[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB13612.1

[Show Plain Result]


## Summary of Sequence Search
    1::150
   16::138     8e-08  28%  143 aa  Y3023_ACIAD RecName: Full=Uncharacterized protein
   28::142     4e-07  28%  142 aa  OHRL2_STAEQ RecName: Full=Organic hydroperoxide resistance
   28::142     9e-07  27%  142 aa  OHRL2_STAES RecName: Full=Organic hydroperoxide resistance
    8::140     8e-06  27%  143 aa  OSMC_SHIFL RecName: Full=Peroxiredoxin osmC;       
    8::140     8e-06  27%  143 aa  OSMC_ECOLI RecName: Full=Peroxiredoxin osmC;       
   17::139     2e-05  27%  142 aa  OHR_XANCH RecName: Full=Organic hydroperoxide resistance protein;
   17::139     2e-05  27%  142 aa  OHR_XANAC RecName: Full=Organic hydroperoxide resistance protein;
   14::141     1e-04  27%  142 aa  OHRL2_STAS1 RecName: Full=Organic hydroperoxide resistance
  377::436     6e-04  33%  587 aa  FTHS_SYNFM RecName: Full=Formate--tetrahydrofolate ligase;       
    1::150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
Y3023_ACIAD     -------------GGRDGRATSSDNILDVQLTVPKEMGGMGGGTNPEQLFAAGYSACFLMKFVATRDKFN
OHRL2_STAEQ     ---------------------------VQSLATPKEMGGQGNDTNPEQLFAAGYSACFNSALSLILSQNK
OHRL2_STAES     ---------------------------VQNLATPKEMGGQGNDTNPEQLFAAGYSACFNSALSLILSQNK
OSMC_SHIFL      --------QAHWEGDKRGKGTVESGVLNQQYGFNTRFEGE-KGTNPEELIGAAHAACFSMALSLMLGEAG
OSMC_ECOLI      --------QAHWEGDKRGKGTVESGVLNQQYGFNTRFEGE-KGTNPEELIGAAHAACFSMALSLMLGEAG
OHR_XANCH       -------------GGREGRAVSSDKALDAKLSTPRELGGAGDGTNPEQLFAAGYAACFIGAMKAVAAQDK
OHR_XANAC       -------------GGREGRAVSSDKALDAKLSTPRELGGAGDGTNPEQLFAAGYAACFIGAMKAVAAQDK
OHRL2_STAS1     -------------GGRDGKVFSEDNTFYQDLAVPKEMGGNGTESNPEQLFAAGYSACFNNALMHIL----
FTHS_SYNFM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
Y3023_ACIAD     IPKDAYVEGDVGIGPIPNGFGIEVKLVHLPGM---------DTDEAKKLVDAAHIVCPYSNATRNNIDVD
OHRL2_STAEQ     ISDANPEVEIELLKDDTDNGFKLGADI---KVTLENMSQQD----AEKFVEQAHQFCPYSKATRGNIDVQ
OHRL2_STAES     ISDANPEVEIELLKDDTDNGFKLGADI---KVTLENMSQQD----AEKFVEQAHQFCPYSKATRGNIDVQ
OSMC_SHIFL      FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
OSMC_ECOLI      FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGDASTFD-----GIIQKAKAGCPVSQVLKAEITLD
OHR_XANCH       LKPGEVSIDSSVGIGQIPGGFGI-------VVELRIAVPGMDKAELQTLVDKAHQVCPYSNATRGNIDVT
OHR_XANAC       LKPGEVSIDSSVGIGQIPGGFGI-------VVELRIAVPGMDKAELQTLVDKAHQVCPYSNATRGNIDVT
OHRL2_STAS1     --KSDSKGTIEPEVSVTAYLLPDKKLAAELDVTLT-DMTQEE---AETYVEKAHNYCPYSKALKESIDIE
FTHS_SYNFM      --KENLKLLEKGIVNMVHHINTIRKSGMNPVVCINHTDTKDEIALVRKHAEAAGARCALS----------


                         +         .         .         .         .         *         .:210
query           LEASVKxxxx
Y3023_ACIAD     FE--------
OHRL2_STAEQ     LDVTAQ----
OHRL2_STAES     LDVTAQ----
OSMC_SHIFL      YQ--------
OSMC_ECOLI      YQ--------
OHR_XANCH       L---------
OHR_XANAC       L---------
OHRL2_STAS1     IQVSV-----
FTHS_SYNFM      ----------