------------------------------------
NEC2_PIG        ----------------------------------------------------------------------
NEC2_HUMAN      ----------------------------------------------------------------------
XSP1_ARATH      ----------------------------------------------------------------------
NEC2_BOVIN      ----------------------------------------------------------------------
PRTT_TRIAL      ----------------------------------------------------------------------
PCSK5_HUMAN     ----------------------------------------------------------------------
PCSK4_HUMAN     ----------------------------------------------------------------------
SUB2_MICCA      ----------------------------------------------------------------------
NEC1_RAT        ----------------------------------------------------------------------
NEC1_HUMAN      ----------------------------------------------------------------------
NEC1_MUSCO      ----------------------------------------------------------------------
NEC1_MOUSE      ----------------------------------------------------------------------
SUB7_TRIVO      ----------------------------------------------------------------------
SUB7_TRISD      ----------------------------------------------------------------------
SUB7_TRIRU      ----------------------------------------------------------------------
SUB7_NANOT      ----------------------------------------------------------------------
KEX2_CANAL      ----------------------------------------------------------------------
BLI4_CAEEL      ----------------------------------------------------------------------
SUB7_TRITO      ----------------------------------------------------------------------
SUB7_TRIEQ      ----------------------------------------------------------------------
KRP1_SCHPO      ----------------------------------------------------------------------
FURIN_RAT       ----------------------------------------------------------------------
PRTS_SERMA      ----------------------------------------------------------------------
FURIN_MOUSE     ----------------------------------------------------------------------
FURIN_HUMAN     ----------------------------------------------------------------------
FUR1C_DROME     ----------------------------------------------------------------------
FUR11_DROME     ----------------------------------------------------------------------
FURIN_BOVIN     ----------------------------------------------------------------------
SUB7_TRIVC      ----------------------------------------------------------------------
SUB7_ARTBE      ----------------------------------------------------------------------
PRTT_SERMA      ----------------------------------------------------------------------
PCSK9_LAGLA     ----------------------------------------------------------------------
XPR6_YARLI      ----------------------------------------------------------------------
PCSK9_ATEGE     ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
TAGB_DICDI      ----------------------------------------------------------------------
PCSK9_SAGLB     ----------------------------------------------------------------------
TAGD_DICDI      ----------------------------------------------------------------------
TAGC_DICDI      ----------------------------------------------------------------------
PCSK9_CALJA     ----------------------------------------------------------------------
PCSK9_SAIBB     ----------------------------------------------------------------------
EPIP_STAEP      ----------------------------------------------------------------------
PCSK9_CALMO     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AGEVLQKEKRSKLKSRFNKINCCSAEVTPSALHSLLSECSNIRKVYLNREVKALLDTATEASHAKEVVRN
ELYA_BACHD      ----------------------------------------NVKAIEKNAEVTISQTVPWGISFINTQQAH
SUBT_BACAM      -------EKGGKVQKQFKYVDAASATLNEKAVKELKKDPS-VAYVEEDHVAHAYAQSVPYGSQIKAPALH
THES_BACSJ      ----------------------------------------------------------------------
ISP_PAEPO       ----------------------------------------------------------------------
SUBB_BACLE      -------------------------------------------------------------SRVQAPAAH
YCT5_YEAST      ----------------------------------------------------------------------
PSP3_SCHPO      ----------------------------------------------------------------------
PEPC_ASPNG      ----------------------------------------------------------------------
SUBD_BACLI      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBT_BACSU      SSAKKKSEKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSYVEEDHIAHEYAQSVPYGI--SQIKAPALH
SUBT_BACST      SSAKKKSEKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSYVEEDHIAHEYAQSVPYGI--SQIKAPALH
SUBT_BACSA      SSAKKKSEKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSYVEEDHIAHEYAQSVPYGI--SQIKAPALH
SUBN_BACNA      SSAKKKSEKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSYVEEDHIAHEYAQSVPYGI--SQIKAPALH
SUBE_BACSU      ----------------------------------------------------------------------
SUBT_BACLI      ----------------------------------------------------------------------
YSP3_YEAST      ----------------------------------------------------------------------
PLS_PYRFU       ----------------------------------------------------------------------
PROA_VIBAL      ----------------------------------------------------------------------
ALP_LECPS       ----------------------------------------------------------------------
BPRX_DICNO      ----------------------------------------------------------------------
SUBT_BACPU      -------------------------------------------------------------SQIKAPALH
ISP1_BACSU      ----------------------------------------------------------------------
THET_THEVU      ----------------------------------------------------------------------
PRTM_BACSK      -------------------------------------------------------------SRVQAPAAH
SUBV_BACSU      ----------------------------------------------------------------------
SUBS_BACLE      -------------------------------------------------------------SRVQAPAAH
ELYA_BACCS      -------------------------------------------------------------SRVQAPAAH
ELYA_BACAO      -------------------------------------------------------------SRVQAPAAH
HLY_HAL17       ----------------------------------------------------------------------
SUB1_NANOT      ----------------------------------------------------------------------
SUB1_MICCA      ----------------------------------------------------------------------
PRTB_YEAST      ----------------------------------------------------------------------
ISP_BACCS       ----------------------------------------------------------------------
ISP6_SCHPO      ----------------------------------------------------------------------
TKSU_PYRKO      ----------------------------------------------------------------------
AQL1_THEAQ      ----------------------------------------------------------------------
BPRV_DICNO      ----------------------------------------------------------------------
CUDP_METAN      ----------------------------------------------------------------------
WPRA_BACSU      ----------------------------------------------------------------------
SPL1_ENCCU      ----------------------------------------------------------------------
SUBT_BACS9      ----------------------------------------------------------------------
SUB6_TRIVC      ----------------------------------------------------------------------
ELYA_BACYA      ------------LLHEFDFIPVLSVELDPEDVDALELDPA-IAYIEEDAEVTTMQTVPWGINRVQAPIAQ
SUB6_TRISD      ----------------------------------------------------------------------
SUB6_TRIRU      ----------------------------------------------------------------------
SEPR_THESR      ----------------------------------------------------------------------
SUB5_NANOT      ----------------------------------------------------------------------
SUB6_ARTBE      ----------------------------------------------------------------------
SUB6_TRITO      ----------------------------------------------------------------------
SUB6_TRIEQ      ----------------------------------------------------------------------
ORYZ_ASPFL      ----------------------------------------------------------------------
SUB6_NANOT      ----------------------------------------------------------------------
ORYZ_ASPOR      ----------------------------------------------------------------------
SMP1_MAGPO      ----------------------------------------------------------------------
SUB5_TRIVC      ----------------------------------------------------------------------
SUB5_TRIRU      ----------------------------------------------------------------------
SUB5_ARTBE      ----------------------------------------------------------------------
SUB5_TRITO      ----------------------------------------------------------------------
SUB5_TRIEQ      ----------------------------------------------------------------------
EXPR_XANCP      ----------------------------------------------------------------------
ALP_TRIAT       ----------------------------------------------------------------------
ALP_CEPAC       ----------------------------------------------------------------------
SUB4_TRIRU      ----------------------------------------------------------------------
SUB4_TRIVC      ----------------------------------------------------------------------
SUB4_TRITO      ----------------------------------------------------------------------
SUB4_TRIEQ      ----------------------------------------------------------------------
SUB4_ARTBE      ----------------------------------------------------------------------
SUB1_TRIEQ      ----------------------------------------------------------------------
PRTR_TRIAL      ----------------------------------------------------------------------
YZ18_AQUAE      ----------------------------------------------------------------------
SUB1_TRITO      ----------------------------------------------------------------------
SUB1_TRIRU      ----------------------------------------------------------------------
SUB1_TRIVC      ----------------------------------------------------------------------
SUB1_ARTBE      ----------------------------------------------------------------------
SUB4_NANOT      ----------------------------------------------------------------------
MBTP1_CRIGR     ----------------------------------------------------------------------
ORYZ_ASPFU      ----------------------------------------------------------------------
SUB3_TRIVC      ----------------------------------------------------------------------
SUB3_TRIRU      ----------------------------------------------------------------------
SUB3_ARTBE      ----------------------------------------------------------------------
SPM1_MAGGR      ----------------------------------------------------------------------
PCSK9_RAT       ----------------------------------------------------------------------
MBTP1_RAT       ----------------------------------------------------------------------
MBTP1_MOUSE     ----------------------------------------------------------------------
MBTP1_HUMAN     ----------------------------------------------------------------------
SUB3_TRIEQ      ----------------------------------------------------------------------
SUB3_TRITO      ----------------------------------------------------------------------
PRCA_ANAVT      ----------------------------------------------------------------------
PCSK9_MOUSE     ----------------------------------------------------------------------
PCSK6_RAT       ----------------------------------------------------------------------
PRTK_TRIAL      ----------------------------------------------------------------------
PCSK6_HUMAN     ----------------------------------------------------------------------
TPP2_HUMAN      ----------------------------------------------------------------------
SUB3_NANOT      ----------------------------------------------------------------------
SUB3_MICCA      ----------------------------------------------------------------------
TPP2_RAT        ----------------------------------------------------------------------
TPP2_MOUSE      ----------------------------------------------------------------------
SUB2_TRIEQ      ----------------------------------------------------------------------
FURI1_XENLA     -----------------------------------------------------LLDTNRHDLHVKEAWEQ
PRCA_ANASP      ----------------------------------------------------------------------
TPP2_SCHPO      ----------------------------------------------------------------------
SUB2_TRITO      ----------------------------------------------------------------------
SUB2_NANOT      ----------------------------------------------------------------------
KEX2_YEAST      ----------------------------------------------------------------------
FUR2_DROME      ----------------------------------------------------------------------
TPP2_DROME      ----------------------------------------------------------------------
TPP2_BOVIN      ----------------------------------------------------------------------
NEC1_BOVIN      ----------------------------------------------------------------------
SUB2_TRIVC      ----------------------------------------------------------------------
C5AP_STRPY      ----------------------------------------------------------------------
C5AP_STRP8      ----------------------------------------------------------------------
C5AP_STRP6      ----------------------------------------------------------------------
C5AP_STRP3      ----------------------------------------------------------------------
C5AP_STRP1      ----------------------------------------------------------------------
SUB2_ARTBE      ----------------------------------------------------------------------
SUBL_ARATH      ----------------------------------------------------------------------
SUB2_TRIRU      ----------------------------------------------------------------------
PCSK4_RAT       LGQIFPDDQYFHLRHR----GVAQQSLTPHWGHRLLKKEPKVRQQTLRRRVKRSLVVPTDPWFSKQWYMN
PCSK4_MOUSE     LGQIFPDDQYFHLRHR----GVAQQSLTPHWGHRLLKKDPKVRQQTLRRRVKRSLVVPTDPWFSKQWYMN
NEC2_RAT        ----------------------------------------------------------------------
SUB2_DEIRA      ----------------------------------------------VNQVFDTLPQYALDSNHLHAKAAW
PCSK9_PANPA     ----------------------------------------------------------------------
PCSK5_BRACL     ----------------------------------------------------------------------
NEC2_MOUSE      ----------------------------------------------------------------------
PCSK9_PONPY     ----------------------------------------------------------------------
KEX1_KLULA      ----------------------------------------------------------------------
PCSK9_PANTR     ----------------------------------------------------------------------
PCSK9_MACNE     ----------------------------------------------------------------------
PCSK9_MACMU     ----------------------------------------------------------------------
PCSK9_HUMAN     ----------------------------------------------------------------------
PCSK9_GORGO     ----------------------------------------------------------------------
PCSK9_COLGU     ----------------------------------------------------------------------
PCSK5_RAT       ----------------------------------------------------------------------
PCSK5_MOUSE     ----------------------------------------------------------------------
CUCM1_CUCME     ----------------------------------------------------------------------
NEC2_PONAB      ----------------------------------------------------------------------
NEC2_PIG        ----------------------------------------------------------------------
NEC2_HUMAN      ----------------------------------------------------------------------
XSP1_ARATH      ----------------------------------------------------------------------
NEC2_BOVIN      ----------------------------------------------------------------------
PRTT_TRIAL      ----------------------------------------------------------------------
PCSK5_HUMAN     ----------------------------------------------------------------------
PCSK4_HUMAN     ----------------------------------------------------------------------
SUB2_MICCA      ----------------------------------------------------------------------
NEC1_RAT        ----------------------------------------------------------------------
NEC1_HUMAN      ----------------------------------------------------------------------
NEC1_MUSCO      ----------------------------------------------------------------------
NEC1_MOUSE      ----------------------------------------------------------------------
SUB7_TRIVO      ----------------------------------------------------------------------
SUB7_TRISD      ----------------------------------------------------------------------
SUB7_TRIRU      ----------------------------------------------------------------------
SUB7_NANOT      ---------------------------------------------YIERDARVQINAITEQDNVPSLARV
KEX2_CANAL      ----------------------------------------------------------------------
BLI4_CAEEL      ----------------------------------------------------------------------
SUB7_TRITO      ----------------------------------------------------------------------
SUB7_TRIEQ      ----------------------------------------------------------------------
KRP1_SCHPO      ----------------------------------------------------------------------
FURIN_RAT       ----------------------------------------------------------------------
PRTS_SERMA      ----------------------------------------------------------------------
FURIN_MOUSE     ----------------------------------------------------------------------
FURIN_HUMAN     ----------------------------------------------------------------------
FUR1C_DROME     ----------------------------------------------------------------------
FUR11_DROME     ----------------------------------------------------------------------
FURIN_BOVIN     ----------------------------------------------------------------------
SUB7_TRIVC      ----------------------------------------------------------------------
SUB7_ARTBE      ----------------------------------------------------------------------
PRTT_SERMA      ----------------------------------------------------------------------
PCSK9_LAGLA     ----------------------------------------------------------------------
XPR6_YARLI      ----------------------------------------------------------------------
PCSK9_ATEGE     ----------------------------------------------------------------------
P3P_LACLS       -----------------------------------------LAKVYYPTDAKANSMANVQA------VWS
P2P_LACPA       -----------------------------------------LAKVYYPTDAKANSMANVQA------VWS
P2P_LACLC       -----------------------------------------LAKVYYPTDAKANSMANVQA------VWS
P1P_LACLC       -----------------------------------------LAKVYYPTDAKANSMANVQA------VWS
TAGB_DICDI      ----------------------------------------------------------------------
PCSK9_SAGLB     ----------------------------------------------------------------------
TAGD_DICDI      ----------------------------------------------------------------------
TAGC_DICDI      ----------------------------------------------------------------------
PCSK9_CALJA     ----------------------------------------------------------------------
PCSK9_SAIBB     ----------------------------------------------------------------------
EPIP_STAEP      ----------------------------------------------------------------------
PCSK9_CALMO     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYRGPA
ELYA_BACHD      NRGIFGNGARVAVLDTGIASHPDL--RIAGGASFISSEPSYHDNNGHGTHVAGTIAALNNSIGVL--GVA
SUBT_BACAM      SQGYTGSNVKVAVIDSGISSHPDL--KVAGGASMVPSETNPFDNNSHGTHVAGTVAALNNSIGVL--GVA
THES_BACSJ      --TKGSSGQEIAVIDTGVYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAG-IAAAETNNATGIAGMA
ISP_PAEPO       -----GRGVKVAVLDTGCADHPDLKARIIGFTDDDEGDPEIFKDNGHGTHVAGTIAATENENGVV--GVA
SUBB_BACLE      NRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIG--VLGVA
YCT5_YEAST      -----GQDVNAYIMDTGIFAHPEFEDRVIQGIDLTKEGFG--DQNGHGTHVAGLVGSKTY-------GAA
PSP3_SCHPO      -----GEGVTAYVIDTGIIEHQDFQGRATWGATIPTGEGE-VDDHGHGTHVAGTIAGKTF-------GVS
PEPC_ASPNG      -----GEGVDAYTIDTGIVDHVDFEGRAT-WGKTIPTNDEDLDGNGHGTHCSGTMAGKKY-------GVA
SUBD_BACLI      -QGYKGANVKVGIIDTGIAAHTDL--KVVGGASFVSGESYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
SUBF_BACSU      -----GTGTVVASIDTGVWNHPALKEKYRGYXDAVAGEASPYDDLAHGTHVTGTMVGSEPDGTNQI-GVA
SUBT_BACSU      SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVA
SUBT_BACST      SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVS
SUBT_BACSA      SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVS
SUBN_BACNA      SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVA
SUBE_BACSU      ---LTGKNIKIAVIDSGISPHDDLS--IAGGYSAVSYTSSYKDDNGHGTHVAGIIGAKHNGYGID--GIA
SUBT_BACLI      -QGFKGANVKVAVLDTGIQAHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVL--GVA
YSP3_YEAST      -----GKGVTSYVLDTGITEHEDFEGRA-EWGAVIPANDEASDLNGHGTHCAGIIGS-------KHFGVA
PLS_PYRFU       ------------------------------------------------------------------QGVA
PROA_VIBAL      -----GTGVTAYVIDTGVNAHVEFGGRSVSGYDFVDNDADASDCNGHGTHVAGTIGGSLY-------GVA
ALP_LECPS       --TSAGAGACVYVIDTGVEDHPDFEGRA---KQIKSYASTARDGHGHGTHCAGTIGSKTW-------GVA
BPRX_DICNO      ---ITGKGVTVAVVDTGIVNHPDLNANVIGY-DFIQEAEIAQDGDGHGSHVAGTIAAVTNNRIG-VSGVA
SUBT_BACPU      SQGYTGSNVKVAVIDSGISSHPDLNVR--GGASFVPSETNPYQDSSHGTHVAGTIAALNNSIGVL--GVA
ISP1_BACSU      -----GKNIKVAVLDTGCTSHPDLKNQIIGFTDDDGGKEDAISDNGHGTHVAGTIAANDSNGG--IAGVA
THET_THEVU      -----GSGAKIAIVDTGVQSHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAG-IAAAVTNNSTGIAGTA
PRTM_BACSK      NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
SUBV_BACSU      ----TGKGIKVAIIDTGVYNHPDLKGQYKGY-DFVDNDYDPKETTDHGTHVAGTVAANGTI-----KGVA
SUBS_BACLE      NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
ELYA_BACCS      NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
ELYA_BACAO      NRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL--GVA
HLY_HAL17       -------GVTISVVDQGIYDHEDLEGNMDGSVDFVDNDGDPYPSENHGTHVXXXXXXXXXXXXXXXXXS-
SUB1_NANOT      -----GEGITVYSVDTGVIHHEDFEGRASWGTNMIEDGYDK-DGNGHGTHTAGTMVGKTF-------GIX
SUB1_MICCA      -----GEGITVYSVDTGVIHHEDFEGRASWGTNMIEDGYDK-DGNGHGTHTAGTMVGKTF-------GIX
PRTB_YEAST      -----GRGVTSYVIDTGVINHKDFEKRAI-WGKTIPLNDEDLDGNGHGTHCAGTI-------ASKHYGXX
ISP_BACCS       -----GAGQIIGVIDTGCQDHPDLAERIIGGVNLTTDETNFSDNNGHGTHVAGTVAAAETGSGVV--GVA
ISP6_SCHPO      -----GDNITAYVVDTGVIHHVEFEGRASWGATIPSGDVDE-DNNGHGTHVAGTIASRAY-------GXX
TKSU_PYRKO      --------IQVAVLDTGVYDHPDLAANIAWCVSTLRGKVSTKDQNGHGTHVIGTIAALNNDIGVV--GVA
AQL1_THEAQ      --TATGRGVNVYVIDTGIRTHREFGGRARVGYDALGGNGQ--DCNGHGTHVAGTIGGVTY-------GVA
BPRV_DICNO      ----TGQGVVVSVVDTGILDHVDLNGNMLPGYDFISSAPNARDDEGHGSHVAGTIXXXXXXXXXXXXXXX
CUDP_METAN      -----GQGTCVYIIDTGIEAHPEFEGRATFLKSFISGQNT--DGHGHGTHCAGTIGSKTY-------GVA
WPRA_BACSU      ----------IAVVDTGVDSTADLKGKVLGH-NFVGRNNNAMDDQGHGTHVAG-IIAAQSDNGYSMTGLN
SPL1_ENCCU      ----SGKGVDVYVLDTGVIEHPEFGGRARWGANFV-PKSPDRDEHGHGTHCAGVIGGKNF-------GVT
SUBT_BACS9      -----------AVLDTGVNTHPDLRNNVEQCKDFTVGTTYTNDRQGHGTHVAGSALADGGTGNGVY-GVA
SUB6_TRIVC      -----GKGVTAYVIDTGITKHEDFGGRAKWGKNLVDQMDED---------CNXXXXXXXXXXXXXKYGLA
ELYA_BACYA      SRGFTGTGVRVAVLDTGISNHADL--RIRGGASFVPGEPNISDGNGHGTQVAGTIAALNNSIG--VLGVA
SUB6_TRISD      -----GKGVTAYIIDTGIIDHEDFQGRAKWGENFVDQQN---------TDCNXXXXXXXXXXXXXKYGLA
SUB6_TRIRU      -----GKGVTAYIIDTGIIDHEDFQGRAKWGENFVDQQN---------TDCNXXXXXXXXXXXXXKYGLA
SEPR_THESR      --TATGAGVHAYVVDTGILSHQEFTGRIGKGYDAITPGGSAQDCNGHGTHVAGTIGGTTY-------GVA
SUB5_NANOT      -----GAGVWAYVVDSGVIRHAEFRGRAVWGSNQVDNQNS--DGTGHGTHVAGTIAGKTY-------GXX
SUB6_ARTBE      -----GKGVRAYIIDTGITDHKDFGGRAKNFADDMDQD------------CNXXXXXXXXXXXXXQYGLA
SUB6_TRITO      -----GKGVTAYVIDTGIINHEDFRGRAKWGKNFVDDMDED---------CNXXXXXXXXXXXXXKYGLA
SUB6_TRIEQ      -----GKGVTAYVIDTGIINHEDFRGRAKWGKNFVDDMDED---------CNXXXXXXXXXXXXXKYGLA
ORYZ_ASPFL      -----GEGTYAYVVDIGIVDHEEFEGRALAYHAAGGQHV---DGVGHGTHVSGTIGGKTY-------GVA
SUB6_NANOT      -----GEGTTAYIVDTGIDVN---NGDFGGRAKWGNNFVDHQD-----TDCNXXXXXXXXXXXXKNFGVA
ORYZ_ASPOR      --TSAGEGTYAYVVDSGVVDHEEFEGRASKAYNAAGG--QHVDSIGHGTHVSGTIAGKTY-------GIA
SMP1_MAGPO      ------------IIDTGLTEHVEFEGRTLGYNAYPNSQF--IDKIGHGTHVAGTIAGKTY-------GVA
SUB5_TRIVC      -----GSGVWAYVVDSGVVRHAEFQGRAVWGSNLVDNKNS--DGTGHGTHVAGTIAGKTY-------GIX
SUB5_TRIRU      -----GSGVWAYVVDSGVIRHSEFQGRAVWGSNLVDNKNS--DGTGHGTHVAGTIAGKTY-------GIX
SUB5_ARTBE      -----GSGVWAYVVDSGVVRHAEFQGRAVWGSNLVDNKNS--DGTGHGTHVAGTIAGKTY-------GIX
SUB5_TRITO      -----GSGVWAYVVDSGVIRHSEFQGRAVWGSNLVDNKNS--DGTGHGTHVAGTIAGKTY-------GIX
SUB5_TRIEQ      -----GSGVWAYVVDSGVIRHSEFQGRAVWGSNLVDNKNS--DGTGHGTHVAGTIAGKTY-------GIX
EXPR_XANCP      ----TGSGTVVAVIDTGITSHADLNANILAGYDFISDATTARDGNGRDSNAA-DEGDWYAANECGAGIPA
ALP_TRIAT       -----GAGTFAYVVDSGINTHQQFGGRALGYNAAGGQHV---DTLGHGTHVSGTIGGSTY-------GVA
ALP_CEPAC       -----GSGTYAYVVDTGILEHNEFSGRAITGYNAVGGSNA--DTNGHGTHVAGTI-------GGRTYGVA
SUB4_TRIRU      -----GRGVTIYGVDTGIINHQDFRGRARWGTNTADRDNA--DRHGHGTHTASTFAGTAY-------GIA
SUB4_TRIVC      -----GRGVTIYGVDTGIINHQDFRGRARWGTNTADRDNA--DRHGHGTHTASTFAGTAY-------GIA
SUB4_TRITO      -----GRGVTIYGVDTGIINHQDFRGRARWGTNTADRDNA--DRHGHGTHTASTFAGTAY-------GIA
SUB4_TRIEQ      -----GRGVTIYGVDTGIINHQDFRGRARWGTNTADRDNA--DRHGHGTHTASTFAGTAY-------GIA
SUB4_ARTBE      -----GRGVTIYGVDTGIINHQDFRGRARWGTNTADRDNA--DRHGHGTHTASTFAGTAY-------GIA
SUB1_TRIEQ      -----GEGITVYSVDTGVINHEDFEGRAIWGSNQVN--------DGDDRDXXXXXXXXXXXMVGKEFGIX
PRTR_TRIAL      -----GQGTCVYVIDTGVEAHPEFEGR----AQMVKTYASSRDGNGHGTHCAGTIGSRTY-------GVA
YZ18_AQUAE      ----------------------------------------------------------------------
SUB1_TRITO      -----GEGITVYSVDTGVINHEDFEGRAIWGSNQVN--------DGDDRDXXXXXXXXXXXMVGKEFGIX
SUB1_TRIRU      -----GEGITVYSVDTGVVNHEDFEGRAIWGSNQVN--------DGDDRDXXXXXXXXXXXMVGKMYGIX
SUB1_TRIVC      -----GEGITVYSVDTGVVNHEDFEGRAIWGSNQVN--------DGDDRDXXXXXXXXXXXMVGKEFGIX
SUB1_ARTBE      -----GEGITVYSVDTGVVNHEDFEGRAIWGSNQVN--------DGDDRDXXXXXXXXXXXMVGKEFGIX
SUB4_NANOT      -----GRGVTIYGVDTGIINHQDFRGRARWGTNTADRDNA--DRHGHGTHTASTFAGTTY-------GIA
MBTP1_CRIGR     ----TGANVRVAVFDTGLSEHPHFKN-VKERTNWTNERTLD-DGLGHGTFVAGVIASMR-----ECQGFA
ORYZ_ASPFU      --TSAGAGTYAYVVDSGIVNHVEFESR----ASLAYNAASHVDSIGHGTHVAGTIGGKTY-------GVA
SUB3_TRIVC      ----------------------------------------------------------------------
SUB3_TRIRU      ----------------------------------------------------------------------
SUB3_ARTBE      ----------------------------------------------------------------------
SPM1_MAGGR      -----GEGVDAYVIDTGTIDHVDFEGRA-HWGKTIPANDQDIDGNGHGTHCSG-------TXXXXXXXXX
PCSK9_RAT       --------VEVYLLDTSIQSHREIEGRVT----ITDFNSVPEEDDSHGTHLAGVVSGRDA-------GVA
MBTP1_RAT       ----TGANVRVAVFDTGLSEHPHFKN-VKERTNWTNERTLD-DGLGHGTFVAGVIASMR-----ECQGFA
MBTP1_MOUSE     ----TGANVRVAVFDTGLSEHPHFKN-VKERTNWTNERTLD-DGLGHGTFVAGVIASMR-----ECQGFA
MBTP1_HUMAN     ----TGANVRVAVFDTGLSEHPHFKN-VKERTNWTNERTLD-DGLGHGTFVAGVIASMR-----ECQGFA
SUB3_TRIEQ      ----------------------------------------------------------------------
SUB3_TRITO      ----------------------------------------------------------------------
PRCA_ANAVT      -------------------------GKIVAPRDVTRKTNFPTPGNNHGTACAGVACGNGNFGAS---GVA
PCSK9_MOUSE     --------VEVYLLDTSIQAHREIEGRVT----ITDFNSVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK6_RAT       ----TGKNVVVTILDDGIERHPDLAPNYDSYADVNGNDYDPYDENKHGTRCAGEVAASANNSYC-IVGIA
PRTK_TRIAL      -----GQGSCVYVIDTGIEAHPEFEGR----AQMV--KTYYYDGNGHGTHCAGTV-------GSRTYGVA
PCSK6_HUMAN     ----TGKNVVVTILDDGIERHPDLAPNYDSYADVNGNDYDPYDENKHGTRCAGEVAASANNSYC-IVGIA
TPP2_HUMAN      -----------------------------GTAEMLNYSVNIYDDGNHGTHVAS-IAAGHFPEEPERNGVA
SUB3_NANOT      -----GQGVTIYGVDTGIINHPEFRGRI---------RWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SUB3_MICCA      -----GQGVTIYGVDTGIINHPEFRGRI---------RWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
TPP2_RAT        -----------------------------GTAEMLNYSVNIYDDGNHGTHVAS-IAAGHFPEEPERNGVA
TPP2_MOUSE      -----------------------------GTAEMLNYSVNIYDDGNHGTHVAS-IAAGHFPEEPERNGVA
SUB2_TRIEQ      -----GEGVWAYVLDTGIVNHVEFEGRAILGHNAIPNKPHT-DEFGHGTYVAGIIAGKTY-------GXX
FURI1_XENLA     G--FTGKGIVVSILDDGIEKHPDLQANYDPAADVNDQDPDPQNDNRHGTRCAGEVAAVANNGICGV-GIA
PRCA_ANASP      -------------------------GKIVAPRDVTRKTNFPTPGNNHGTACAGVACGNGNFGAS---GVA
TPP2_SCHPO      ------------------------EWSTFGSLDLLSYGVHVYDNGNHGTHVAG-IIGANHPETPELNGAA
SUB2_TRITO      -----GEGVWAYVLDTGIVNHVEFEGRAILGHNAIPNKPHT-DEFGHGTYVAGIIAGKTY-------GXX
SUB2_NANOT      -----GEGVWAYVLDTGIVDHIEFEGRILGHNAIPNKPHT--DEFGHGTYVAGIIAGKTY-------GXX
KEX2_YEAST      ---ITGAGVVAAIVDDGLYENEDLKDNFCAFNDNTNLPKPRLSDDYHGTRCAGEIAAKKGNNFCGV-GVG
FUR2_DROME      ----TGKGVVVSILDDGIQTHPDLAQNYDPEADINGNDSDPTPDNKHGTRCAGEVAAVAFNNFCGV-GVA
TPP2_DROME      ------------------------EGNVLEVVGMSSPHGTHVSSIASGNHSSRDVD-----------GVA
TPP2_BOVIN      -----------------------------GAAEMLNYSVNIYDDGNHGTHVAS-IAAGHFPEEPERNGVA
NEC1_BOVIN      ---ITGKGVVITVLDDGLWNHTDIYANYYDFNDNDHDPFPRYDENKHGTRCAGEIAMQANNHKCGV-GVA
SUB2_TRIVC      -----GEGVWAYVLDTGIVNHIEFEGRAILGHNAIPNKPHT-DEFGHGTYVAGIIAGKTYGXXXXXXXXX
C5AP_STRPY      ----------------------------------------------------------------------
C5AP_STRP8      ----------------------------------------------------------------------
C5AP_STRP6      ----------------------------------------------------------------------
C5AP_STRP3      ----------------------------------------------------------------------
C5AP_STRP1      ----------------------------------------------------------------------
SUB2_ARTBE      -----GEGVWAYVLDTGIVNHVEFEGRILGHNAIPNKPHT--DEFGHGTYVAGIIAGKTYGXXXXXXXXX
SUBL_ARATH      ----------------------------MGPIDESKESRSPRDDDGHGTHAAGSVVEGASLLGYASRGMA
SUB2_TRIRU      -----GEGVWAYVLDTGIVNHVEFEGRAILGHNAIPNKSHT-DEFGHGTCVAGIIAGKTYGXXXXXXXXX
PCSK4_RAT       NQGLTGRGVVVSILDDGIEKHPDLWANYDPLASYPQPRYTPNDENRHGTRCAGEVSATANNGFCG-AGVA
PCSK4_MOUSE     NQGLTGRGVVISILDDGIEKHPDLWANYDPLASYPQPRYTPNDENRHGTRCAGEVSATANNGFCG-AGVA
NEC2_RAT        ----TGKGVTIGIMDDGIYLHPDLAYNYNSDASYDFSSNDPYDDNSHGTRCAGEVSAAASNNICGV-GVA
SUB2_DEIRA      DAGFTGKGVKVGVIDPSDVSHPDLRDAIDGFDGKVDNKVDPGIE--HGTAVASTIAAAKNGQGIV--GVA
PCSK9_PANPA     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFENVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK5_BRACL     ----TGKGVVVSILDDGSETHPDLAGNINGGTLDPTPRYEYTNENRHGTRCAGEVAAMGNNSFCSV-GVA
NEC2_MOUSE      ----TGKGVTIGIMDDGIYLHPDLAYNYNADASYDFSSNDPYDDNSHGTRCAGEVSAAASNNICGV-GVA
PCSK9_PONPY     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFENVPEEDDSHGTHLAGVVSGRDA-------GVA
KEX1_KLULA      -ENITGYGVVAALVDDGLYENEDLKDNVEGSWDFNDNNPLPLKDDYHGTRCAGEIAAFRNDICGV--GVA
PCSK9_PANTR     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFENVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK9_MACNE     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFESVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK9_MACMU     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFESVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK9_HUMAN     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFENVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK9_GORGO     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFENVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK9_COLGU     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFESVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK5_RAT       ----TGKNIVVTILDDGIETHPDLMQNYDALADVNGNDLDPYDENKHGTRCAGEVAATANNSHCTV-GIA
PCSK5_MOUSE     ----TGKNIVVTILDDGIETHPDLMQNYDALADVNGNDLDPYDENKHGTRCAGEVAATANNSHCTV-GIA
CUCM1_CUCME     ----------------------------------------PRDTNGHGTHTASTAAG----------GLV
NEC2_PONAB      ----TGKGVTIGIMDDGIYLHPDLASNYNAEASYDFSSNDPYDDNSHGTRCAGEVSAAANNNICGV-GVA
NEC2_PIG        ----TGKGVTIGIMDDGIYLHPDLASNYNAEASYDFSSNDPYDDNSHGTRCAGEVSAAANNNICGV-GVA
NEC2_HUMAN      ----TGKGVTIGIMDDGIYLHPDLASNYNAEASYDFSSNDPYDDNSHGTRCAGEVSAAANNNICGV-GVA
XSP1_ARATH      ----------------------------------------PIDIDGHGTHTSSTVAGVLVANASLYRGAV
NEC2_BOVIN      ----TGKGVTIGIMDDGIYLHPDLASNYNAEASYDFSSNDPYDDNSHGTRCAGEVSAAANNNICGV-GVA
PRTT_TRIAL      -----GTGTCAYIIDTGIYTHTDFGGRA--------KFLKNFAGDGQDTDGNXXXXXXXXXXXXXXXXXX
PCSK5_HUMAN     ----TGKNIVVTILDDGIETHPDLMQNYDALADVNGNDLDPYDENKHGTRCAGEVAAAANNSHCTV-GIA
PCSK4_HUMAN     -QGLSGQGIVVSVLDDGIEKHPDLWANYDPLASYPQPRYTPSKENRHGTRCAGEVAAMANNGFCGV-GVA
SUB2_MICCA      -----GEGVWAYVLDTGIVDHIEFEDRILGHNAIPNKPHT--DEFEHGTYVAGIIAGKTYGXXXXXXXXX
NEC1_RAT        ---ITGKGVVITVLDDGLWNHTDIYANYYDFNDNDHDRYDPTNENKHGTRCAGEIAMQANNHKCGV-GVA
NEC1_HUMAN      ---ITGKGVVITVLDDGLWNHTDIYANYYDFNDNDHDRYDPTNENKHGTRCAGEIAMQANNHKCGV-GVA
NEC1_MUSCO      ---ITGKGVVITVLDDGLWNHTDIYANYYDFNDNDHDPFPRYDENKHGTRCAGEIAMQANNHKCGV-GVA
NEC1_MOUSE      ---ITGKGVVITVLDDGLWNHTDIYANYYDFNDNDHDPFPRYDENKHGTRCAGEIAMQANNHKCGV-GVA
SUB7_TRIVO      -----GEGSTAYVIDTGTIQHEEFEGRATWGANFVDDMD--MDCNGHGTHVSGTIGGKTF-------GXX
SUB7_TRISD      -----GEGSTAYVIDTGTIQHEEFEGRATWGANFVDDMD--MDCNGHGTHVSGTIGGKTF-------GXX
SUB7_TRIRU      -----GEGSTAYVIDTGTIQHEEFEGRATWGANFVDDMD--MDCNGHGTHVSGTIGGKTF-------GXX
SUB7_NANOT      GSSTAGEGSTAYIIDTGTIEHEEFEGRATWGSNFVDDMD---------MDCNXXXXXXXXXXXXATFGVA
KEX2_CANAL      -EDILGQGIVTALVDDGVDAESDQNFNSEGSWDFNNKGKSPLPDDYHGTRCAGEIAAVKNDVCGI--GVA
BLI4_CAEEL      -QGYAGRNVSVSILDDGIQDHPDLAANYLASTDINDHDDDPTPDNKHGTRCAGEVAALAGNNQCGV-GVA
SUB7_TRITO      -----GEGTTAYIIDTGTIQHEEFDG---GRATWGENFVDDMDMD-----CNXXXXXXXXXXXXRTFGVA
SUB7_TRIEQ      -----GEGTTAYIIDTGTIQHEEFDG---GRATWGENFADDMDMD-----CNXXXXXXXXXXXXRTFGVA
KRP1_SCHPO      -----GENVTVAFVDDGIFKHPDLQAAYTSFNDNIADPLPKLSDDQHGTRCAGEVAAAWNDVCGV--GIA
FURIN_RAT       -QGFTGRGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
PRTS_SERMA      ----TGKGITIGVIDNAILSHSEFSGKLTGSYNFSYDKQDNMSFGDHGTHVAG--IAAAKRDGAGMHGVA
FURIN_MOUSE     -QGFTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
FURIN_HUMAN     -QGYTGHGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
FUR1C_DROME     ---ITGKGVVVTILDDGLESHPDIQDNYDPKADVNSHDDDPMDSNRHGTRCAGEVAATANNSFCAV-GIA
FUR11_DROME     ---ITGKGVVVTILDDGLESHPDIQDNYDPKADVNSHDDDPMDSNRHGTRCAGEVAATANNSFCAV-GIA
FURIN_BOVIN     -QGYTGRGIVVSILDDGIEKHPDLAGNYDPGADVNDQDPDPMNDNRHGTRXXXXXXXXXXXXXXXXXXXY
SUB7_TRIVC      ---------TAYVIDTGTIQHEEFEGRATWGANFVDDMD--MDCNGHGTHVSGTIGGKTF-------GXX
SUB7_ARTBE      ---------TAYVIDTGTIQHEEFEGRATWGANFVDDMD--MDCNGHGTHVSGTIGGKTF-------GXX
PRTT_SERMA      ----TGKGVTIGVIDDAILSHPEFAGKLTGSYNFSYDKQDNMSFGTHGTHVAG--IAAAKRDGSGMHGVA
PCSK9_LAGLA     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFESVPEEDDSHGTHLAGVVSGRDA-------GVA
XPR6_YARLI      -RNVTGWGVVTAVVDDGLDMNADIKANYFGSWDFNFNKSDPKPDDYHGTRCAGEIAAVRNNVCGV--GVA
PCSK9_ATEGE     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFESVPEEDDSHGTHLAGVVSGRDA-------GVA
P3P_LACLS       NYKYKGEGTVVSVIDSGIDPHKDMRLSDDKDVKLTKSDVEKFTDTAHGMHVAGIIGANGTGDDPAKSGVA
P2P_LACPA       NYKYKGEGTVVSVIDTGIDPHKDMRLSDDKDVKLTKYDVEKFTDTAHGMHVAGIIGANGTGDDPTKSGVA
P2P_LACLC       NYKYKGEGTVVSVIDSGIDPHKDMRLSDDKDVKLTKSDVEKFTDTAHGMHVAGIIGANGTGDDPAKSGVA
P1P_LACLC       NYKYKGEGTVVSVIDSGIDPHKDMRLSDDKDVKLTKSDVEKFTDTAHGMHVAGIIGANGTGDDPAKSGVA
TAGB_DICDI      ----------------------------------------------------------------------
PCSK9_SAGLB     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFGSVPKEDDSHGTHLAGVVSGRDA-------GVA
TAGD_DICDI      ----------------------------------------------------------------------
TAGC_DICDI      ----------------------------------------------------------------------
PCSK9_CALJA     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFGSVPEEDDSHGTHLAGVVSGRDA-------GVA
PCSK9_SAIBB     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFGSVPEEDDSHGTHLAGVVSGRDA-------GVA
EPIP_STAEP      ----------------------------------------------------------------------
PCSK9_CALMO     -----GSLVEVYLLDTSIQSHREIEGRVM----VTDFESVPEEDDSHGTHLAGVVSGRDA-------GVA


                         .         .         .         +         .         .         .:280
query           PEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEA
ELYA_BACHD      PSADLYAVKVLDRNGSGSLASVAQGIEWAINNN-------MHIINMXXXXXXXXXXXE------LAVNRA
SUBT_BACAM      PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGPS------GSXXXXXXXXXX
THES_BACSJ      PNTRILAVRALDRNGSGTLS-------XXXXXXXXXXXSGAEVINLSLGCDC------HTTTLENAVNYA
ISP_PAEPO       PEADLLIIKVLNKQGSGQYDWIIQGIYYAI-------EQKVDIISMSLGGP------EDVPELHEAVKKA
SUBB_BACLE      PSAELYAVKVLGADGRGAISSIAQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
YCT5_YEAST      KRVNLVEVKVLGKDGSGEASNVLSGLEFIVEHKVSRPQGKKCVANLSLG--------SFRSPIINAVEGA
PSP3_SCHPO      KNAKLVAVKVMRADGTGTVSDIIKGIEFAFKQSKKDKESIASVVNMSIGGDA-------STALDLAVNAA
PEPC_ASPNG      KKANLYAVKVLRSSGSGTMSDVVSGVEYAVQAHIXXXXXXXSVANMSLGGG-------KSKTLEDAVNAG
SUBD_BACLI      PNVSLYAIKVLNSSGSGTYSAIVSGIEWATQ-------NGLDVINMSLGGPS------GSTALKQAVDKX
SUBF_BACSU      PGAKWIAVKAFSEDG-GTDADILEAGEWVLAPKDPHPEMAPDVVNNSWGGGS------GLDEWYRDMVNA
SUBT_BACSU      PSASLYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPT------GSTALKTVVDKX
SUBT_BACST      PSASLYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPS------GSTALKTVVDKX
SUBT_BACSA      PSASLYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPS------GSTALKTVVDKX
SUBN_BACNA      PSASLYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPT------GSTALKTVVDKX
SUBE_BACSU      PEAQIYAVKALDQNGSGDLQSLLQGIDWSIANR-------MDIVNMSLGTTS------DSKILHDAVNKA
SUBT_BACLI      PSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNG-------MDVINMSLGGPS------GSTAMKQAVDNA
YSP3_YEAST      KNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHKKNKEFKGSTANLSLGS-------SKSLAMEMAVNAA
PLS_PYRFU       PGAQIMAIRVLRSDGRGSMWDIIEGMTYAATHGAD-------VISMSLGGNAPYLDGT--DPESVAVDEL
PROA_VIBAL      KNVNLVGVRVLSCSGSGSTSGVIAGVDW-VAANASGPS----VANMSLGGG-------QSVALDXXXXXX
ALP_LECPS       KKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGG-------YSAALNQAAARL
BPRX_DICNO      YDAKIVPVRVLGRCG-GYNSDINEGMYWAAGGHIDGPDHPAQVINMSLGGPGVCGSTEQ-----TLINRA
SUBT_BACPU      PSSALYAVKVLDSTGSGQYSWIINGIEWAISNN-------MDVINMSLGGPT------GSTALKTVVDKX
ISP1_BACSU      PEASLLIVKVLGENGSGQYEWIINGINYAV-------EQKVDIISMSLGGPS------DVPELKEAVKNA
THET_THEVU      PKASILAVRVLDNSGSGTWTAVANGITYA-------ADQGAKVISLSLGGTV------GNSGLQQAVNYA
PRTM_BACSK      PSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
SUBV_BACSU      PDATLLAYRVLGPGGSGTTENVIAGVERAVQ-------DGADVMNLSLGNSLNNPDWATST----ALDWA
SUBS_BACLE      PSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
ELYA_BACCS      PSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
ELYA_BACAO      PNAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGMHVANLSLGSPSPSATLEQ------AVNSA
HLY_HAL17       -NCSLLSARALGDGGGGSLTDIADAIQW-------SADQGADVINMSLGGGGF------SQTLSNACEYA
SUB1_NANOT      XXXXXXXXXXLDNNGSGPTSGIIAGINWCAQHASQNGGTDKAVINMSLGGGS-------SSALNRAAAQA
SUB1_MICCA      XXXXXXXXXXLDNNGSGPTSGIIAGINWCAQHASQNGGTDKAVINMSLGGGS-------SSALNRAAAQA
PRTB_YEAST      XXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXSTANMSLGGG-------KSPALDLAVNAA
ISP_BACCS       PKADLFIIKALSGDGSGEMGWIAKAIRYAVDWRGPK-GEQMRIITMSLGGPT------DSEELHDAVKYA
ISP6_SCHPO      XXXXXXXXXXLRSSGSGTMADVIAGVEWTVRHHKSS-GKKTSVGNMSLGGG-------NSFVLDMAVDSA
TKSU_PYRKO      PGVQIYSVRVLDARGSGSYSDIAIGIEQAIXXXXXXXXXXXEVISMSLGGPA------DDSYLYDMIIQA
AQL1_THEAQ      KAVNLYAVRVLDCNGSGSTSGVIAGVDW-VTRNHRRP----AVANMSLGGGV-------STALDNAVKNS
BPRV_DICNO      XXXX-IPVRVLGKCG-GYDSDITDGMYWSAGGHIDGPDNPAQVVNMSLGGGGGCSQNSQ-----RMIDKT
CUDP_METAN      KKAKLYGVKVLDNQXXXXXXXXXXXMDYVAQDSKTRGCPNGAIASMSLGGGYSASVNQGAAALV------
WPRA_BACSU      AKAKIIPVKVLDSAGSGDTEQIALGIKYAA-------DKGAKVINLSLGGGYSRV-------LEFALKYA
SPL1_ENCCU      KESSIIAVKVLDKYGSGMTSRLLQGVDFVIKEHEKKKDELYNAAALSSGGSSIEMDGSEETPSIQAIEYA
SUBT_BACS9      PDADLWAYKVLGDDGSGYADDIAAAIRHA--GDQATALNTKVVINMSLGSSG------ESSLITNAVNYS
SUB6_TRIVC      KGVSLVAVKVLDCEGSGSNSGVIKGMEWAMMXXXXXXXXXXXVMNMSLGGPR----SEATNQAAKAISD-
ELYA_BACYA      PNVDLYGVKVXXXXXXXXXXXXXXXXXWA-------ANNGMHIANMSLGSSAGSATMEQ------AVNQA
SUB6_TRISD      KGVSLVAVKVLDCDGSGSNSGVIKGMEWAMRXXXXXXXXXXXVMNMSLGGPR----SEASNQAAKAISD-
SUB6_TRIRU      KGVSLVAVKVLDCDGSGSNSGVIKGMEWAMRXXXXXXXXXXXVMNMSLGGPR----SEASNQAAKAISD-
SEPR_THESR      KGVTLHPVRVLDCNGSGSNSSVIAGLDWVTQ-NHVKP----AVINMSLGGGA-------STALDTAVMXX
SUB5_NANOT      XXXXXXXXXXLNSEGKGPTSGIIAGINWSINNARQNGMLHKSVINMSLGG-------SYSAGLNHATAQA
SUB6_ARTBE      KSVSLIAVKVLDCEGSGSNSGVIKGMEWAMRXXXXXXXXXXXVMNMSLGGPR----SEATNQAAKAISD-
SUB6_TRITO      KGVSLVAVKVLDCEGSGSNSGVIKGMEWAMRXXXXXXXXXXXVMNMSLGGTRSQASNQ-------AAKAI
SUB6_TRIEQ      KGVSLVAVKVLDCEGSGSNSGVIKGMEWAMRXXXXXXXXXXXVMNMSLGGPRSQASNQ-------AAKAI
ORYZ_ASPFL      KKANLLSVKVFVGESSST-SIILDGFNWAANDIVSKKRTGKAAINMSLGGG---YSKAFND----AVENA
SUB6_NANOT      KKTNLIAVKVLDCNGSGSNSGVIKGMEWVMRGGNSTSKASKSVMNMSLGG-------PRSEATNRAAKAI
ORYZ_ASPOR      KKASILSVKVFQGESSSTSV-ILDGFNWAANDIVSKKRTSKAAINMSLGGG---YSKAFND----AVENA
SMP1_MAGPO      KKASIVSVRVFDTGSQSTTAIVLDGFSWAVKDITAKGRQAKSVISMSLGGG-------RSEAFNAAVEAA
SUB5_TRIVC      XXXXXXXXXXLNSEGKGPTSGIIAGINWSIRHARKHGMLQKSVLNMSLGG-------TYSAGLNHATAQA
SUB5_TRIRU      XXXXXXXXXXLNSEGKGPTSGIIAGINWSIRHARKHGMLQKSVLNMSLGG-------TYSAGLNHATAQA
SUB5_ARTBE      XXXXXXXXXXLNSEGKGPTSGIIAGINWSIRHARKHGMLQKSVLNMSLGG-------TYSAGLNHATAQA
SUB5_TRITO      XXXXXXXXXXLNSEGKGPTSGIIAGINWSIRHARKHGMLHKSVLNMSLGG-------TYSAGLNHATAQA
SUB5_TRIEQ      XXXXXXXXXXLNSEGKGPTSGIIAGINWSIRHARKHGMLHKSVLNMSLGG-------TYSAGLNHATAQA
EXPR_XANCP      ASSSXXPVRVLGKCG-GSLSDIADAIVWAIPANAN----PAEVINMSLGGGG-----SCSTTMQNAINGA
ALP_TRIAT       KQASLISVKVFAGESASTSV-ILDGYNWAVNDIVSKSRASKSAINMSLGGPA-------SSTWTTAINAA
ALP_CEPAC       KNTNLIAVKVFRGSSSST-SIILDGFNWAVNDIINRGRQNKAAISMSLGGG-------YSSAFNNAVNTA
SUB4_TRIRU      KNANIVAVKVLXXXXXXXXXXXXXXXNYCVQDAQQRGILGKAAMNLSLGGGFSQANND-------AVTRA
SUB4_TRIVC      KNANIVAVKVLXXXXXXXXXXXXXXXNYCVQDAQQRGILGKAAMNLSLGGGFSQANND-------AVTRA
SUB4_TRITO      KNANIVAVKVLXXXXXXXXXXXXXXXNYCVQDAQQRGILGKAAMNLSLGGGFSQANND-------AVTRA
SUB4_TRIEQ      KNANIVAVKVLXXXXXXXXXXXXXXXNYCVQDAQQRGILGKAAMNLSLGGGFSQANND-------AVTRA
SUB4_ARTBE      KNANIVAVKVLXXXXXXXXXXXXXXXNYCVQDAQQRGILGKAAMNLSLGGGFSQANND-------AVTRA
SUB1_TRIEQ      XXXXXXXXXXXGNDGSGPTSGIVAGINWCVEHARQNGGNDKAVMNMSLGGSS-------SSALNRAAAQA
PRTR_TRIAL      KKTQIFGVKVLNDQGSGQYSTIISGMDFVADYRNRNCPNGV-VASMSIGG--------------------
YZ18_AQUAE      ---------------------------------------------------------------------A
SUB1_TRITO      XXXXXXXXXXXGNDGSGPTSGIVAGINWCVEHARQNGGTDKAVMNMSLGGSS-------SSALNRAAAQA
SUB1_TRIRU      XXXXXXXXXXXGNDGSGPTSGIVAGINWSVEHARQNGGTKKAVMNMSLGGSS-------SSALNRAAAQA
SUB1_TRIVC      XXXXXXXXXXXGNDGSGPTSGIVAGINWSVEHARQNGGTKKAVMNMSLGGSS-------SSALNRAAAQA
SUB1_ARTBE      XXXXXXXXXXXGNDGSGPTSGIVAGINWSVEHARQNGGTKKAVMNMSLGGSS-------SSALNRAAAQA
SUB4_NANOT      KNANIVAVKVLXXXXXXXXXXXXXXXNFCVQDAQSRGILGKAAMNLSLGGGFSQANND-------AVTRA
MBTP1_CRIGR     PDAELHIFRVFTNNQVSYTSWFLDAFNYAIL-------KKIDVLNLSIGGPDFM-DH----PFVDKVWEL
ORYZ_ASPFU      KKTNLLSVKVFQGESSST-SIILDGFNWAVNDIVSKGRTKKAAINMSLGGG---YSYAFNN----AVENA
SUB3_TRIVC      ----------LSAGGSGSTSGVIKGIDWCVTDARSKNALGKAALNLSLGGS---FSQASNDAVTRAQE--
SUB3_TRIRU      ----------LSAGGSGSTSGVIKGIDWCVTDARSKNTLGKAALNLSLGGS---FSQASNDAVTRAQE--
SUB3_ARTBE      ----------LSAGGSGSTSGVIKGIDWCVTDARSKNALGKAALNLSLGGS---FSQASNDAVTRAQE--
SPM1_MAGGR      XXXXXXXXXXLKSNGSGTMSDVIAGVDFAAKSHKAQVSAAKDVANMSLGGG-------KXXXXXXXXXXX
PCSK9_RAT       KGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGXXXXXXXXAGG--------YSRILNTACQRL
MBTP1_RAT       PDAELHIFRVFTNNQVSYTSWFLDAFNYAIL-------KKMDVLNLSIGGPDFM-DH----PFVDKVWEL
MBTP1_MOUSE     PDAELHIFRVFTNNQVSYTSWFLDAFNYAIL-------KKMDVLNLSIGGPDFM-DH----PFVDKVWEL
MBTP1_HUMAN     PDAELHIFRVFTNNQVSYTSWFLDAFNYAIL-------KKIDVLNLSIGGPDFM-DH----PFVDKVWEL
SUB3_TRIEQ      ----------LSAGGSGSTAGVIKGIDWCVTDARSRNALGKAALNLSLGGS---FSQANNDAVTRAQE--
SUB3_TRITO      ----------LSAGGSGSTAGVIKGIDWCVTDVRSRNALGKAALNLSLGGS---FSQANNDAVTRAQE--
PRCA_ANAVT      PGAKLMPIRFVSALGSQDEAD---SFVWAAQNGAD-------VISCSWGPDGTWWDHKQKVPLPDSTRLA
PCSK9_MOUSE     KGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGXXXXXXXXAGG--------YSRILNAACRHL
PCSK6_RAT       YNAKIGGIRMLD----GDVTDVVEAKSLGIRPNY------IDIYSASWGPDD---DGKTVDGPGRLAKQA
PRTK_TRIAL      KKTQLFGVKVLDDNGSGQYSTIIAGMDF------------------------------------------
PCSK6_HUMAN     YNAKIGGIRMLD----GDVTDVVEAKSLGIRPNY------IDIYSASWGPDD---DGKTVDGPGRLAKQA
TPP2_HUMAN      PGAQILSIKIGDTRGTGLIRAMIEVI-----------NHKCDLVNYSYG-EATHWPNSGR--ICEVINEA
SUB3_NANOT      XXXXXXXXXXLSAGGSGSTAGVIKGIDWCV---TDXXXXXXXXXXXXXXXXXXXFSQANND----AVTRA
SUB3_MICCA      XXXXXXXXXXLSAGGSGSTAGVIKGIDWCV---TDXXXXXXXXXXXXXXXXXXXFSQANND----AVTRA
TPP2_RAT        PGAQILSIKIGDTRGTGLIRAMIEVI-----------NHKCDLVNYSYG-EATHWPNSGR--ICEVINEA
TPP2_MOUSE      PGAQILSIKIGDTRGTGLIRAMIEVI-----------NHKCDLVNYSYG-EATHWPNSGR--ICEVINEA
SUB2_TRIEQ      XXXXXXXXXXFDT-GSSTYNYILETYDWIVRNITDSNRKNKAVINLSISG-------AKYQPFDDAVEKA
FURI1_XENLA     YNANIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPAKLAEEA
PRCA_ANASP      PGAKLMPIRFVSALGSQDEAD---SFVWAAQNGAD-------VISCSWGPDGTWWDHKQKVPLPDSTRLA
TPP2_SCHPO      PGCQLVSLMI----GDGRLDSLETSHAFSRACSEIIKNE-VDIINISFGEDAGIPNKGRVIELLRD-ELA
SUB2_TRITO      XXXXXXXXXXFDT-GSSTYNYILETYDWIVRNITDSNRKNKAVINFSISG-------AKYQPFDDAVEKA
SUB2_NANOT      XXXXXXXXXXFDT-GSSTYNYILETYDWIVKNITDSNRKNKAVINLSISG-------AKYQPFDDAVENA
KEX2_YEAST      YNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSWGADDGRHLQGPSDALVKGVTEG
FUR2_DROME      YNASIGGVRMLD----GKVNDVVEA-----QALSLNPSH-IDIYSASWGPEDDGSTVDGPGPLARVTSGR
TPP2_DROME      PNAKIVSMTILGSMETGTA--LVRAMTKVMELCRDG--RRIDVINMSYGEHANWSNSGRIGELMNEVVNK
TPP2_BOVIN      PGAQILSIKIGDTRGTGLIRAMIEVI-----------NHKCDLVNYSYG-EATHWPNSGR--ICEVINEA
NEC1_BOVIN      YNSKVGGIRMLD----GIVTDAIEAS--LIGFNPGH----VDIYSASWGPND---DGKTVEGPGRLAQKA
SUB2_TRIVC      XXXFDTG-----SVQQSTYNYILETYDWIVRNITDSNRKNKAVINLSISG-------AKYQPFDDAVEKA
C5AP_STRPY      ----------------------------------------------------------------------
C5AP_STRP8      ----------------------------------------------------------------------
C5AP_STRP6      ----------------------------------------------------------------------
C5AP_STRP3      ----------------------------------------------------------------------
C5AP_STRP1      ----------------------------------------------------------------------
SUB2_ARTBE      XXXFDTG-----SVEQSTYNYILETYDWIVRNITDSNRKNKAVINLSISG-------AKYQPFDDAVEKA
SUBL_ARATH      PRARVAVYKVCWLGGCFS--------SXXXXXXXXXXXXNVNVLSMSLGGGMSDY---YRDGVAIGAFAA
SUB2_TRIRU      XXXFDTG-----SMNQSTYNYILETYDWIIRNITDSNRKNKAVINLSISG-------AKYQPFDDAAERA
PCSK4_RAT       FNARIGGVRMLD----GAITDIVEAQSLSLQ------PQHIHIYSASWGPED---DGRTVDGPGLLTQEA
PCSK4_MOUSE     FNARIGGVRMLD----GAITDIVEAQSLSLQ------PQHIHIYSASWGPED---DGRTVDGPGLLTQEA
NEC2_RAT        YNSKVAGIRMLDQP---FMTDIIEA------SSISHMPQLIDIYSASWGDNGKTVDGPREQAMADGVNKG
SUB2_DEIRA      PDSKFYTAAIFQ---PGFIGDVARSVIWTV-------NQGAQVINNSWGGTGY-------SPLLKAFDYA
PCSK9_PANPA     KGASMRSLRVLNCQGKGTVSGTLIGLEF-IRKSQXXXXXXXXXXXXXXXXXYSRV-------LNAACQRL
PCSK5_BRACL     YKASIGGVRMLD----GDVTDSVEAASLGL-----NP-QHIMIYSASWGPDD---DGKTVDGPANLAQKT
NEC2_MOUSE      YNSKVAGIRMLDQP---FMTDIIEA------SSISHMPQLIDIYSASWGDNGKTVDGPREQAMADGVNKG
PCSK9_PONPY     KGASMRSLRVLNCQGKGTVSGTLIGLEF-IRKSQXXXXXXXXXXXXXXXXXYSRV-------LNAACQRL
KEX1_KLULA      YNSKVSGIRILS--GQITAEDEAASLIYGLDVN--------DIYSCSWGPSDDGKTMQAPDTLVKVTEGR
PCSK9_PANTR     KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
PCSK9_MACNE     KGAGLRSLRVLNCQGKGTVSGTLIGLEF-IRKSXXXXXXXXXXXXXXXXXXYSRVFNAACQRLAR-----
PCSK9_MACMU     KGAGLRSLRVLNCQGKGTVSGTLIGLEF-IRKSXXXXXXXXXXXXXXXXXXYSRVFNAACQRLAR-----
PCSK9_HUMAN     KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
PCSK9_GORGO     KGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR----VLNAACQRL
PCSK9_COLGU     KGAGLRSLRVLNCQGKGTVSGTLIGLEF-IRKSXXXXXXXXXXXXXXXXXXYSRVFNAACQRLAR-----
PCSK5_RAT       FNAKIGGVRMLD----GDVTDMVEAKS--VSYNPQH----VHIYSASWGPDDDGKTVDGPAPLTRQAFER
PCSK5_MOUSE     FNAKIGGVRMLD----GDVTDMVEAKS--VSYNPQH----VHIYSASWGPDDDGKTVDGPAPLTRQAFER
CUCM1_CUCME     SQANLYGLGLGTARGGVPLARI---AAYKVCWNDXXXXXGVDIISLSVGGANPR--HYFVDAIAIGSFHA
NEC2_PONAB      YNSKVAGIRMLDQP---FMTDIIEA------SSISHMPQLIDIYSASWGDNGKTVDGPREQAMADGVNKG
NEC2_PIG        YSSKVAGIRMLDQP---FMTDIIEA------SSISHMPQLIDIYSASWGDNGKTVDGPREQAMADGVNKG
NEC2_HUMAN      YNSKVAGIRMLDQP---FMTDIIEA------SSISHMPQLIDIYSASWGDNGKTVDGPREQAMADGVNKG
XSP1_ARATH      PSARLAMYKVCWARSGCADMDILAGFEAAIH-------DGVEIISISIGGPIADYS---SDSISVGSFHA
NEC2_BOVIN      YGSKVAGIRMLDQP---FMTDIIEA------SSISHMPQLIDIYSASWGDNGKTVDGPREQAMADGVNKG
PRTT_TRIAL      XXXSLFAVKVLDANGQGSNSGVIAGMDFVTKDASSQNCPKGVVVNMSLGGPS-------SSAVNRAAAEI
PCSK5_HUMAN     FNAKIGGVRMLD----GDVTDMVEAKS--VSFNPQH----VHIYSASWGPDDDGKTVDGPAPLTRQAFER
PCSK4_HUMAN     FNARIGGVRMLD----GTITDVIEAQSLSLQ------PQHIHIYSASWGPED---DGRTVDGPGILTREA
SUB2_MICCA      XXXFDTG-----SVEQSTYNYILETYDWIVKNITDSNRKNKAVINLSISG-------AKYQPFDDAVENA
NEC1_RAT        YNSKVGGIRMLD----GIVTDAIEASS--IGFNPGH----VDIYSASWGPND---DGKTVEGPGRLAQKA
NEC1_HUMAN      YNSKVGGIRMLD----GIVTDAIEASS--IGFNPGH----VDIYSASWGPND---DGKTVEGPGRLAQKA
NEC1_MUSCO      YNSKVGGIRMLD----GIVTDAIEASS--IGFNPGH----VDIYSASWGPND---DGKTVEGPGRLAQKA
NEC1_MOUSE      YNSKVGGIRMLD----GIVTDAIEASS--IGFNPGH----VDIYSASWGPND---DGKTVEGPGRLAQKA
SUB7_TRIVO      XXXXXXXXXXLDCSGSGSNSGVIMGMEWATKDAQQKGADKA-VANMSLGG--------------------
SUB7_TRISD      XXXXXXXXXXLDCNGSGSNSGVIMGMEWATKDAQQKGADKA-VANMSLGG--------------------
SUB7_TRIRU      XXXXXXXXXXLDCNGSGSNSGVIMGMEWATKDAQQKGADKA-VANMSLGG--------------------
SUB7_NANOT      KKSNIVAVKVLDCNGSGSNSGVIMGMEWATN-XXXXXXXXXXXXNMSLGGXXXXXXXXXXXXXXXXXXXX
KEX2_CANAL      WKSQVSGIRILS--GPITSSDEAEAMVYGLDTN--------DIYSCSWGGKVLSEDVIVKKAMIKGIQEG
BLI4_CAEEL      FKAKIGGVRMLD----GAVSDSVEAAS--LSLNQDH----IDIYSASWGPEDDGKTFDGPGPLAREAXXX
SUB7_TRITO      KKSNIVAVKVLDCNGSGSNSGVIMGMQWA---TEDAQSKGADVVNMSLGGAFSQTSND--------AAKA
SUB7_TRIEQ      KKSNIVAVKVLDCNGSGSNSGVIMGMQWA---TEDAQSKGADVVNMSLGGAFSQTSND--------AAKA
KRP1_SCHPO      PRAKVAGLRIL----SAPITDAVE----------------------------------------------
FURIN_RAT       -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
PRTS_SERMA      FDADIIGTK-LNDYGN------------------------------------------------------
FURIN_MOUSE     -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
FURIN_HUMAN     -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGPED---DGKTVDGPARLAEEA
FUR1C_DROME     YGASVGGVRMLD----GDVTDAVEARSLSL-----NP-QHIDIYSASWGPD-------------------
FUR11_DROME     YGASVGGVRMLD----GDVTDAVEARSLSL-----NP-QHIDIYSASWGPD-------------------
FURIN_BOVIN     -NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IHIYSASWGDDGKTVDHLAEEAFFRGVSQG
SUB7_TRIVC      XXXXXXXXXXLDCNGSGSNSGVIMGMEWATKDAQQKGADKA-VANMSLGG--------------------
SUB7_ARTBE      XXXXXXXXXXLDCNGSGSNSGVIMGMEWATKDAQQKGADKA-VANMSLGG--------------------
PRTT_SERMA      YDADIIGTK-LNDYGN------------------------------------------------------
PCSK9_LAGLA     KGASLRSLRVLNCQGKGTVSSTLIGLE----FIRKNXXXXXXXXXXXXXXXXXXYSR-----VLNAACQX
XPR6_YARLI      YDSKVAGIRILSKE----IAEDIEAL--AINYEMDKN----DIYSCSWGGQTMRPGKVVKDAMVNAITNG
PCSK9_ATEGE     KGASLRSLRVLNCQGKGTVSSTLIGLE----FIRKNXXXXXXXXXXXXXXXXXXYSR-----VLNAACQR
P3P_LACLS       PEAQLLAMKVFTNSGSATLVSAIE----------DSAKIGADVLNMSLGSDS--GNQTLEDPELAAVQNA
P2P_LACPA       PEAQLLAMKVFTNSGSATLVSAIE----------DSAKIGADVLNMSLGSDS--GNQTLEDPEIAAVQNA
P2P_LACLC       PEAQLLAMKVFTNSGSATLVSAIE----------DSAKIGADVLNMSLGSDS--GNQTLEDPELAAVQNA
P1P_LACLC       PEAQLLAMKVFTNSGSSTLVSAIE----------DSAKIGADVLNMSLGSDS--GNQTLEDPELAAVQNA
TAGB_DICDI      ----------------------------------------------------------------------
PCSK9_SAGLB     KGASLHSLRVLNCQGKGTVSSTLIGLEFICK----SXXXXXXXXXXXXXXXXXXYSR----VLNAACQXX
TAGD_DICDI      ----------------------------------------------------------------------
TAGC_DICDI      ----------------------------------------------------------------------
PCSK9_CALJA     KGASLRSLRVLNCQGKGTVSSTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR-----VLNAACQX
PCSK9_SAIBB     KGASLRSLRVLNCQGKGTVSSTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR-----VLNAACQX
EPIP_STAEP      ----------------------------------------------------LRDDEKVDDALQKAINYA
PCSK9_CALMO     KGASLRSLHVLNCQGKGTVSSALIGLEF------------------------------------------


                         .         *         .         .         .         .         +:350
query           WSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAP
ELYA_BACHD      NNAGILLVGAAGNTG--RQGVNYPARYSGVMAVAAVDQNGQR-------ASFSTYGPEI------EISAP
SUBT_BACAM      XXXXXXXXXXXGNEGTSSSTVGYPGKYPSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAP
THES_BACSJ      WNKGSVVVAAAGNNG--SSTTFEPASYENVIAVG-------AVDQYDRLASFSNYGTWV------DVVAP
ISP_PAEPO       VASQILVMCAAGNEGDDDRTLGYPGCYNEVISVG-------AINFDRHASEFSNSNNEV------DLVAP
SUBB_BACLE      TSRXXXXXXXXXXXXXXXXXY--PARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
YCT5_YEAST      IEEGIVFVAAAGNFNLDAYW-ASPASAENVITVG------AFDDHIDTIAKFSNWGPCV------NIFAP
PSP3_SCHPO      IAGGLFFAVAAGNDAEDA-CGTSPARVSNAMTVG-------ASTWNDQIASFSNIGSCV------DIFAP
PEPC_ASPNG      VEAGLHFAVAAGNDNADACNY-SPAAAEKAITVGASTLADER-------AYFSNYG------ECTDIFAP
SUBD_BACLI      XXXXXXXXXXXXXXXXXQNTIGYPAKYDSVIAVGAVDSNKNR-------ASFSSVGAEL------EVMAP
SUBF_BACSU      WAADIFPEFSAGNTGPGS--IANPANYPESFATGATDINKK-------LADFSLQGPSPYDEIKPEISAP
SUBT_BACSU      XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSSNQR-------ASFSSAGSEL------DVMAP
SUBT_BACST      XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSSNQR-------ASFSSAGSEL------DVMAP
SUBT_BACSA      XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSSNQR-------ASFSSAGSEL------DVMAP
SUBN_BACNA      XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSSNQR-------ASFSSVGSEL------DVMAP
SUBE_BACSU      YEQGVLLVAASGNDG-NGKPVNYPXXXXXXXXXXXTNEKNQ-------LASFSTTGDEV------EFSAP
SUBT_BACLI      YARXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDSNSNR-------ASFSSVGAEL------EVMAP
YSP3_YEAST      VDSGVHFAIAAGNEDEDA-CLSSPAGAEKSITVGASTFSDDR-------AFFSNWGTCV------DVFAP
PLS_PYRFU       TEKGVVFVIAAGNEGPGINIVGSPGVATKAITVGAAAVPINVGVYVSQIAFFSSRGPRIDGEIKPNVVAP
PROA_VIBAL      XXXXXXFMLAAGNSNADACNYSPARVAXXXXXXXXXXXDAR--------SSFSNWGSCV------DVFAP
ALP_LECPS       QSSGVFVAVAAGNDNRDAAN-TSPASEPTVCTVGATDSNDVR-------STFSNYGRVV------DIFAP
BPRX_DICNO      TQLGATIIVAAGNDNIDAYGV-TPASCDNILTVGATTSNGTR-------AYFSNHGSVV------DISAP
SUBT_BACPU      XXXXXXXXXXXXXXXXXXXXXXXPAKYPSTIAVGAVNSANQR-------ASFSSAGSEL------DVMAP
ISP1_BACSU      VKNGVLVVCAAGNEGDGTEELSYPAAYNEVIAVG-------SVSVARELSEFSNANKEI------DLVAP
THET_THEVU      WNKG---------SXXXXXXXXXXXXXXXXXXXXSNAIAVASTDQNDNKSSFSTYGSVV------DVAAP
PRTM_BACSK      TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
SUBV_BACSU      MSEGVVAVTSNGNSGPNGWTVGSPGTSREAISVG--------------VADFSSRGPVMTWMIKPDISAP
SUBS_BACLE      TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
ELYA_BACCS      TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
ELYA_BACAO      TSRXXXXXXXXXXXXXXX--ISYPARYANAMAVGATDQNNNR-------ASFSQYGAGL------DIVAP
HLY_HAL17       YNQGSLLVAAAGNGYGNS--VSYPAAYDTVMAVSSLDEGET-------LSAFSNLGPEI------ELAAP
SUB1_NANOT      VQKGMFLAVAAGNDNQDART-SSPASEDTVCTVGASAENDER-------SSFSNWGPAV------DLFAP
SUB1_MICCA      VQKGMFLAVAAGNDNQDART-SSPASEDTVCTVGASAENDER-------SSFSNWGPAV------DLFAP
PRTB_YEAST      VEVGIHFAVAAGNENQDACN-TSPASADKAITVGASTLSDDR-------AYFSNWGKCV------DVFAP
ISP_BACCS       XXXXXXXXCAAGNEGDDTNEFAYPAAYNEVIAVGAVDFDLR-------LSDFPNTN------EEIDIVAP
ISP6_SCHPO      VTNGVIYAVAAGNEYDDA-CYSSPAASKKAITVG-------ASTINDQMAYFSNYGSCV------DIFAP
TKSU_PYRKO      YNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG-------AIDSNDNIASFSNR--------QPEVSAP
AQL1_THEAQ      IXXXXXXXXXXXXXXXXXCNYSPARVAE-ALTVGATTSSDAR-------ASFSNYGSCV------DLFAP
BPRV_DICNO      TNLGALIVIAAGNENQDASR-TWPSSCNNVLSVGATTPKGKR-------APFSNYGARVH------LAAP
CUDP_METAN      -NSGVFLAVAAGNDNRDAQN-TSPASEPSACTVGASAENDSR-------SSFSNYGRVV------DIFAP
WPRA_BACSU      ADKNVLIAAASGNDGENA--LSYPASSKYVMSVGATNRMDM-------TADFSN-----YGKGL-DISAP
SPL1_ENCCU      SRLGIHFSTAAGNEHEDACDF-SPGSSRAAITTG-------ASTYRDTVAFFSNFGKCV------NVFAP
SUBT_BACS9      YNKGVLIIAAAGNSGPYQGSIGYPGXXXXXXXXXXXXXXXXXGTYR--VADFSSRGYSWYAIQKGDISAP
SUB6_TRIVC      --AGIFLAVAAGNENMDAQH-SSPASEPSVCTVAASTKDDGK-------ANFSNFGSVV------DVYAP
ELYA_BACYA      --TXXXXXXXXXXXXXXXXXXXFPARYANAMAVGATDQNNNR-------ATFSQYGAGL------DIVAP
SUB6_TRISD      --AGIFMAVAAGNENMDAQH-SSPASEPSVCTVAASTKDDGK-------ADFSNYGAVV------DVYAP
SUB6_TRIRU      --AGIFMAVAAGNENMDAQH-SSPASEPSVCTVAASTKDDGK-------ADFSNYGAVV------DVYAP
SEPR_THESR      XXXXXXXXXXXXXXXRDA-CFYSPARVTAAITVGATTSTDYR-------ASFSNYGRCL------DLFAP
SUB5_NANOT      IKAGIFVSVSAG-XXXXXXXXXXPASEKSVCTIAASTEDDGK-------ASFSNWGPAV------DLYAP
SUB6_ARTBE      --AGIFLAVAAGNENMDAQH-SSPASEPSVCTVAASTKDDGK-------ASFSNYGSAV------DVYAP
SUB6_TRITO      SDAGIFMAVAAGNENMDAQH-SSPASEPSVCTVAASTEDDGK-------ADFSNYGQLV------DVYAP
SUB6_TRIEQ      SDAGIFMAVAAGNENMDAQH-SSPASEPSVCTVAASTEDDGK-------ADFSNYGQLV------DVYAP
ORYZ_ASPFL      FNEGVLSIVAAGNENTDASR-TSPASAPDAFTVAAINVNNTR-------AYFSNYGSVV------DIFAP
SUB6_NANOT      SDAGIFLAVAAGNDNADSQH-DSPASEPSVCTVAASAEDDTK-------ASFSNWGQAV------DVFAP
ORYZ_ASPOR      FEQGVLSVVAAGNENSDAGQ-TSPASAPDAITVAAIQKSNNR-------ASFSNFGKVV------DVFAP
SMP1_MAGPO      YQANILTVAAAGNSAWDASQY-SPASAPNAITVG-------AIDVDNVMAWFSNYGPVV------DVFAP
SUB5_TRIVC      IKAGMFVSVSAGNDNINSNG-NSPASERSVCTIAASTENDGK-------ASFSNWGPAV------DLYAP
SUB5_TRIRU      IKAGMFVSVSAGNDNINSNG-NSPASERSVCTIAASTENDGK-------ASFSNWGPAV------DLYAP
SUB5_ARTBE      IKAGMFVSVSAGNDNINSNG-NSPASERSVCTIAASTENDGK-------ASFSNWGPAV------DLYAP
SUB5_TRITO      IKAGMFVSVSAGNDNINSNG-NSPASERSVCTIAASTENDGK-------ASFSNWGPAV------DLYAP
SUB5_TRIEQ      IKAGMFVSVSAGNDNINSNG-NSPASERSVCTIAASTENDGK-------ASFSNWGPAV------DLYAP
EXPR_XANCP      VSRGTTVVVAAGN---DASNVSGPANCANVIXXXXXXXXXXXXX-------YSNFGTGI------DVSAP
ALP_TRIAT       FNQGVLTIVAAGNGNPQPVSGTSPANVPNAITVAALDINWR-------TASFTNYGAGV------DVFAP
ALP_CEPAC       YSRGVLSVVAAGND-XXXXXXXXXXXXXXXITVGSIASNWAR-------SSFSNYGSVL------DIFAP
SUB4_TRIRU      QNAGIFVAVAAGNDNKDARNY-SPASAPAVCTVASSTINDSK-------SSFSNWGPVV------DIYAP
SUB4_TRIVC      QNAGIFVAVAAGNDNRDARNY-SPASAPAVCTVASSTINDSK-------SSFSNWGPVV------DIYAP
SUB4_TRITO      QNAGIFVAVAAGNDNRDARNY-SPASAPAVCTVASSTINDSK-------SSFSNWGPVV------DIYAP
SUB4_TRIEQ      QNAGIFVAVAAGNDNRDARNY-SPASAPAVCTVASSTINDSK-------SSFSNWGPVV------DIYAP
SUB4_ARTBE      QNAGIFVAVAAGNDNRDARNY-SPASAPAVCTVASSTINDSK-------SSFSNWGPVV------DIYAP
SUB1_TRIEQ      VEQGMFLSVAAGNENQDARS-SSPASEPSVCTVG-------XXXXXXXXXXXXNWGPAL------DLFAP
PRTR_TRIAL      ----------------------------------------------------------------------
YZ18_AQUAE      MNSGLIMWVISGSTGGITFTVTNPGTSKRVITVGAFASRPLDTQSFYNIAYFSSRGPTRNGRIKPNIVAG
SUB1_TRITO      VEQGMFLSVAAGNENQDARS-SSPASEPSVCTVG-------XXXXXXXXXXXXNWGPAL------DLFAP
SUB1_TRIRU      VEQGMFLSVAAGNDNQDAQS-SSPASEPSVCTVG-------XXXXXXXXXXXXNWGPAI------DIFAP
SUB1_TRIVC      VEQGMFLSVAAGNDNQDAQS-SSPASEPSVCTVG-------XXXXXXXXXXXXNWGPAI------DLFAP
SUB1_ARTBE      VEQGMFLSVAAGNDNQDAQS-SSPASEPSVCTVG-------XXXXXXXXXXXXNWGPAI------DLFAP
SUB4_NANOT      QNAGIFVAVAAGNDNKDARNY-SPASAPAVCTVASSTVNDSK-------SSFSNYGSIV------DIYAP
MBTP1_CRIGR     TANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVG-------GIDFEDNIARFSSRGMTTYGRVKPDIVT-
ORYZ_ASPFU      FDEGVLSVVAAGNEXXXXXXXXXXXXXXXLTVAAINKSNAR--------ASFSNYGSVV------DIFAP
SUB3_TRIVC      --AGIFVAVAAGNDNRDAKN-SSPASAPAVCTAASSTIDDQK-------SSFSNWGTIV------DIYAP
SUB3_TRIRU      --AGIFVAVAAGNDNRDAKN-SSPASAPAVCTAASSTIDDQK-------SSFSNWGTIV------DIYAP
SUB3_ARTBE      --AGIFVAVAAGNDNRDAKN-SSPASAPAVCTAASSTIDDQK-------SSFSNWGTIV------DIYAP
SPM1_MAGGR      XXXGIHFAVAAGNDNADACNYSPXXXXXXXXXXXXXLDDSR--------AYFSNWGKCT------DIFAP
PCSK9_RAT       ARTGVVLVAAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
MBTP1_RAT       TANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVG-------GIDFEDNIARFSSRGMTTYGRVKPDIVT-
MBTP1_MOUSE     TANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVG-------GIDFEDNIARFSSRGMTTYGRVKPDIVT-
MBTP1_HUMAN     TANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVG-------GIDFEDNIARFSSRGMTTYGRMKPDIVT-
SUB3_TRIEQ      --AGIFVAVAAGNDNRDARNY-SPASAPAVCTAASSTIDDQK-------SSFSNWGSIV------DIYAP
SUB3_TRITO      --AGIFVAVAAGNDNRDARNY-SPASAPAVCTAASSTIDDQK-------SSFSNWGSIV------DIYAP
PRCA_ANAVT      MDKGCVILFAAGNG---NESVDNDGYAEKVIAVAACNDFGTRSAYSDFGTAVWCAFPSNNGNQTPGITAD
PCSK9_MOUSE     ARTGVVLVAAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK6_RAT       FEYGIIFVWASGNGGREGDHCSCDGYTNSIYTIS--------------VSSTTENGKPWYLEECASTLAT
PRTK_TRIAL      ----------------------------------------------------------------------
PCSK6_HUMAN     FEYGIIFVWASGNGGREGDYCSCDGYTNSIYTIS--------------VSSATENGKPWYLEECASTLAT
TPP2_HUMAN      WKHNIIYVSSAGNNGPCLSTVGCPGTTSSVIGVGMVAEYSLREKLPANQYTWSSRGPSADGALGVSISAP
SUB3_NANOT      QNAGIFVAVAAGNDNKDAKN-SSPASAPAVCTAASSTIDDQK-------SSFSNWGTIV------DIYAP
SUB3_MICCA      QNAGIFVAVAAGNDNKDAKN-SSPASAPAVCTAASSTIDDQK-------SSFSNWGTIV------DIYAP
TPP2_RAT        WKHNTIYVSSAGNNGPCLSTVGCPGTTSSVIGVGMVAEYSLREKLPANQYTWSSRGPSADGALGVSISAP
TPP2_MOUSE      WKHNTIYVSSAGNNGPCLSTVGCPGTTSSVIGVGMVAEYSLREKLPANQYTWSSRGPSADGALGVSISAP
SUB2_TRIEQ      FKAGIATVVAAGNDGKDAKN-NTPASSPNAITVGAVRWENTR-------PSFSNYGKIV------DIWAP
FURI1_XENLA     FYRGVIYVWASGNGGREHDSCNCDGYTNSIYTL-------------------------------------
PRCA_ANASP      MDKGCVILFAAGNG---NESVDNDGYAEKVIAVAACNDFGTRSAYSDFGQAVWCAFPSNNGNQTPGITAD
TPP2_SCHPO      GKRNVVIVSSAGNNGPAYTTVGAPGTTFDVISVGAYVTSGMMQAQYNLLSTWCSRGPTLDGDTGVSIYAP
SUB2_TRITO      FKAGIATVVAAGNDGKDAKN-NTPASSPNAITVGAVRWENTR-------PSFSNYGKIV------DIWAP
SUB2_NANOT      FKAGITTVVAAGNDGKDAKN-NTPASSPNAITVGAVRWENTR-------PSFSNYGKIV------DIWAP
KEX2_YEAST      RSKGAIYVFASGNGGTRGDNCNYDGYTNSIITIGAIDHKDLHPP---------------YSEGCSAVMA-
FUR2_DROME      QGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLS-ISSATQAGFKPWYLEECSSTLATTYSSGTPDKSVA
TPP2_DROME      Y--GVVWVASAGNHGPALCTVGTPGVGAYVSPQMMEAEYAMREKLPGNVYTWTSRDPCIDGGQGVTVCAP
TPP2_BOVIN      WKHNIIYVSSAGNNGPCLSTVGCPGTTSSVIGVGMVAEYSLREKLPANQYTWSSRGPSADGALGVSVSAP
NEC1_BOVIN      FEYGVIFVWASGNGGRQGDNCDCDGYTDSIYTIS--------------INSASQQGLSPWYAEKCSS---
SUB2_TRIVC      FKAGITTVVAAGNDGKDAKN-NTPASSPNAITVGAVRWENTR-------PSFSNYGKLV------DIWAP
C5AP_STRPY      ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
C5AP_STRP8      ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
C5AP_STRP6      ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
C5AP_STRP3      ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
C5AP_STRP1      ------------------------------------------------LSRFSSWGLTADGNIKPDIAAP
SUB2_ARTBE      FKAGITTVVAAGNDGKDAKN-NTPASSPNAITVGAVRWENTR-------PSFSNYGKLV------DIWAP
SUBL_ARATH      MERGILVSCSAGNAGPSSSSLSN--VAPWITTVG--------------VAAFSSRGPNSITPNKPDLIAP
SUB2_TRIRU      FKAGITTVVAAGNDGKDAKN-NTPASSPNAITVGAVRWENTR-------PSFSNYGKIV------DIWAP
PCSK4_RAT       FRRGVLFIWASGNGGLHYDNCNCDGYTNSIHTLS-----VGSTTRQGRVPWYSEACAXXXXXXXXXGVVT
PCSK4_MOUSE     FRRGVLFIWASGNGGLHYDNCNCDGYTNSIHTLS-----VGSTTRQGRVPWYSEACAXXXXXXXXXGVVT
NEC2_RAT        RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN-------------SAINDGRTALYDESCSSTLAS
SUB2_DEIRA      LERDITVVVSAGNSYREENPAQLPGVIASA-----------ALDINNDKAGFSTYGRHV------SVAAP
PCSK9_PANPA     ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK5_BRACL     FQAGAIFVWASGNGGRTHDSCGCDGYTNSIYTIS--------------VSSASEQG------KVPWYLEP
NEC2_MOUSE      RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN-------------SAINDGRTALYDESCSSTLAS
PCSK9_PONPY     ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
KEX1_KLULA      DAKGALYVFASGNGGMFGDSCNFDGYTNSIFSI--------------TVGAIDWKGLHPPYSES----CS
PCSK9_PANTR     ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK9_MACNE     --AGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK9_MACMU     --AGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK9_HUMAN     ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK9_GORGO     ARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK9_COLGU     --AGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK5_RAT       RGLGSVFVWASGNGGRSKDHCSCDG------------XXXXXXXXXXXXXAESGKKPW-YLEECSSTLA-
PCSK5_MOUSE     RGLGSVFVWASGNGGRSKDHCSCDG------------XXXXXXXXXXXXXAESGKKPW-YLEECSSTLA-
CUCM1_CUCME     VERGILTSNSAGNGGPNFFTTAS-------------------------VVSFSSRGPNRATKDKPDISGP
NEC2_PONAB      RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN-------------SAINDGRTALYDESCSSTLAS
NEC2_PIG        RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN-------------SAINDGRTALYDESCSSTLAS
NEC2_HUMAN      RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN-------------SAINDGRTALYDESCSSTLAS
XSP1_ARATH      MRKGILTVASAGNDGPSSGTVTN-------------------------VASFSSRGPNPGSIRKPDIAAP
NEC2_BOVIN      RGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN-------------SAINDGRTALYDESCSSTLAS
PRTT_TRIAL      TSAGLFLAVAAGNXXXXXXXXXXXXXXXXC-TVGATDKTDT-------LAEYSNFGSVV------DLLAP
PCSK5_HUMAN     RGLGSVFVWASGNGGRSKDHCSCDG------------XXXXXXXXXXXXXAESGKKPW-YLEECSSTLA-
PCSK4_HUMAN     FRRGVLFIWASGNGGLHYDNCNCDGYTNSIHTLSVGSTTQQGRVPWYSEACASTL-TTTYSSG----VAT
SUB2_MICCA      FKAGITAVVAAGNDGKDAKN-NTPASSPNAITVG------------------------------------
NEC1_RAT        FEYGVIFVWASGNGGRQGDNCDCDGYTD--------------XXXXXXXXXXXQQGLSPWYAEK-----C
NEC1_HUMAN      FEYGVIFVWASGNGGRQGDNCDCDGYTD--------------XXXXXXXXXXXQQGLSPWYAEK-----C
NEC1_MUSCO      FEYGVIFVWASGNGGRQGDNCDCDGYTD--------------XXXXXXXXXXXQQGLSPWYAEK-----C
NEC1_MOUSE      FEYGVIFVWASGNGGRQGDNCDCDGYTD--------------XXXXXXXXXXXQQGLSPWYAEK-----C
SUB7_TRIVO      ----------------------------------------------------------------------
SUB7_TRISD      ----------------------------------------------------------------------
SUB7_TRIRU      ----------------------------------------------------------------------
SUB7_NANOT      XXXXXXXXXXXXXSSPASE--------PSICTVAASTEQDGK-------ADFSNFGQVV------DVYAP
KEX2_CANAL      RDKGAIYVFASGNGGRFGDSCNFDGYTNSIITVG--------------AIDYKGLHPQ-YSEACSAVMV-
BLI4_CAEEL      XXXXXXFVWASGNGGSSQDSCSADGYTTSVYTL-------------------------------------
SUB7_TRITO      IAEGGVFLXXXXXXXXXXXXXXXXXXXXXICTVAASTEQDGK-------ADFSNFGQVV------DVYAP
SUB7_TRIEQ      IAEGGVFLXXXXXXXXXXXXXXXXXXXXXICTVAASTEQDGK-------ADFSNFGQVV------DVYAP
KRP1_SCHPO      ----------------------------------------------------------------------
FURIN_RAT       FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
PRTS_SERMA      ----------------------------------------------------------------------
FURIN_MOUSE     FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
FURIN_HUMAN     FFRGVIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
FUR1C_DROME     ----------------------------------------------------------------------
FUR11_DROME     ----------------------------------------------------------------------
FURIN_BOVIN     GGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE----
SUB7_TRIVC      ----------------------------------------------------------------------
SUB7_ARTBE      ----------------------------------------------------------------------
PRTT_SERMA      ----------------------------------------------------------------------
PCSK9_LAGLA     XXXXXXXXXXXXXNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
XPR6_YARLI      QGKGNVFVFASGNGGSRGDNCNFDGYTNSIITVG------------------------------------
PCSK9_ATEGE     XXXXXXXXXXXXXNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
P3P_LACLS       NESGTAAVIXXXXXXQDNEMVGSPGTSRGATTV---------------MSDFTSYGPVSNLSFKPDITAP
P2P_LACPA       NESGTAAVIXXXXXXQDNEMVGTPGTSRGATTV---------------MSDFTSYGPVSNLSFKPDITAP
P2P_LACLC       NESGTAAVIXXXXXXQDNEMVGTPGTSRGATTV---------------MSDFTSYGPVSNLSFKPDITAP
P1P_LACLC       NESGTAAVIXXXXXXQDNEMVGTPGTSRGATTV---------------MSDFTSYGPVSNLSFKPDITAP
TAGB_DICDI      ------------------------------------------------MGSFSSKGPTHDGRLKPDIVAP
PCSK9_SAGLB     XXXXXXXXXXXGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
TAGD_DICDI      ------------------------------------------------ICSFSSKGPTHDGRLKPDIVAP
TAGC_DICDI      ------------------------------------------------ICSFSSKGPTHDGRMKPDLVAP
PCSK9_CALJA     XXXXXXXXXXXXXNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
PCSK9_SAIBB     XXXXXXXXXXXXXNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNF---GRCV------DLFAP
EPIP_STAEP      QKKGSIVVAAVGNDGXSKKVYDSPANLNNVMTVGSIDDNDY-------ISEFSN-----YGNNFIDLMTI
PCSK9_CALMO     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW
ELYA_BACHD      GVNV--------------NSTYTGNRYVSLSGTSMATPHVAGVAALVKSRYPSYTNNQIRQRI-NQTATY
SUBT_BACAM      GVSI--------------QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
THES_BACSJ      GVDIV--------------STITGNRYAYMSGTSMASPHVAGLAALLASQGRNNI--EIRQAIEQTADKI
ISP_PAEPO       GEDIL--------------STVPGGKYATFSGTSMATPHVAGALALIKQ---------------------
SUBB_BACLE      GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
YCT5_YEAST      GVEIESLSHLN-YNDTL-----------ILSGTSMSTPIVTGVAAILLSKEPEMIAQEIEYL--------
PSP3_SCHPO      GSLIL--------------SDWIGSNRASMSGTSMASPHVAGLAAYFISLDPSLAPVELKKALKDLLNGI
PEPC_ASPNG      GLNIL--------------STWIGSNYATISGTSMASPHIAGLLAYFVSLQPELTPAKLKK---------
SUBD_BACLI      GVSVYSTYPSNTYT--------------SLNGTSMASPHVAGAAALILSKYPTLSASQVRNRLSSTATNL
SUBF_BACSU      GVNIRSSVPGQTYED-------------GWDGTSMAGPHVSAVAALLKQANASLSVDEMEDILTSTAETF
SUBT_BACSU      GVSI--------------QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
SUBT_BACST      GVSI--------------QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
SUBT_BACSA      GVSI--------------QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
SUBN_BACNA      GVSI--------------QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
SUBE_BACSU      GTNITS-----TYLNQY---------YATGSGTSQATPHAAAMFALLKQRDPAETNVQLREEMR------
SUBT_BACLI      GAGVYSTYPTSTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
YSP3_YEAST      GINIMS-----TYIGSRNAT-------LSLSGTSMASPHVAGILSLSLQPAPDSSPQELKEVLKFSTQDI
PLS_PYRFU       GYGIYS-----------SLPMWIGGADF-MSGTSMATPHVSGVVALLISEGIYYNPDIIKKVLESGA-TW
PROA_VIBAL      GSQI--------------KSAWYDGGYKTISGTSMATPHVAGVAALYLQENSSVSPSQVEALIVSRASTG
ALP_LECPS       GTSI--------------TSTWIGGRTNTISGTSMATPHIAGLAAYL-----------------------
BPRX_DICNO      GAGITSTVDSGARYPS-------GPSYSLMDGTSMATPHVAGVAALVISANKEMTPAQVRDVL-------
SUBT_BACPU      GVSI--------------QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYL
ISP1_BACSU      GENILS-TLPN-------------KKYGKLTGTSMAAPHVSGALALI-----------------------
THET_THEVU      G----------SWI----YSTYPTSTYASLSGTSMATPHVAGVAGLLASQG--RSASNIRAAIENTADKI
PRTM_BACSK      GVNV--------------QSTYPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATGL
SUBV_BACSU      GVNIVST------IPTHDPDHPYG--YGSKQGTSMASPHIAGAVAVIKQAKPKWSVEQIKAAIMNTAVTL
SUBS_BACLE      GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
ELYA_BACCS      GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
ELYA_BACAO      GVNV--------------QSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
HLY_HAL17       GGNVLS--------------SIPWDNYDTFSGTSMASPVVAGVAGFTLSAHPNLSNAELRSHLQN-----
SUB1_NANOT      GSNIVSTR--------------------------------------------------------------
SUB1_MICCA      GSNIVSTR--------------------------------------------------------------
PRTB_YEAST      GLNILS-----TYIGSDDATA-------TLSGTSMASPHVAGLLTYFLSLQPSLTPQQLKKKL-------
ISP_BACCS       GVGI--------------KSTYLDSGYAELSGTSMAAPHVAGALALIINLAKD-----------------
ISP6_SCHPO      GLNI------------LXXXXXXXXXXXXXXXXXMATPHVAGLSAYYLGLHPAASASEVKDAI-------
TKSU_PYRKO      GVDILS-----TYPD---------DSYETLMGTSMATPHVSGVVALI-----------------------
AQL1_THEAQ      GASI-----PSAWY-----TSDTATQ--TLNGTSMATPHVAGVAALYLEQNPSATPASVASAILNG----
BPRV_DICNO      GTNILST------ID-VGQAGPVRSSYGMKAGTSMAAPHVSGVAALVISAGKTLTPSELSDILVRTTSRF
CUDP_METAN      GSNVLS--------------TWIVGRTNSISGTSMATPHIAGLAAYLSALQGKTTP--------------
WPRA_BACSU      GSDIPSL-VPNGNVTY-------------MSGTSMATPYXXXXXGLLFAQNPKLKRTEVEDMLKKTAD--
SPL1_ENCCU      GVDIL--------------SSWIGGTQKIVSGTSMAAPHTSGAIAAYL----------------------
SUBT_BACS9      GAAIYS-----TWFD---------GGYATISGTSMASPHAAGLAAKIWAQYPSASNVDVR----------
SUB6_TRIVC      GKDIVSLKP--------------GGGTDTLSGTSMASPHVCGLGAYLIQGGPGLC-DTIKEM--------
ELYA_BACYA      GVGV--------------QSTVPGNGYASFNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATNL
SUB6_TRISD      GKDITSLKP--------------GGSTDTLSGTSMASPHVCGLGAYLIQGGPGLC-DTIKKM--------
SUB6_TRIRU      GKDITSLKP--------------GGSTDTLSGTSMASPHVCGLGAYLIQGGPGLC-DTIKKM--------
SEPR_THESR      GQSITSAWYTSSTATN------------TISGTSMATPHVTGAAALYLQWYPTATPSQVASAL-------
SUB5_NANOT      GHNILSARPGG------------GSQ--VMSGTSMAAPHACGVAAYLIAKNPG--PDTTRRLLYNGSGR-
SUB6_ARTBE      GKDITSLKP--------------GGSTDTLSGTSMASPHVCGLGAYLIQGGPGLC-DTIKEM--------
SUB6_TRITO      GKDITSLKP--------------GGSTDTLSGTSMASPHVCGLGAYLIQGGPGLC-DTIKEM--------
SUB6_TRIEQ      GKDITSLKP--------------GGSTDTLSGTSMASPHVCGLGAYLIQGGPGLC-DTIKEM--------
ORYZ_ASPFL      GQNILS--------------AWIGSNTATISGTSMATPHIVGLSIYLMSSSPKAVSDRIKELATRGVVSN
SUB6_NANOT      GMHI--------------TSDKPGNGTAVLSGTSMASPHVCGIGAYLI----------------------
ORYZ_ASPOR      GQDILSAWIGSS------------SATNTISGTSMATPHIVGLAALENLDGPAAVTKRIKELATKDVVKD
SMP1_MAGPO      GVAVESAWIGSSH-----------AEHDVLDGTSMATPHVSGL---------------------------
SUB5_TRIVC      GHNILSAR--------------------------------------------------------------
SUB5_TRIRU      GHNILSAR--------------------------------------------------------------
SUB5_ARTBE      GHNILSAR--------------------------------------------------------------
SUB5_TRITO      GHNILSAR--------------------------------------------------------------
SUB5_TRIEQ      GHNILSAR--------------------------------------------------------------
EXPR_XANCP      GSSILSTLNSGT-------TTPGSASYASYNGTSMASPHVAGVVALVQSVAPTLTPAAVETLLKNTARAL
ALP_TRIAT       GVNILS--------------SWIGSNTATISGTSMATPHVVGL-ALYLQSSPTAVTNRIKALATSG----
ALP_CEPAC       GTSILS-----AWIGG-------NSATNTISGTSMATPHVTGV-VLYLQALEGLT---------------
SUB4_TRIRU      GSDIIAAR--------------------------------------------------------------
SUB4_TRIVC      GSDIIAAR--------------------------------------------------------------
SUB4_TRITO      GSDIIAAR--------------------------------------------------------------
SUB4_TRIEQ      GSDIIAAR--------------------------------------------------------------
SUB4_ARTBE      GSDIIAAR--------------------------------------------------------------
SUB1_TRIEQ      GSNIISAR--------------------------------------------------------------
PRTR_TRIAL      ----------------------------------------------------------------------
YZ18_AQUAE      GYFICSTNSESSHSDPYICAE--GHYYVPFAGTSMATAVVMGLVALYLQDHSFAIPEEVKE---------
SUB1_TRITO      GSNIISAR--------------------------------------------------------------
SUB1_TRIRU      GSNIVSAR--------------------------------------------------------------
SUB1_TRIVC      GSNIISAR--------------------------------------------------------------
SUB1_ARTBE      GSNIISAR--------------------------------------------------------------
SUB4_NANOT      GSDIIAAR--------------------------------------------------------------
MBTP1_CRIGR     -------------YXXXXXXXXXXXXCRALSGTSVASPVVAGAVTLLVQKRELVNPASVKQAL-------
ORYZ_ASPFU      GQDILS-----AWIGSTTATN-------TISGTSMATPHIVGLSVYLMLSGPAAVTARIKELATNG----
SUB3_TRIVC      GSNILS--------------AAPGGGTRTLSGTSMASPHVCGVGAAMLAQGVSVAQDRLKQI--------
SUB3_TRIRU      GSNILS--------------AAPGGGTRTLSGTSMASPHVCGVGAAMLAQ--------------------
SUB3_ARTBE      GSNILS--------------AAPGGGTRTLSGTSMASPHVCGVGAAMLAQGVSVAQDRLKQI--------
SPM1_MAGGR      GLNI--------------QSTWIGSKINTISGTSMASPHIAGLLAYYLSLQPTITPEKLKDLIKVGT---
PCSK9_RAT       GKDIIGA------------SSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRL-------
MBTP1_RAT       -------------YXXXXXXXXXXXXCRALSGTSVASPVVAGAVTLLVQKRELVNPASVKQAL-------
MBTP1_MOUSE     -------------YXXXXXXXXXXXXCRALSGTSVASPVVAGAVTLLVQKRELVNPASVKQAL-------
MBTP1_HUMAN     -------------YXXXXXXXXXXXXCRALSGTSVASPVVAGAVTLLVQKRELVNPASMKQAL-------
SUB3_TRIEQ      GSSIL--------------SAAPGGGTRTLSGTSMASPHVCGVGAAMLAQ--------------------
SUB3_TRITO      GSSIL--------------SAAPGGGTRTLSGTSMASPHVCGVGAAMLAQ--------------------
PRCA_ANAVT      RTGVVGYNSGNTNL-----GDQAGNYTNSFGGTSSACPGAAGVAALILSRNPNLRWDEVRDIIKRSCDRI
PCSK9_MOUSE     GKDIIGA------------SSDCSTCFMSQSGTSQAAAHVAGIVARMLSREPTLTLAELRQRLIHFSTKW
PCSK6_RAT       TYSSGAFYERKIVTTDLRQRCTDGH-----TGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSSDW
PRTK_TRIAL      ----------------------------------------------------------------------
PCSK6_HUMAN     TYSSGAFYERKIVTTDLRQRCTDGH-----TGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSSDW
TPP2_HUMAN      GGAIASV--PNWTLRGTQ----------LMNGTSMSSPNACGGIALILSNNIDYTVHSVRRALENTAVKA
SUB3_NANOT      GSNIL--------------SAAPGGGTRTLSGTSMASPHVCGVGAAMLAQGVSVAQDRIKQI--------
SUB3_MICCA      GSNIL--------------SAAPGGGTRTLSGTSMASPHVCGVGAAMLAQGVSVAQDRIKQI--------
TPP2_RAT        GGAIASV--PNWTLRGTQ----------LMNGTSMSSPNACGGIALVLSNNVDYTVHSVRRALENTAIKA
TPP2_MOUSE      GGAIASV--PNWTLRGTQ----------LMNGTSMSSPNACGGIALVLSNNVDYTVHSVRRALENTAIKA
SUB2_TRIEQ      G---------------------------------------------------------------------
FURI1_XENLA     ----------------------------------------------------------------------
PRCA_ANASP      RSGVVGYNSGSTNL-----GDQAGNYTNSFGGTSSACPGAAGVAALILSRNPNLRWDEVRDIIKRSCDRI
TPP2_SCHPO      GGAITSV-PPYS----LQNSQ-------LMNGTSMSSPSACGGISLILSQKKPYTAAAIKKAVMYTSKDL
SUB2_TRITO      G---------------------------------------------------------------------
SUB2_NANOT      G---------------------------------------------------------------------
KEX2_YEAST      ---VTYSSGSGEYIHSSDINGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSKNADGDW
FUR2_DROME      TVDMDGSLRPD-HICTVEH-----------TGTSASAPLAAGICALALEANPELTWRDMQYLV-------
TPP2_DROME      GGAIASV--PQFTMSKSQ----------LMNGTSMAAPHVAGAVALLIQQNIEYSPYSIKRAISVTATKL
TPP2_BOVIN      GGAIASV--PNWTLRGTQ----------LMNGTSMSSPNACGGIALVLSNDVNYTVHSVRRALENTAVKA
NEC1_BOVIN      --TLATSYSSGDYTDQRITSADLHNDCTTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLV-------
SUB2_TRIVC      G---------------------------------------------------------------------
C5AP_STRPY      GQDIL--------------SSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYPDMTPSEAKKVLMSSATAL
C5AP_STRP8      GQDIL--------------SSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYPDMTPSEAKKVLMSSATAL
C5AP_STRP6      GQDIL--------------SSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYPDMTPSEAKKVLMSSATAL
C5AP_STRP3      GQDIL--------------SSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYPDMTPSEAKKVLMSSATAL
C5AP_STRP1      GQDIL--------------SSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYPDMTPSEAKKVLMSSATAL
SUB2_ARTBE      G---------------------------------------------------------------------
SUBL_ARATH      GVNILAAWTGAAGPTGLASDSR-RVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKY
SUB2_TRIRU      G---------------------------------------------------------------------
PCSK4_RAT       DPQIVTTDLHHQCTDK-------------HTGTSASAPLAAGMIALALEANPLLTWRDLQHLVVRASAQL
PCSK4_MOUSE     DPQIVTTDLHHQCTDK-------------HTGTSASAPLAAGMIALALEANPLLTWRDLQHLVVRASAQL
NEC2_RAT        TFSNGRKRNPEAGV---ATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHL--------
SUB2_DEIRA      GVDVMLASPLFINADGTRKTGGYGSGYQLISGTSFSGPYTSGVAAVILGAKPDLDPHQVRRLMEETAD--
PCSK9_PANPA     GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK5_BRACL     CASTLTYSSGAPHERKVITTDLRKGCTESHTGTSASAPMAAGILALALEANPMLT---------------
NEC2_MOUSE      TFSNGRKRNPEAGV---ATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHL--------
PCSK9_PONPY     GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSVEPELTLAELRQRLIHFSAKW
KEX1_KLULA      AVMVVTYSSGSNYIKTTDLDEKCSN---THGGTSAAAPLAAGIYTLVLEANPNLTWRDVQEEINPHDGKW
PCSK9_PANTR     GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK9_MACNE     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK9_MACMU     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK9_HUMAN     GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK9_GORGO     GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK9_COLGU     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
PCSK5_RAT       ----TTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRNANDW
PCSK5_MOUSE     ----TTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRNANDW
CUCM1_CUCME     GVEILAAWPSVAPVGGIRRNTL----FNIISGTSMSCPHITGIATYVKTYNPTWSPAAIKSALMTTASRF
NEC2_PONAB      TFSNGRKRNPEAGV---ATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHL--------
NEC2_PIG        TFSNGRKRNPEAGV---ATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHL--------
NEC2_HUMAN      TFSNGRKRNPEAGV---ATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHL--------
XSP1_ARATH      GIDILAAFTLKRSLTGLDGDTQF-SKFTILSGTSMACPHVAGVAAYVKSFHPD-----------------
NEC2_BOVIN      TFSNGRKRNPEAGV---ATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHL--------
PRTT_TRIAL      GTDI--------------KSTWNDGRTKIISGTSMASPHVAGLGAYFL----------------------
PCSK5_HUMAN     ----TTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRNANDW
PCSK4_HUMAN     DPQIVTTDLHHGCTDQ-------------HTGTSASAPLAAGMIALALEANPFLTWRDMQHLV-------
SUB2_MICCA      ----------------------------------------------------------------------
NEC1_RAT        SSTLATSYSSGDYTDQRITSADLHNDCTTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLV-------
NEC1_HUMAN      SSTLATSYSSGDYTDQRITSADLHNDCTTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLV-------
NEC1_MUSCO      SSTLATSYSSGDYTDQRITSADLHNDCTTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLV-------
NEC1_MOUSE      SSTLATSYSSGDYTDQRITSADLHNDCTTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLV-------
SUB7_TRIVO      ----------------------------------------------------------------------
SUB7_TRISD      ----------------------------------------------------------------------
SUB7_TRIRU      ----------------------------------------------------------------------
SUB7_NANOT      GDSITSAKPGG------------GSQ--VLSGTSMATPHVAGLAAYFI----------------------
KEX2_CANAL      -VTYSSGSGEHIHTTDIKKKCSA-----THGGTSAAAPLASGIYSLILSANPNLTWRDVQYISVLSATPI
BLI4_CAEEL      ----------------------------------------------------------------------
SUB7_TRITO      GDGITSAKPGG------------GSQ--VLSGTSMASPHVAGLAAYLI----------------------
SUB7_TRIEQ      GDGITSAKPGG------------GSQ--VLSGTSMASPHVAGLAAYLI----------------------
KRP1_SCHPO      ----------------------------------------------------------------------
FURIN_RAT       -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
PRTS_SERMA      --------------------------YGNKSGTSMAAPHVTGVAAVLMQRFPYMSADQISAVIKTATDLG
FURIN_MOUSE     -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
FURIN_HUMAN     -KQIVT-------TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV-------
FUR1C_DROME     ----------------------------------------------------------------------
FUR11_DROME     ----------------------------------------------------------------------
FURIN_BOVIN     -KQIVT-------TDLRQKCTE------SHTGTSAFAPLAAGIIALTLEANKNLTWRDMQHLV-------
SUB7_TRIVC      ----------------------------------------------------------------------
SUB7_ARTBE      ----------------------------------------------------------------------
PRTT_SERMA      ----------------------VKPDYGNMSGTSMA-PDVTGFAAVLMQRFPYMSAAQISAVIKTATDLG
PCSK9_LAGLA     GEDIIG------------ASSDCSTCFVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
XPR6_YARLI      ----------------------------------------------------------------------
PCSK9_ATEGE     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
P3P_LACLS       GGNIWSTQNNNGYTN--------------MSGTSMASPFIAG----------------------------
P2P_LACPA       GGNIWSTQNNNGYTN--------------MSGTSMASPFIAG----------------------------
P2P_LACLC       GGNIWSTQNNNGYTN--------------MSGTSMASPFIAG----------------------------
P1P_LACLC       GGNIWSTQNNNGYTN--------------MSGTSMASPFIAG----------------------------
TAGB_DICDI      GEYITSARSENSTDQCGDGSLPNANGLMSISGTSM-----------------------------------
PCSK9_SAGLB     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKW
TAGD_DICDI      GQYITSARS-------------------------------------------------------------
TAGC_DICDI      GEYITSARS-------------------------------------------------------------
PCSK9_CALJA     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXMMLSAKPELTLAELRQRLIHFSAKW
PCSK9_SAIBB     GEDIIG------------ASSDCSTCFVSRSGTSQXXXXXXXXXXVMLSAEPELTLAELRQRLIHFSAKW
EPIP_STAEP      GYKLLDKYGKDAWLEKMQKQSVLSTRYIYQSGTSLAAPKVSGALALEIDQLKDQPETAIELFKKKGIEKE
PCSK9_CALMO     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KDEDPNIYGAGAVNAENSVPGx
ELYA_BACHD      LG-SPSLYGNGLVHA-------
SUBT_BACAM      GDS--FYYGKGLINVQ------
THES_BACSJ      SGTG-TYFKYGRINSYNAV---
ISP_PAEPO       ----------------------
SUBB_BACLE      --GSTNLYGSGLVNAE------
YCT5_YEAST      ----------------------
PSP3_SCHPO      PEDTPNV---------------
PEPC_ASPNG      ----------------------
SUBD_BACLI      GDS--FYYGKGLINVE------
SUBF_BACSU      PDSPNNGYGHGLVNAFDAV---
SUBT_BACSU      GNS--FYYGKGLINVQ------
SUBT_BACST      GNS--FYYGKGLINVQ------
SUBT_BACSA      GNS--FYYGKGLINVQ------
SUBN_BACNA      GNS--FYYGKGLINVQ------
SUBE_BACSU      ----------------------
SUBT_BACLI      GSS--FYYGKGLINVE------
YSP3_YEAST      GDDTPNIYNGG-----------
PLS_PYRFU       LEGDP-----------------
PROA_VIBAL      KVTDTR----GSVN--------
ALP_LECPS       ----------------------
BPRX_DICNO      ----------------------
SUBT_BACPU      GSS--FYYGKGLINVQ------
ISP1_BACSU      ----------------------
THET_THEVU      SGTG-TYWAKGRVNAYKAV---
PRTM_BACSK      --GNTNLYGSGLVNAE------
SUBV_BACSU      KDSDGEVYGAGSARIMNAI---
SUBS_BACLE      --GSTNLYGSGLVNAE------
ELYA_BACCS      --GSTNLYGSGLVNAE------
ELYA_BACAO      --GSTNLYGSGLVNAE------
HLY_HAL17       ----------------------
SUB1_NANOT      ----------------------
SUB1_MICCA      ----------------------
PRTB_YEAST      ----------------------
ISP_BACCS       ----------------------
ISP6_SCHPO      ----------------------
TKSU_PYRKO      ----------------------
AQL1_THEAQ      ----------------------
BPRV_DICNO      NGRLDRGLGSGIVDANAAV---
CUDP_METAN      ----------------------
WPRA_BACSU      ----------------------
SPL1_ENCCU      ----------------------
SUBT_BACS9      ----------------------
SUB6_TRIVC      ----------------------
ELYA_BACYA      GNTTQ--FGSGLVNAE------
SUB6_TRISD      ----------------------
SUB6_TRIRU      ----------------------
SEPR_THESR      ----------------------
SUB5_NANOT      ----------------------
SUB6_ARTBE      ----------------------
SUB6_TRITO      ----------------------
SUB6_TRIEQ      ----------------------
ORYZ_ASPFL      VAGSPNL---------------
SUB6_NANOT      ----------------------
ORYZ_ASPOR      VKGSPNL---------------
SMP1_MAGPO      ----------------------
SUB5_TRIVC      ----------------------
SUB5_TRIRU      ----------------------
SUB5_ARTBE      ----------------------
SUB5_TRITO      ----------------------
SUB5_TRIEQ      ----------------------
EXPR_XANCP      PGACSGGCGAGIVNADAAV---
ALP_TRIAT       ----------------------
ALP_CEPAC       ----------------------
SUB4_TRIRU      ----------------------
SUB4_TRIVC      ----------------------
SUB4_TRITO      ----------------------
SUB4_TRIEQ      ----------------------
SUB4_ARTBE      ----------------------
SUB1_TRIEQ      ----------------------
PRTR_TRIAL      ----------------------
YZ18_AQUAE      ----------------------
SUB1_TRITO      ----------------------
SUB1_TRIRU      ----------------------
SUB1_TRIVC      ----------------------
SUB1_ARTBE      ----------------------
SUB4_NANOT      ----------------------
MBTP1_CRIGR     ----------------------
ORYZ_ASPFU      ----------------------
SUB3_TRIVC      ----------------------
SUB3_TRIRU      ----------------------
SUB3_ARTBE      ----------------------
SPM1_MAGGR      ----------------------
PCSK9_RAT       ----------------------
MBTP1_RAT       ----------------------
MBTP1_MOUSE     ----------------------
MBTP1_HUMAN     ----------------------
SUB3_TRIEQ      ----------------------
SUB3_TRITO      ----------------------
PRCA_ANAVT      DPVGGNFYGYGRINALKAV---
PCSK9_MOUSE     FPEDQQV---------------
PCSK6_RAT       KHKVSHLYGFGLVDAE------
PRTK_TRIAL      ----------------------
PCSK6_HUMAN     KHKVSHFYGFGLVDAE------
TPP2_HUMAN      DNIEVFAQGHGIIQVDKA----
SUB3_NANOT      ----------------------
SUB3_MICCA      ----------------------
TPP2_RAT        DNIEVFAQGHGIIQVDKA----
TPP2_MOUSE      DNIEVFAQGHGIIQVDKA----
SUB2_TRIEQ      ----------------------
FURI1_XENLA     ----------------------
PRCA_ANASP      DPVGGNFYGYGRINALKAV---
TPP2_SCHPO      RDD----FNTGMLQVDNA----
SUB2_TRITO      ----------------------
SUB2_NANOT      ----------------------
KEX2_YEAST      RDKYSHRYGFGKIDAHKLI---
FUR2_DROME      ----------------------
TPP2_DROME      GYVDPFAQGHGLLNVEKA----
TPP2_BOVIN      DNIEVFAQGHGIIQVDKA----
NEC1_BOVIN      ----------------------
SUB2_TRIVC      ----------------------
C5AP_STRPY      YDEDEKAY--------------
C5AP_STRP8      YDEDEKAY--------------
C5AP_STRP6      YDEDEKAY--------------
C5AP_STRP3      YDEDEKAY--------------
C5AP_STRP1      YDEDEKAY--------------
SUB2_ARTBE      ----------------------
SUBL_ARATH      KDGKP-----------------
SUB2_TRIRU      ----------------------
PCSK4_RAT       QAEDWRINGVG-----------
PCSK4_MOUSE     QAEDWRINGVG-----------
NEC2_RAT        ----------------------
SUB2_DEIRA      ----------------------
PCSK9_PANPA     FPEDQRVLTPNLVAA-------
PCSK5_BRACL     ----------------------
NEC2_MOUSE      ----------------------
PCSK9_PONPY     FPEDQRVLTPNLVAA-------
KEX1_KLULA      QDRYSHTYGFGKLDAYNIV---
PCSK9_PANTR     FPEDQRVLTPNLVAA-------
PCSK9_MACNE     FPEDQRVLTPNLVAA-------
PCSK9_MACMU     FPEDQRVLTPNLVAA-------
PCSK9_HUMAN     FPEDQRVLTPNLVAA-------
PCSK9_GORGO     FPEDQRVLTPNLVAA-------
PCSK9_COLGU     FPEDQRVLTPNLVAA-------
PCSK5_RAT       KTKVSHLYGFGLMDAEAMV---
PCSK5_MOUSE     KTKVSHLYGFGLMDAEAMV---
CUCM1_CUCME     NPQAEFAYGSGHVNPLKAVPG-
NEC2_PONAB      ----------------------
NEC2_PIG        ----------------------
NEC2_HUMAN      ----------------------
XSP1_ARATH      ----------------------
NEC2_BOVIN      ----------------------
PRTT_TRIAL      ----------------------
PCSK5_HUMAN     KTKVSHLYGFGLMDAEAMV---
PCSK4_HUMAN     ----------------------
SUB2_MICCA      ----------------------
NEC1_RAT        ----------------------
NEC1_HUMAN      ----------------------
NEC1_MUSCO      ----------------------
NEC1_MOUSE      ----------------------
SUB7_TRIVO      ----------------------
SUB7_TRISD      ----------------------
SUB7_TRIRU      ----------------------
SUB7_NANOT      ----------------------
KEX2_CANAL      NEEDGN-YQTTALNRKYS----
BLI4_CAEEL      ----------------------
SUB7_TRITO      ----------------------
SUB7_TRIEQ      ----------------------
KRP1_SCHPO      ----------------------
FURIN_RAT       ----------------------
PRTS_SERMA      VAGIDNLFGWGRVNLRDAING-
FURIN_MOUSE     ----------------------
FURIN_HUMAN     ----------------------
FUR1C_DROME     ----------------------
FUR11_DROME     ----------------------
FURIN_BOVIN     ----------------------
SUB7_TRIVC      ----------------------
SUB7_ARTBE      ----------------------
PRTT_SERMA      EVGIDHLFGWGRVNLRDAING-
PCSK9_LAGLA     FPEDQRVLTPNLVAA-------
XPR6_YARLI      ----------------------
PCSK9_ATEGE     FPEDQRVLTPNLVAA-------
P3P_LACLS       ----------------------
P2P_LACPA       ----------------------
P2P_LACLC       ----------------------
P1P_LACLC       ----------------------
TAGB_DICDI      ----------------------
PCSK9_SAGLB     FPEDQRVLTPNLVAA-------
TAGD_DICDI      ----------------------
TAGC_DICDI      ----------------------
PCSK9_CALJA     FPEDQRVLTPNLVAA-------
PCSK9_SAIBB     FPEDQRVLTPNLVAA-------
EPIP_STAEP      KYMDKKHYGNGKLD--------
PCSK9_CALMO     ----------------------