[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB13622.1

[Show Plain Result]


## Summary of Sequence Search
    1::700
    1::700       0.0 100%  700 aa  RIR1_BACSU RecName: Full=Ribonucleoside-diphosphate reductase
   50::725       0.0  47%  725 aa  RIR1_MYCTU RecName: Full=Ribonucleoside-diphosphate reductase
   50::725       0.0  47%  725 aa  RIR1_MYCBO RecName: Full=Ribonucleoside-diphosphate reductase
    3::381       0.0  80% 1084 aa  NRDEB_BPSPC RecName: Full=Ribonucleoside-diphosphate reductase
    3::381       0.0  80% 1084 aa  NRDEB_BACSU RecName: Full=Ribonucleoside-diphosphate reductase
   47::721     e-179  46%  721 aa  RIR1_MYCLE RecName: Full=Ribonucleoside-diphosphate reductase
   39::714     e-174  45%  714 aa  RIR3_SALTY RecName: Full=Ribonucleoside-diphosphate reductase 2
   38::721     e-174  46%  721 aa  RIR1_MYCPN RecName: Full=Ribonucleoside-diphosphate reductase
   39::714     e-171  44%  714 aa  RIR3_ECOLI RecName: Full=Ribonucleoside-diphosphate reductase 2
   37::706     e-171  46%  721 aa  RIR1_MYCGE RecName: Full=Ribonucleoside-diphosphate reductase
  121::801     5e-70  31%  801 aa  RIR1_AQUAE RecName: Full=Ribonucleoside-diphosphate reductase
  196::843     3e-66  30%  845 aa  RIR1_TREPA RecName: Full=Ribonucleoside-diphosphate reductase
   96::773     5e-60  30%  788 aa  RIR1_HELPY RecName: Full=Ribonucleoside-diphosphate reductase
   96::773     5e-60  30%  788 aa  RIR1_HELPJ RecName: Full=Ribonucleoside-diphosphate reductase
  423::994     3e-55  31% 1047 aa  RIR1_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase
  346::994     2e-53  29% 1047 aa  RIR1_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase
  212::763     4e-52  31%  767 aa  RIR1_SYNY3 RecName: Full=Ribonucleoside-diphosphate reductase
   85::734     1e-51  29%  768 aa  RIR1_ENCCU RecName: Full=Ribonucleoside-diphosphate reductase large
  143::740     3e-50  29%  811 aa  RIR1_SCHPO RecName: Full=Ribonucleoside-diphosphate reductase large
  343::993     3e-50  27% 1044 aa  RIR1_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase
  166::753     1e-49  30%  812 aa  RIR1_DROME RecName: Full=Ribonucleoside-diphosphate reductase large
  155::742     4e-49  30%  792 aa  RIR1_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase large
  113::742     9e-49  29%  806 aa  RIR1_PLAF4 RecName: Full=Ribonucleoside-diphosphate reductase large
  161::748     3e-48  30%  788 aa  RIR1_CAEEL RecName: Full=Ribonucleoside-diphosphate reductase large
  228::814     4e-47  29%  881 aa  RIR1_MIMIV RecName: Full=Ribonucleoside-diphosphate reductase large
  155::742     7e-47  29%  792 aa  RIR1_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase large
  137::746     1e-46  29%  869 aa  RIR3_YEAST RecName: Full=Ribonucleoside-diphosphate reductase large
  155::742     2e-46  29%  792 aa  RIR1_PONAB RecName: Full=Ribonucleoside-diphosphate reductase large
  143::740     4e-46  29%  771 aa  RIR1_VARV RecName: Full=Ribonucleoside-diphosphate reductase large
  128::747     2e-45  28%  929 aa  RIR1_NEUCR RecName: Full=Ribonucleoside-diphosphate reductase large
  137::746     6e-45  29%  888 aa  RIR1_YEAST RecName: Full=Ribonucleoside-diphosphate reductase large
  101::741     4e-44  26%  763 aa  RIR1_BUCAP RecName: Full=Ribonucleoside-diphosphate reductase
  132::742     5e-44  27%  803 aa  RIR1_CRYPV RecName: Full=Ribonucleoside-diphosphate reductase large
  114::741     1e-42  28%  804 aa  RIR1_PLAFG RecName: Full=Ribonucleoside-diphosphate reductase large
  143::740     7e-41  28%  771 aa  RIR1_VACCW RecName: Full=Ribonucleoside-diphosphate reductase large
  143::740     7e-41  28%  771 aa  RIR1_VACCC RecName: Full=Ribonucleoside-diphosphate reductase large
  143::740     7e-41  28%  771 aa  RIR1_VACCA RecName: Full=Ribonucleoside-diphosphate reductase large
  109::741     3e-40  25%  761 aa  RIR1_SALTY RecName: Full=Ribonucleoside-diphosphate reductase 1
  160::800     5e-40  28%  835 aa  RIR1_OSHV1 RecName: Full=Ribonucleoside-diphosphate reductase large
  137::761     5e-40  26%  816 aa  RIR1_ARATH RecName: Full=Ribonucleoside-diphosphate reductase large
  109::741     6e-40  25%  761 aa  RIR1_ECOLI RecName: Full=Ribonucleoside-diphosphate reductase 1
  137::742     1e-39  28%  794 aa  RIR1_DANRE RecName: Full=Ribonucleoside-diphosphate reductase large
  102::732     1e-38  26%  754 aa  RIR1_BPT4 RecName: Full=Ribonucleoside-diphosphate reductase
  172::764     2e-38  27%  838 aa  RIR1_TRYBB RecName: Full=Ribonucleoside-diphosphate reductase large
  180::770     7e-38  27%  870 aa  RIR1_DICDI RecName: Full=Ribonucleoside-diphosphate reductase large
  102::637     9e-38  25%  761 aa  RIR1_BUCAI RecName: Full=Ribonucleoside-diphosphate reductase
  113::740     6e-37  25%  756 aa  RIR1_HAEIN RecName: Full=Ribonucleoside-diphosphate reductase
  113::740     2e-36  24%  761 aa  RIR1_BUCBP RecName: Full=Ribonucleoside-diphosphate reductase
  107::618     3e-33  28%  778 aa  RIR1_ASFP4 RecName: Full=Ribonucleoside-diphosphate reductase large
  123::618     4e-33  28%  778 aa  RIR1_ASFWA RecName: Full=Ribonucleoside-diphosphate reductase large
  124::619     2e-32  29%  779 aa  RIR1_ASFK5 RecName: Full=Ribonucleoside-diphosphate reductase large
  123::618     3e-32  28%  778 aa  RIR1_ASFB7 RecName: Full=Ribonucleoside-diphosphate reductase large
  553::1142    8e-32  26% 1142 aa  RIR1_HHV2H RecName: Full=Ribonucleoside-diphosphate reductase large
  555::1144    2e-31  25% 1144 aa  RIR1_HHV23 RecName: Full=Ribonucleoside-diphosphate reductase large
  108::619     9e-31  28%  779 aa  RIR1_ASFM2 RecName: Full=Ribonucleoside-diphosphate reductase large
  548::1137    1e-29  26% 1137 aa  RIR1_HHV11 RecName: Full=Ribonucleoside-diphosphate reductase large
   20::602     4e-25  27%  630 aa  RIR1_IIV3 RecName: Full=Ribonucleoside-diphosphate reductase large
  193::788     1e-24  25%  790 aa  RIR1_EHV1B RecName: Full=Ribonucleoside-diphosphate reductase large
  128::693     1e-24  25%  964 aa  NRDJ_STRAW RecName: Full=Vitamin B12-dependent ribonucleotide
  196::767     6e-24  26%  787 aa  RIR1_BHV1C RecName: Full=Ribonucleoside-diphosphate reductase large
  129::563     8e-24  25%  961 aa  NRDJ_STRCL RecName: Full=Vitamin B12-dependent ribonucleotide
  129::694     1e-23  25%  967 aa  NRDJ_STRCO RecName: Full=Vitamin B12-dependent ribonucleotide
  181::775     7e-23  26%  775 aa  RIR1_VZVO RecName: Full=Ribonucleoside-diphosphate reductase large
  181::775     7e-23  26%  775 aa  RIR1_VZVD RecName: Full=Ribonucleoside-diphosphate reductase large
  192::787     6e-22  25%  789 aa  RIR1_EHV4 RecName: Full=Ribonucleoside-diphosphate reductase large
  249::833     2e-18  26%  835 aa  RIR1_SUHVK RecName: Full=Ribonucleoside-diphosphate reductase large
  166::704     2e-18  28%  764 aa  NRDJ_BDEBA RecName: Full=Vitamin B12-dependent ribonucleotide
   47::740     4e-18  24%  826 aa  RIR1_EBVB9 RecName: Full=Ribonucleoside-diphosphate reductase large
   47::740     4e-18  24%  826 aa  RIR1_EBVA8 RecName: Full=Ribonucleoside-diphosphate reductase large
   47::740     5e-18  24%  826 aa  RIR1_EBVG RecName: Full=Ribonucleoside-diphosphate reductase large
  213::621     3e-17  25% 1040 aa  NRDJ_RHOBA RecName: Full=Vitamin B12-dependent ribonucleotide
  156::725     2e-16  23%  767 aa  RIR1_SHV21 RecName: Full=Ribonucleoside-diphosphate reductase large
   67::272     3e-13  31%  959 aa  RIR1_IIV6 RecName: Full=Ribonucleoside-diphosphate reductase large
  431::692     1e-10  27% 1272 aa  NRDJ_AGRT5 RecName: Full=Vitamin B12-dependent ribonucleotide
  420::692     9e-09  26% 1254 aa  NRDJ_BRAJA RecName: Full=Vitamin B12-dependent ribonucleotide
  137::611     2e-08  30% 1209 aa  NRDJ_LEPIN RecName: Full=Vitamin B12-dependent ribonucleotide
  137::611     2e-08  30% 1209 aa  NRDJ_LEPIC RecName: Full=Vitamin B12-dependent ribonucleotide
    7::210     3e-07  27%  599 aa  NRDJ_STRCT RecName: Full=Vitamin B12-dependent ribonucleotide
   81::262     3e-04  27%  750 aa  PBPX_STRR6 RecName: Full=Penicillin-binding protein 2X;       
   81::262     3e-04  27%  750 aa  PBPX_STRPN RecName: Full=Penicillin-binding protein 2x;       
    1::700

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSQNQVPKWIQLNNEIMIXXXXXXXXXXXXEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
RIR1_BACSU      MSQNQVPKWIQLNNEIMIXXXXXXXXXXXXEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
RIR1_MYCTU      ------------------------------EAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLD
RIR1_MYCBO      ------------------------------EAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLD
NRDEB_BPSPC     ---NTIPNWIKLNNEIMIQKDGKYQFEKDKEAVHSYFVDYINQNTVFFHDLKEKLDYLIKNDYYEEEFLS
NRDEB_BACSU     ---NTIPNWIKLNNEIMIQKDGKYQFEKDKEAVHSYFVDYINQNTVFFHDLKEKLDYLIKNDYYEEEFLS
RIR1_MYCLE      -------------------------------AARQFFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLD
RIR3_SALTY      ------------------------------QAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
RIR1_MYCPN      -------------------------------AVEAYIQEHVKPKTKVFHSTKERLDFLVKNDYYDENIIN
RIR3_ECOLI      ------------------------------QAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLN
RIR1_MYCGE      ------------------------------QAVESYIQEHVKPKTKVFHSTKERLDFLIKNDYYDEKIIN
RIR1_AQUAE      ----------------------------------------------------------VEKGIYGEYLLE
RIR1_TREPA      ------------------------------------------------HSFYEKITYLEEAGLYGVYIRT
RIR1_HELPY      -----------------------------------------------YRHLKEYFENAEEKGRILKGFKE
RIR1_HELPJ      -----------------------------------------------YRHLKEYFENAEEKGRILKGFKE
RIR1_CHLTR      ----------------------------------------------------------------------
RIR1_CHLMU      --------------------------------------------------------YIMEGDSYRPELKN
RIR1_SYNY3      ----------------------------------------------------------------------
RIR1_ENCCU      -------------------------------------VSYIHEITM--DSFVEKIKYIQKHRVSEEMYII
RIR1_SCHPO      ----------------------------------------------------------------------
RIR1_CHLPN      -------------------------------------------------------EYILNGEEYRNPQLK
RIR1_DROME      ----------------------------------------------------------------------
RIR1_MOUSE      ----------------------------------------------------------------------
RIR1_PLAF4      ---------------------------------------------------------LISKEVYD--FIL
RIR1_CAEEL      ----------------------------------------------------------------------
RIR1_MIMIV      ----------------------------------------------------------------------
RIR1_HUMAN      ----------------------------------------------------------------------
RIR3_YEAST      ----------------------------------------------------------------------
RIR1_PONAB      ----------------------------------------------------------------------
RIR1_VARV       ----------------------------------------------------------------------
RIR1_NEUCR      ----------------------------------------------------------------------
RIR1_YEAST      ----------------------------------------------------------------------
RIR1_BUCAP      -------------------------------------------------NLYYHVKKMVQLGKYDEKLLQ
RIR1_CRYPV      ----------------------------------------------------------------------
RIR1_PLAFG      ---------------------------------------------------------LISKEVYD--FIL
RIR1_VACCW      ----------------------------------------------------------------------
RIR1_VACCC      ----------------------------------------------------------------------
RIR1_VACCA      ----------------------------------------------------------------------
RIR1_SALTY      ---------------------------------------------------------MVELGKYDNHLLE
RIR1_OSHV1      ----------------------------------------------------------------------
RIR1_ARATH      ----------------------------------------------------------------------
RIR1_ECOLI      ---------------------------------------------------------MVEMGKYDNHLLE
RIR1_DANRE      ----------------------------------------------------------------------
RIR1_BPT4       ----------------------------------------------------DHISYCVNAGKYDPELLS
RIR1_TRYBB      ----------------------------------------------------------------------
RIR1_DICDI      ----------------------------------------------------------------------
RIR1_BUCAI      --------------------------------------------------LYDHVKKMVDLEKYDENLLK
RIR1_HAEIN      ----------------------------------------------------EKYDQALLDDYTREEWDT
RIR1_BUCBP      ----------------------------------------------------EKYDQHLLNDYPKQDFLI
RIR1_ASFP4      ----------------------------------------------------------------------
RIR1_ASFWA      ----------------------------------------------------------------------
RIR1_ASFK5      ----------------------------------------------------------------------
RIR1_ASFB7      ----------------------------------------------------------------------
RIR1_HHV2H      ----------------------------------------------------------------------
RIR1_HHV23      ----------------------------------------------------------------------
RIR1_ASFM2      ----------------------------------------------------------------------
RIR1_HHV11      ----------------------------------------------------------------------
RIR1_IIV3       ----------------------------------------------------------------------
RIR1_EHV1B      ----------------------------------------------------------------------
NRDJ_STRAW      ----------------------------------------------------------------------
RIR1_BHV1C      ----------------------------------------------------------------------
NRDJ_STRCL      ----------------------------------------------------------------------
NRDJ_STRCO      ----------------------------------------------------------------------
RIR1_VZVO       ----------------------------------------------------------------------
RIR1_VZVD       ----------------------------------------------------------------------
RIR1_EHV4       ----------------------------------------------------------------------
RIR1_SUHVK      ----------------------------------------------------------------------
NRDJ_BDEBA      ----------------------------------------------------------------------
RIR1_EBVB9      ------------------------------------------------HTVAEYLE-VFSDKFYDEEFFQ
RIR1_EBVA8      ------------------------------------------------HTVAEYLE-VFSDKFYDEEFFQ
RIR1_EBVG       ------------------------------------------------HTVAEYLE-VFSDKFYDEEFFQ
NRDJ_RHOBA      ----------------------------------------------------------------------
RIR1_SHV21      ----------------------------------------------------------------------
RIR1_IIV6       ----------------------------------------------------------------------
NRDJ_AGRT5      ----------------------------------------------------------------------
NRDJ_BRAJA      ----------------------------------------------------------------------
NRDJ_LEPIN      ----------------------------------------------------------------------
NRDJ_LEPIC      ----------------------------------------------------------------------
NRDJ_STRCT      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
RIR1_BACSU      LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
RIR1_MYCTU      QYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVXXXXXXXXXXXXXXX
RIR1_MYCBO      QYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVXXXXXXXXXXXXXXX
NRDEB_BPSPC     KYTFEQIKSIYKIAYSYKFRFPSFMSAFKFYNDYALKTNDKTKILERYEDRVSIVALYCADGDYEKAVEE
NRDEB_BACSU     KYTFEQIKSIYKIAYSYKFRFPSFMSAFKFYNDYALKTNDKTKILERYEDRVSIVALYCADGDYEKAVEE
RIR1_MYCLE      QYSRNFVKSLLDRAYAKKFRFSTFLGAFKYYTSYTLKTFDGKRYLERLEDRVCMVXXXXXXXXXXXXEKL
RIR3_SALTY      RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
RIR1_MYCPN      MYSFEQFEEITRKAYAYRFRYANFMGAFKFYNAYALKTFDGKWYLENYEDRVVMNVLFLANGNYNKALKL
RIR3_ECOLI      RYSRDFVITLFTHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQL
RIR1_MYCGE      MYSFEQFEEITHKAYSYRFRYANFMGAFKFYNAYALKTFDGKYYLENYEDRVVMNVLMLANGNFNKALKL
RIR1_AQUAE      NYSEEDFNKLANYIKPERDLYFTYTGIKILYDRYLVR-DEEGRVIELPQEMYMLIAMTLAVPEKPEAKKF
RIR1_TREPA      HYSRAEIEEAATYLECSRDKLFTYSSLDMILRRYVIRTRAHVP-LETPQEMFLGIALHLAMNETQDVKRF
RIR1_HELPY      KFDLEFLNSQIKPE--RDFQF-NYLGIKTLYDRYLLKDANNNPI-ELPQHMFMSIAMFLAQNEQEPNKEF
RIR1_HELPJ      KFDLEFLNSQIKPE--RDFQF-NYLGIKTLYDRYLLKDANNHPI-ELPQHMFMSIAMFLAQNEQELNKEF
RIR1_CHLTR      ---------------------------------------------------------------TSWAITF
RIR1_CHLMU      LFDLDALANAMDLSRDLQF---SYMGIQNLYDRYF--NHDDGRRLETPQIFWMRVAMGLALKEQDKAITF
RIR1_SYNY3      ------------------------------------------------------------------ARRF
RIR1_ENCCU      LEHGETIEGMIN--YENDFLF-SYFGILTLMKSYLIKVGEE--IIERPQDMFMRVALQIHKTDFEKVREV
RIR1_SCHPO      ------------------------------YNFFGFKTLERSKVAERPQHMIMRVAVGIHGEDIEAAIET
RIR1_CHLPN      DYDLDALSEVLDLSRDQQF---SYMGVQNLYDRYFLHEGRRLETAQIFWMRVSM-GLALNEGEQKNAITF
RIR1_DROME      ---------------------------------YLLKRNGK--IAERPQHMLMRVAIGIHGEDIDAAVET
RIR1_MOUSE      ---------------------------------YLLKINGK--VAERPQHMLMRVSVGIHKEDIDAAIET
RIR1_PLAF4      LHKDRLNKEI---DYTRDFNYDYF--GFKLERSYLLRINNK--IIERPQHLLMRVSIGIHIDDIDKALET
RIR1_CAEEL      ---------------------------------YLLKIN--KEIVERPQQMLMRVSIGIHGDDITSAIET
RIR1_MIMIV      -----------------------------------------KKIVERPQHLFMRVALHYRKNDLDRIFET
RIR1_HUMAN      ---------------------------------YLLKINGK--VAERPQHMLMRVSVGIHKEDIDAAIET
RIR3_YEAST      --------------YDRDFQYTYF--GFKLERSYLLRLNGE--VAERPQHLVMRVALGIHGSDIESVLKT
RIR1_PONAB      ---------------------------------YLLKINGK--VAERPQHMLMRVSVGIHKEDIDAAIET
RIR1_VARV       ------------------------------YNYFGFKTLEKSKIVERPQHMLMRVAVGIHQWDIDSAIET
RIR1_NEUCR      -------KDEFDSAYDRDFNYQYF--GFKLERSYLLKLDGQ--IAERPQHMIMRVAVGIWGDDVERVIET
RIR1_YEAST      --------------YDRDFQYSYF--GFKLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
RIR1_BUCAP      NYSFEEYVEMNSFVDHRRDMNFSYAAVKQLEAKYLLQNRVTGQIYESAQFLILISACLFSKYEKKVRMNY
RIR1_CRYPV      -----------KIDFSKDFEYDYF--AFKLERSYLLKIDNK--VVERPQHLLMRVSCGIHCGDIEAALET
RIR1_PLAFG      LHKVRLNKEI---DYTTHFNYDYF--GFKLERSYLLRINNK--IIERPQHLLMRVSIGIHIDDIDKALET
RIR1_VACCW      ------------------------------YNYFGFKTLEKSKIVERPQHMLMRVAVGIHQWDIDSAIET
RIR1_VACCC      ------------------------------YNYFGFKTLEKSKIVERPQHMLMRVAVGIHQWDIDSAIET
RIR1_VACCA      ------------------------------YNYFGFKTLEKSKIVERPQHMLMRVAVGIHQWDIDSAIET
RIR1_SALTY      DYTEEEFKQMDSFIVHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLDY
RIR1_OSHV1      ----------------------NYMGITGLLNGVAIKVN--KKLYERPQYVFMRVAMAMTDLSSETALED
RIR1_ARATH      --------------YDRDFEYDYF--GFKLERSYLLKVQGT--VVERPQHMLMRVAVGIHKDDIDSVIQT
RIR1_ECOLI      DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLILVAACLFSNYPRETRLQY
RIR1_DANRE      --------------YDRDFSY-NFFGFKTLERSYLLKINGK--VAERPQHMLMRVSVGIHKEDIAAAIET
RIR1_BPT4       KYSAEEITFLSKIKHERDMEF-TYSGAMQLKEKYLVKDKTTGQIYETPQFAFMTIGMALHQDEPVDRLKH
RIR1_TRYBB      ------------------------------------------EVVERPQQMFLRVALGIHGEDLERVKET
RIR1_DICDI      ------------------------------------------KIVERPQHMLMRVSIGIHGEDLESAINT
RIR1_BUCAI      NYSYKEFLQM--NSFIDHWRDMNFSYAAQLEGKYLIQNRVNGKIYESAQFLILISACLFSQYPKNVRMNY
RIR1_HAEIN      MDGFIDHWRDMTFSYA---------AVKQLEGKYLVQNRVTGEIYESAQFLYLLVASLFSKYPKETRLDY
RIR1_BUCBP      MNSFIKHRRDMNFSYA---------AVKQLEGKYLIQNRVTKKIYESAQFLILISACLFSKYPNETRMKY
RIR1_ASFP4      --------------YSRDYKL-SLLGIETMKNSYLLKNKDGV-IMERPQDAYMRVAIMYGMGKVVNIKMI
RIR1_ASFWA      -------------------------------NSYLLKNKDGV-IMERPQDAYMRVAIMYGMGKVVNIKMI
RIR1_ASFK5      -------------------------------NSYLLKNKDGV-IMERPQDAYMRVAIMYGMGRVVNMKMI
RIR1_ASFB7      -------------------------------NSYLLKNKDGV-IMERPQDAYMRVAIMYGMGKVVNIKMI
RIR1_HHV2H      ----------------------------------------------------------------EMFKFF
RIR1_HHV23      ----------------------------------------------------------------EMFKFF
RIR1_ASFM2      --------------YSRDYKL-SLLGIETMKNSYLLKNKDGV-IMERPQDAYMRVAIMIHGGRVVNMKMI
RIR1_HHV11      ----------------------------------------------------------------EMFKFF
RIR1_IIV3       -----------------------------------LKDSYMKEDESSPQERFAFIARQFCADDEPLAQRL
RIR1_EHV1B      -------------------------------------------------------------------KAY
NRDJ_STRAW      --------------------------------------------------------------------EL
RIR1_BHV1C      ---------------------------------------------------------------------Y
NRDJ_STRCL      --------------------------------------------------------------------EL
NRDJ_STRCO      --------------------------------------------------------------------EL
RIR1_VZVO       ---------------------------------------------------------------TDVCRVF
RIR1_VZVD       ---------------------------------------------------------------TDVCRVF
RIR1_EHV4       -------------------------------------------------------------------RAF
RIR1_SUHVK      ---------------------------------------------------------------------Y
NRDJ_BDEBA      ----------------------------------------------------------------------
RIR1_EBVB9      MH--RDELETRVSAFAQSPAYEGYLSALRYYDTYLVGRSGKQESVQHFYMRLSTTCLYAGESDMEVFDYY
RIR1_EBVA8      MH--RDELETRVSAFAQSPAYEGYLSALRYYDTYLVGRSGKQESVQHFYMRLSTTCLYAGESDMEVFDYY
RIR1_EBVG       MH--RDELETRVSAFAQSPAYEGYLSALRYYDTYLVGRSGKQESVQHFYMRLSTTCLYAGESDMEVFDYY
NRDJ_RHOBA      ----------------------------------------------------------------------
RIR1_SHV21      --------------------------------------------------------------DMQIFKYF
RIR1_IIV6       ----------------------------------------------------------------------
NRDJ_AGRT5      ----------------------------------------------------------------------
NRDJ_BRAJA      ----------------------------------------------------------------------
NRDJ_LEPIN      --------------------------------------------------------------DEESAKEI
NRDJ_LEPIC      --------------------------------------------------------------DEESAKEI
NRDJ_STRCT      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
RIR1_BACSU      VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
RIR1_MYCTU      VDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHG
RIR1_MYCBO      VDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHG
NRDEB_BPSPC     VHTMMKQEYQPATPTFLNAGRKRRGEMVSCFLLEVGDSLNDISRAIDISMQLSKLGGGVALNLNKLRAKG
NRDEB_BACSU     VHTMMKQEYQPATPTFLNAGRKRRGEMVSCFLLEVGDSLNDISRAIDISMQLSKLGGGVALNLNKLRAKG
RIR1_MYCLE      VDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVALLLSNIREHG
RIR3_SALTY      TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
RIR1_MYCPN      LKQIITNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLTNIRESG
RIR3_ECOLI      TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
RIR1_MYCGE      LKQIILNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLSNLREAG
RIR1_AQUAE      YDVLSEHKVTVATPTLMNA-RRPFTQLSSCFVLTVDDDLFDIFDNVKKAGMISKFAGGLGVYLGKIRATG
RIR1_TREPA      YTVLSKLQVTVATPTLSNA-RKPFHQLSSCFVDTVPDSLDGIYRSIDNFSQVSKFGGGMGLYFGKVRAVG
RIR1_HELPY      YEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIG
RIR1_HELPJ      YEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIG
RIR1_CHLTR      YNLLSTFRYTPATPTLFNSGM-RHSQLSSCYLSTVQDNLVNIYKVIADNAMLSKWAGGIGNDWTAIRATG
RIR1_CHLMU      YNLLSTFRYTPATPTLFNSGM-RHSQLSSCYLSTVQDDLVNIYKVISDNAMLSKWAGGIGNDWTAIRATG
RIR1_SYNY3      YESIAARRISLATPILANL-RVPGGSLTSCFIVAMEDNLESIFGEITNAARISKXXXXXXXXXSRIRATG
RIR1_ENCCU      YNLLSGHYFTHATPTLYNSCLKNP-QLASCFLITPRDSIEGVYHMINQAAIITKYSGGIGLNLHGIRSKG
RIR1_SCHPO      YNLMSQRYFTHASPTLFNAGTPRP-QLSSCFLVTMDDSIEGIYDTLKMCAMISKTAGGIGINIHNIRATG
RIR1_CHLPN      YNLLSTFRYTPATPTLFNSGM-RHSQLSSCYLSTVKDDLSHIYKVISDNALLSKWAGGIGNDWTDVRATG
RIR1_DROME      YNLLSERYFTHASPT-LFAAATNRPQLSSCFLLTMTDSIEGIFKSVEQCAMISKSAGGIGLNVHCIRAKG
RIR1_MOUSE      YNLLSEKWFTHAPPTLFNAGTNRP-QLSSCFLLSMDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATG
RIR1_PLAF4      YHLMSQKYFTHATPTLFNSGTPRP-QMSSCFLLSMKDSIEGIFETLKQCALISKTAGGIGVAVQDIRGQN
RIR1_CAEEL      YNLMSERYMTHASPTLFNSGTCRP-QMSSCFLLTMSDSILGIYDTLKQCALISKSAGGIGLNVHKIRATG
RIR1_MIMIV      YKYLSKGYFTHATPTLFNAGTTHE-QLSSCFLLGIGDSLEEISECWKECALISKHAGGIGIHMTNIRVEG
RIR1_HUMAN      YNLLSERWFTHASPTLFNAGTNRP-QLSSCFLLSMDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATG
RIR3_YEAST      YNLMSLRYFTHASPTLFNAGTPHP-QMSSCFLIAMDDSIEGIYDTLKECAMISKTAGGVGLHINNIRSTG
RIR1_PONAB      YNLLSERWFTHASPTLFNAGTNRP-QLSSCFLLSMDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATG
RIR1_VARV       YNLLSEKWFTHASPTLFNAGTSRH-QMSSCFLLNMDDSIEGIYDTLKRCALISKMAGGIGLSISNIRASG
RIR1_NEUCR      YNLMSLKTFTHASPTLFNAGTPQP-QLSSCFLVDMKDSIEGIYDTLKTCAMISKMAGGIGLNIHRIRATG
RIR1_YEAST      YNLMSLKYFTHASPTLFNAGTPKP-QMSSCFLVAMKDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
RIR1_BUCAP      IQRFYNSTFKISLPTPIMSGRTPTRQFSSCVLIECADNLNSINATTSAIVKYVSQRAGIGINAGQIRALG
RIR1_CRYPV      YELLSQKYFTHATPTLFNSGTPRP-QMSSCFLLRIEDSINGIFDTLTKCANISKTAGGLGVAVSNIRGTG
RIR1_PLAFG      YHLMSQKYFTHATPTLFNSGTPRP-QMSSCFLLSMKDSIEGIFETLKQCALISKTAGGIGVAVQDIRGQN
RIR1_VACCW      YNLLSEKWFTHASPTLFNAGTSRH-QMSSCFLLNIDDSIEGIYDTLKRCALISKMAGGIGLSISNIRAXX
RIR1_VACCC      YNLLSEKWFTHASPTLFNAGTSRH-QMSSCFLLNIDDSIEGIYDTLKRCALISKMAGGIGLSISNIRAXX
RIR1_VACCA      YNLLSEKWFTHASPTLFNAGTSRH-QMSSCFLLNIDDSIEGIYDTLKRCALISKMAGGIGLSISNIRAXX
RIR1_SALTY      VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
RIR1_OSHV1      IMLISGQCLSMASPVLFNGGTSS-SNTASCFLLDMGDNMVSITKKVAQTMTLIAKNGGIGINFSKLRATG
RIR1_ARATH      YHLMSQRWFTHASPTLFNAGTPRP-QLSSCFLVCMDDSIEGIYETLKECAVISKSAGGIGVSVHNIRATG
RIR1_ECOLI      VKRFYDSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
RIR1_DANRE      YNLLSEKWFTHASPTLFNAG-TNRPQLSSCFLLAMDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATG
RIR1_BPT4       VIRFYESTRQISLPTPIMAGRTPTRQFSSCVVIEAGDSLKSINKASASIVEYISKRAGIGINVGMIRAEG
RIR1_TRYBB      YDYMSQGFFTHATPTLFNAGTPFP-QMSSCFLVAMRDSIDGIYDTLKQCXXXXXXXXXXXXHMHNIRAAG
RIR1_DICDI      YKRLSEKLFTHATPTLFNAGTPSP-QMSSCFLVQMKDSIDGIYDTLKQCALISKSAGGIGIAVHKIRAAQ
RIR1_BUCAI      IHRFYNSTFKISLPTPIMSGRTPTRQFSSCVLIECGDSLNSINATTSSIVKYVSQRAGIGVNAGQIRALG
RIR1_HAEIN      VKRFYDSTFKISLPTPIMAGRTPTRQFSSCVLIECDDSLDSINATASAIVKYVSQRXXXXXXXXXXRALG
RIR1_BUCBP      IKNFYDSTFKISLPTPIMAGRTPTRQFSSCVLIESEDNLNSINATTSAIVKYVSQRAGIGINAGRIRALG
RIR1_ASFP4      LDLLSRHIITHASPTMFNAGTKKP-QLSSCFLLNVNDNLENLYDMVKTAXXXXXXXXXXXXXXXXXRAKN
RIR1_ASFWA      LDLLSQHIITHASPTMFNAGTKKP-QLSSCFLLNVNDNLENLYDMVKTAXXXXXXXXXXXXXXXXXRAKN
RIR1_ASFK5      LDLLSRHVITHASPTMFNAGTKKP-QLSSCFLLNVNDNLENLYDMVKTAXXXXXXXXXXXXXXXXXRAKN
RIR1_ASFB7      LDLLSRHVITHASPTMFNAGTKKP-QLSSCFLLNVNDNLENLYDMVKTAXXXXXXXXXXXXXXXXXRAKN
RIR1_HHV2H      FHRLYDHQIVPSTPAMLNLGT-RNYYTSSCYLVNPQATTNQATRAINVSAILAR-NGGIGLCM-------
RIR1_HHV23      FHRLYDHQIVPSTPAMLNLGT-RNYYTSSCYLVNPQATTNQATRAINVSAILAR-NGGIGLCM-------
RIR1_ASFM2      LDLLSRHVITHASPTMFNAGTKKP-QLSSCFLLNVNDNLENLYDMVKTAXXXXXXXXXXXXXXXXXRAKN
RIR1_HHV11      FHRLYDHQIVPSTPAMLNLGT-RNYYTSSCYLVNPQATTNKATRAINVSAILAR-NGGIGLCV-------
RIR1_IIV3       YDYMSQHWLSPSSPQ-LSFGRTKQGLPIACFLPYLHDTARGL---IDTWAEVSELSMXXXXXXXXXXXRQ
RIR1_EHV1B      FTALAGQVLIPATPIMLFGGRDC-GSLASCYLL--NPRVTDMNSAMLALMEILCNRGGIGLSLQRFNTPP
NRDJ_STRAW      AYALLHQIFSFNSPVWFNVGTPQPQQVSACFILAVDDSMESILDWYKEEGMIFKGGSGAGLNLSRIRSSK
RIR1_BHV1C      LTALYRQLVVPATPIMLFAGRAR-GSLASCYLL--NPQVSSSTEAVEITTEVARIRGGIGISFQSFRAVS
NRDJ_STRCL      AYALLHQIFSFNSPVWFNVGTPQPQQVSACFILSVDDSMESILDWYKEEGMIFKGGSGAGLNLSRIRSSK
NRDJ_STRCO      AYALLHQIFSFNSPVWFNVGTPQPQQVSACFILSVDDSMESILDWYKEEGMIFKGGSGAGLNLSRIRSSK
RIR1_VZVO       FTALACQKIVPATPVMMFLGRET-GATASCYLMDPESTVGRAVRAIDVGTVLQSRGG-VGISLQSLN---
RIR1_VZVD       FTALACQKIVPATPVMMFLGRET-GATASCYLMDPESTVGRAVRAIDVGTVLQSRGG-VGISLQSLN---
RIR1_EHV4       FTALAGQVVIPATPIMLFGGRDC-GSMASCYLL--NPRVTDMNSAIPALME--EVGGGIGLSLQRFNTP-
RIR1_SUHVK      FRALATQAIVPATPLMLFAGRAR-GSLASCYLLNLPRTTEEAVRAIEVAPILLRRGGGLSLQSFNRTPSG
NRDJ_BDEBA      -----------------------RPQCSACFIQSVDDSIESIFDLAKTEAKLFKYGSGTGSNFSKIRSKY
RIR1_EBVB9      FEHLTSQTVCCSTP-FMRFAGVENSTLASCIL-----TTPDLSSEWDVTQALYRLGRYLFQRXXXXXXXX
RIR1_EBVA8      FEHLTSQTVCCSTP-FMRFAGVENSTLASCIL-----TTPDLSSEWDVTQALYRLGRYLFQRXXXXXXXX
RIR1_EBVG       FEHLTSQTVCCSTP-FMRFAGVENSTLASCIL-----TTPDLSSEWDVTQALYRLGRYLFQRXXXXXXXX
NRDJ_RHOBA      ----------------------------ACFIQSVDDNMEDIMRLACSEAMLFKFGSGTGTDLSTIRSQR
RIR1_SHV21      YKVISSQLVCCATPVMRSAGVAGEN-LSSCFIIALDTEKSTISSIFGELAPLLASRSGVGVDVTKFSFGG
RIR1_IIV6       -----------STP-ILSFGKANHGLPISCYLSWIEDTKEGLIDTLSEVNQLSMLXXXXXXXXX------
NRDJ_AGRT5      ----------------------------------------------------------------------
NRDJ_BRAJA      ----------------------------------------------------------------------
NRDJ_LEPIN      VYMLATQMAAPNSPQWFNTGLNSTGKLVACFIQSVDDDLVNEGGIMDLEARLFKYGSGTGTNFSNLRGEN
NRDJ_LEPIC      VYMLATQMAAPNSPQWFNTGLNSTGKLVACFIQSVDDDLVNEGGIMDLEARLFKYGSGTGTNFSNLRGEN
NRDJ_STRCT      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
RIR1_BACSU      EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
RIR1_MYCTU      APIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSL
RIR1_MYCBO      APIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSL
NRDEB_BPSPC     EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAVYLSVFHPDITDFLDTKKISADEDVRVKTLSI
NRDEB_BACSU     EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAVYLSVFHPDITDFLDTKKISADEDVRVKTLSI
RIR1_MYCLE      APIKNIEHQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSL
RIR3_SALTY      APIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
RIR1_MYCPN      APIKKIENQSSGIIPIMKLLEDSFSYANQLGQRQGAGAVYLHAHHPDVMQFLDTKRENADEKIRIKSLSL
RIR3_ECOLI      APIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
RIR1_MYCGE      APIKKIENQSSGIIPIMKLLEDSFSYSNQLGQRQGAGAVYLHCHHPDVMQFLDTKRENADEKIRIKSLSL
RIR1_AQUAE      APIRKFKGASSGVIPVVKLINDTMTYVDQLGMRKGSASITLDIWHKDILDFLEVKTNVGDERKKAHDIHP
RIR1_TREPA      APIRGFQGAAGGILRWIKLANDTAVAVDQLGVRQGSVAVYLDVWHKDIPEFLQLRTNNGDDRMKAHDVFP
RIR1_HELPY      SYIDGHKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFP
RIR1_HELPJ      SYIDGHKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFP
RIR1_CHLTR      ALIKGTNGRSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDERRRAHDVNI
RIR1_CHLMU      ALIKGTNGKSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDDRRRAHDVNT
RIR1_SYNY3      SWVMGKPNASGGVIPWTKLLNDTAIAVNQGGRRAGAVTVGLDVWHLDVPEFLEMQAENGDQRRKAYDIFP
RIR1_ENCCU      SSLRSTGGRSNGIIPLIQVLNATKRYINQGAERRGSIAIFLEPWHMEIFDFLELRKNTGPEEFRARDIFT
RIR1_SCHPO      SYIAGTNGTSNGIVPMIRVYNNTARYVDQGGKRPGAFAAYLEPWHADVMDFLELRKTHGNEDFRAREMFY
RIR1_CHLPN      AVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAMCVYLENWHLDYEDFLELRKNTGDERRRTHDINT
RIR1_DROME      TSICGTNGTSNGLVPMLRVFNNVARYVDQGGKRPGAFAIYLEPWHSDVFEFLELKKNTGKEENRARDLFY
RIR1_MOUSE      SYIAGTNGNSNGLVPMLRVYNNTARYVDQGGKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFF
RIR1_PLAF4      SYIRGTNGISNGLVPMLRVFNDTARYVDQGGKRKGSFAVYIEPWHSDIFEFLDLRKNHGKEELRARDLFY
RIR1_CAEEL      SVIAGTNGTSNGLIPMLRVYNNTARYVDQGGKRPGAFAIYLEPWHADIFEFVSLRKNTGPEEERARDLFL
RIR1_MIMIV      AYIASTQGEAGGL-RVLTIFNDISRYANQGGKRPGSFAIFIEPWHGDIFFFLDLKKNTGAETERARDLFL
RIR1_HUMAN      SYIAGTNGNSNGLVPMLRVYNNTARYVDQGGKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFF
RIR3_YEAST      SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALFLEPWHADIFDFVDIRKTHGKEEIRARDLFP
RIR1_PONAB      SYIAGTNGNSNGLVPMLRVYNNTARYVDQGGKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFF
RIR1_VARV       SYISGTNGASNGIIPMLRVYNNTARYIDQGGKRPGVMTIYLEPWHSDIMAFLDLKKNTGNEEHRTRDLFI
RIR1_NEUCR      SYIAGTNGTSNGIVPMLRVFNNTARYVDQGGKRPGAFAIYLEPWHADVFEFLDLRKNHGKEEVRARDLFL
RIR1_YEAST      SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
RIR1_BUCAP      SPIRNGEAFHTGCIPFYKHFQSAVKSCSQGGVRGGAATVFYPIWHLEIESLLVLKNNRGIEENRVRHLDY
RIR1_CRYPV      SYIRGTNGRSNGLIPMLRVYNDTARYIDQGGKRKGAIAIYLEPWHVDVVEFIEIRKNHGKEEMRCRDLFP
RIR1_PLAFG      SYIRGTNGISNGLVPMLRVFNDTARYVDQGGKRKGSYAVYIEPWHSDIFEFLDLRKNHGKEELRARDLFY
RIR1_VACCW      XXXXXXXXXXXXXXPMLRVYNNTARYIDQGGKRPGVMAIYLEPWHSDIMAFLDLKKNTGNEEHRTRDLFI
RIR1_VACCC      XXXXXXXXXXXXXXPMLRVYNNTARYIDQGGKRPGVMAIYLEPWHSDIMAFLDLKKNTGNEEHRTRDLFI
RIR1_VACCA      XXXXXXXXXXXXXXPMLRVYNNTARYIDQGGKRPGVMAIYLEPWHSDIMAFLDLKKNTGNEEHRTRDLFI
RIR1_SALTY      SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
RIR1_OSHV1      SKI-GMAGKSSGIGGKLNLFDRVAQSVDQENKRPGAIAGYLTDWHADMYDWLYSRYSGSGNEVNKRVLNM
RIR1_ARATH      SYIRGTNGTSNGIVPMLRVFNDTARYVDQGGKRKGAFAVYLEPWHADVYEFLELRKNHGKEEHRARDLFY
RIR1_ECOLI      SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
RIR1_DANRE      RYIAGTNGNSNGLVPMLRVNNNTARYVDQGGKRPGAFAMYLEPWHFDIFDFLELKKNTGKEEQRARDLFY
RIR1_BPT4       SKIGMGEVRHTGVIPFWKHFQTAVKSCSQGGIRGGAATAYYPIWHXXXXXXXXXXXXXXXXENRIRHMDY
RIR1_TRYBB      SYIAGTNGTSNGLVPMLRVWNNTARYVDQGGKRKGAFAIYLEPWHADIFGFLLLKKNTGKEDQRARDLFY
RIR1_DICDI      SYIRGTNGTSNGLVPMLRVFNDTARYVDQGGKRKGAFAVYLEPWHADVFEFIDLKKNTGKEEMRARDLFY
RIR1_BUCAI      SPIRNGEAFHTGCIPFYKHFQSAVKSCSQGGVRGGAATIFYPIWHLEVESLLVLKNNRGIEENRVRHIDY
RIR1_HAEIN      SEIRGGEAFHTGCIPFYKYFQTAVKSCSQGGVRGGAATLYYPIWHLEAENLLVLKNNRGVEDNRVRHMDY
RIR1_BUCBP      SPIRNGDTLHTGCIPFYKHFQSAVKSCSQGGVRGGAATIFYPIWHFEIESLLVLKNNRGIEENRVRHMDY
RIR1_ASFP4      SFISGSGLRSNGIQNYIMLQNASQCYANQGGLRPGAYAVYLELWHQDIFTFLEMPRLKAEQRLNAPNLKY
RIR1_ASFWA      SFISGSGLRSNGIQNYIMLQNASQCYANQGGLRPGAYAVYLELWHQDIFTFLEMPRLKAEQRLNAPNLKY
RIR1_ASFK5      SFISGSGLRSNGIQNYIVLQNASQCYANQGGLRPGAYAVYLELWHQDIFTFLQMPRLKAEQRLNAPNLKY
RIR1_ASFB7      SFISGSGLRSNGIQNYIMLQNASQCYANQGGLRPGAYAVYLELWHQDIFTFLQMPRLKAEQRLNAPNLKY
RIR1_HHV2H      QAFNDASPGTASIMPALKVLDSLVAAHNKQSTRPTGACVYLEPWHSDVRAVLRMKGVLAGEEARCDNIFS
RIR1_HHV23      QAFNDASPGTASIMPALKVLDSLVAAHNKQSTRPTGACVYLEPWHSDVRAVLRMKGVLAGEEARCDNIFS
RIR1_ASFM2      SFISGSGLRSNGIQNYIVLQNASQCYANQGGLRPGAYAVYLELWHQDIFTFLQMPRLKAEQRLNAPNLKY
RIR1_HHV11      QAFNDSGPGTASVMPALKVLDSLVAAHNKESARPTGACVYLEPWHTDVRAVLRMKGVLAGEEARCDNIFS
RIR1_IIV3       PDEKSV-----GIIPHLRTYDASCTAYKQGQTRRGSYAAYLDISHPEILSFLNTRRVGGDHNYKLLNLHN
RIR1_EHV1B      K-----EGCSRGVMALLKLIDSMTMAINSDGERPTGVCVYFEPWHADIRAILNMRMLARDETVRCDNIFA
NRDJ_STRAW      ELLSSGGNAS-GPVSFMRGADASAGTIKSGGARRAAKMVILDVDHPDIEDFIETK---VKEEEKIRALRD
RIR1_BHV1C      RDCK------RGIMGALKLLDSMAMAINSDSERPTGICVYLEPWHCDVRAVLNMRGLLADESTRCDNLFS
NRDJ_STRCL      ELLSSGGNAS-GPVSFMRGADASAGTIKSGGARRAAKMVILDVDHPDIEGFIETK---VKEEEKIRALRD
NRDJ_STRCO      ELLSSGGNAS-GPVSFMRGADASAGTIKSGGARRAAKMVILDVDHPDIEDFIQTK---VKEEEKIRALRD
RIR1_VZVO       --LIPTENQTKGLLAVLKLLDCMVMAINSDCERPTGVCVYIEPWHVDLQTVLATRMLVRDEIFRCDNIFC
RIR1_VZVD       --LIPTENQTKGLLAVLKLLDCMVMAINSDCERPTGVCVYIEPWHVDLQTVLATRMLVRDEIFRCDNIFC
RIR1_EHV4       ----PTEGCSRGVMALLKLLDSMTMAINSDGERPTGVCVYFEPWHADIRAILNMRMLARDETVRCDNIFA
RIR1_SUHVK      DC-------TRGIMAVLKALDSMTAAINSDSERPTGVCVYVEPWHADVRAVLNMRMLAADESLRCDNIFS
NRDJ_BDEBA      EATGS-GGKSSGLISFLEVLDKGAGAIKSGGTRRAAKMVVVDIDHPEVLDFIDWKMLSADEGEAYRTVSN
RIR1_EBVB9      XXXQD----GKHISLLMRMINSHVEYHNYGCKRPVSVAAYMEPWHSQIFKFLETKLPENHE--RCPGIFT
RIR1_EBVA8      XXXQD----GKHISLLMRMINSHVEYHNYGCKRPVSVAAYMEPWHSQIFKFLETKLPENHE--RCPGIFT
RIR1_EBVG       XXXQD----GKHISLLMRMINSHVEYHNYGCKRPVSVAAYMEPWHSQIFKFLETKLPENHE--RCPGIFT
NRDJ_RHOBA      EKXXXXXXXXXXXX-FMRVYDSIAGVVKSGGKRRAAKMQSLKVWHPDILEFIECKWA---EEKKAHAL--
RIR1_SHV21      ----------KNIHSCLKLINAQVEFFNDKSVRPVSVATYIEVWHCQIHEFLSAK--LPENPDRCNSIFQ
RIR1_IIV6       --IRTSDNKSTGVMSHLNTYDACSLAYKQDGVRRGSYAMYLNNNHPDVLQFIEMRKPTGDHNIRCLNLHH
NRDJ_AGRT5      ----------------------------------------------------------------------
NRDJ_BRAJA      ----------------------------------------------------------------------
NRDJ_LEPIN      EPXXXXXXXXXXXXXX-KIGDRAAGAIKSGGTRRAAKMVCLDVDHPDIENFIDWK---VTEEKKVASLVT
NRDJ_LEPIC      EPXXXXXXXXXXXXXX-KIGDRAAGAIKSGGTRRAAKMVCLDVDHPDIENFIDWK---VTEEKKVASLVT
NRDJ_STRCT      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
RIR1_BACSU      GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
RIR1_MYCTU      GVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQ
RIR1_MYCBO      GVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQ
NRDEB_BPSPC     GVVVPDKFIELAREDKDYYMFYPHSVYKEYGQYLDELDINEMYDELVENPRVRKAKGNARKLLEQLAILR
NRDEB_BACSU     GVVVPDKFIELAREDKDYYMFYPHSVYKEYGQYLDELDINEMYDELVENPRVRKAKGNARKLLEQLAILR
RIR1_MYCLE      GVIIPDITFELAKRNEDMYLFSSYDVERVYEVPFADISVTEKYYEMLDDARIRKTKIKAREFFQKLAELQ
RIR3_SALTY      GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
RIR1_MYCPN      GLVIPDITFTLAKNNEEMALFSPYDVYEEYGKPLSDISVTEMYYELLANQRIKKTFINARKFFQTVAELH
RIR3_ECOLI      GVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQ
RIR1_MYCGE      GLVIPDITFQLAKNNEMMALFSPYDIYQEYGKALSDISVTEMYYELLENQRIKKTFISARKFFQTIAELH
RIR1_AQUAE      AVSIPDLFMKRLKNREDWTLIDPYWAYKEVGSHLEPKGLEDFYGXXXXXPSYAKKKVNSFELWKRLLTVA
RIR1_TREPA      AVCYPDLFWKTVRDNLGAYLMCPHEILTVKGYALEDFYAEEWEKRYVKDARISKRTIPIKELVRLVLKSV
RIR1_HELPY      ALWVCDLFLKRVLEDAMWTLFDPYDLTELYGQ-----DFEKRYLEYEKDPKIIKEYINAKDLWKKILMNY
RIR1_HELPJ      ALWVCDLFMKRVLEDAMWTLFDPYDLTELYGQ-----DFEKRYLEYEKDPKIIKEYINAKDLWKKILMNY
RIR1_CHLTR      ASWIPDLFFKRLQQKGTWTLFSPDDVHDAYGXXXXXXXXXXXXK--VDTGEIRLKKVEAEDLWRKMLSML
RIR1_CHLMU      ASWIPDLFFKRLQQKGSWTLFSPDDVHDAYGXXXXXXXXXXXXK--VDSGEIRYKKVEAEDLWRKMLSML
RIR1_SYNY3      QLILPDEFMRRVINKEDWTLVDPYEVREKMGIELAELWGEQFEGAYLDTTITLYKRINARELFKQIMRTQ
RIR1_ENCCU      ALWINDLFMERVKNNEEWSLFCPSQLSDVWGE-----EFNALYCKY--EKTISRTVVPAQKLWKAIIEAQ
RIR1_SCHPO      ALWIPDLFMQRVERNEQWTFFCPNEAPGLADVWGDE--FVALYEKYEKENRGRR-SLPAQKVWYAILQSQ
RIR1_CHLPN      ASWIPDLFFKRLEKKGMWTLFSPDDVHEAYGLEFEK--LYEEYERKVESGEIRYKKVEAEVLWRKMLSML
RIR1_DROME      ALWIPDLFMKRVEANGDWSLMCPHKCPGLHDVWGDEFE--KLYEKYEQEGRANR-TVKAQSLWFAIIEAQ
RIR1_MOUSE      ALWIPDLFMKRVETNQDWSLMCPNEC-----PGLDEVEFEKLYESYEKQGRVRK-VVKAQQLWYAIIESQ
RIR1_PLAF4      AVWVPDLFMKRVKENKNWTLMCPNELSETWGE-----EFEKLYTKY-EEENMGKKTVLAQDLWFAILQSQ
RIR1_CAEEL      ALWIPDLFMKRVEKDQEWSLMCPCEC-----PGLDDCEFEALYAKYEAEGRVRK-TVKARKLWEHIVSNQ
RIR1_MIMIV      GLMINDIFMERVYKDDVWSLMCPSQCPNLLNKYGDE--FTKEYLKY-ESEGIYLKQIRAIDLWFKIMESQ
RIR1_HUMAN      ALWIPDLFMKRVETNQDWSLMCPNEC-----PGLDEVEFEKLYASYEKQGRVRK-VVKAQQLWYAIIESQ
RIR3_YEAST      ALWIPDLFMKRVQEDGPWTLFSPSAAPGLDDVWGDEFE--ELYTRYEREGRGKT--IKAQKLWYAILQAQ
RIR1_PONAB      ALWIPDLFMKRVETNQDWSLMCPNEC-----PGLDEVEFEKLYASYEKQGRVRK-VVKAQQLWYAIIESQ
RIR1_VARV       ALWIPDLFMKRVKDDGEWSLMCPDECPGLDNVWGDEFE--RLYTLYEREKRY-KSIIKARVVWKAIIESQ
RIR1_NEUCR      ALWIPDLFMKRVEQNGQWTLMCPHECPGLADVYGDEF---EALXXXXXXXXXXRKTVKAQKLWYAILEAQ
RIR1_YEAST      ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFEA--LYTRYEKEGRGKT--IKAQKLWYSILEAQ
RIR1_BUCAP      AVQINKLMYQRMLLGQKITLFSPSDVPKLYEFFFDQXXXXXXXXXXXXNRNIRKKSINAIDLFCLIMRER
RIR1_CRYPV      ALWVPDLFMERVEKDQDWTLMCPRGLQDVWGD-----DFKKLYEEYEKQGRGRK-TMKAQKLWFLILQAQ
RIR1_PLAFG      AVWVPDLFMKRVKENKNWTLMCPNELSETWGE-----EFEKLYTKY-EEENMGKKTVLAQDLWFAILQSQ
RIR1_VACCW      ALWIPDLFMKRVKDDGEWSLMCP-----DECPGLDNVDXXXXXXXXXXXXXXXKSIIKARVVWKAIIESQ
RIR1_VACCC      ALWIPDLFMKRVKDDGEWSLMCP-----DECPGLDNVDXXXXXXXXXXXXXXXKSIIKARVVWKAIIESQ
RIR1_VACCA      ALWIPDLFMKRVKDDGEWSLMCP-----DECPGLDNVDXXXXXXXXXXXXXXXKSIIKARVVWKAIIESQ
RIR1_SALTY      GVQINKLMYTRLLKGGDITLFSPSDVPGLYDAFFDQDEFERLYVKYEHDDSIRKQRVKAVELFSLMMQER
RIR1_OSHV1      GLVMSDLFMERVENDKEWSLFSPN----------DVVGLEELYEKFVRNPKIKRTTVSARKLFSDIANMM
RIR1_ARATH      ALWLPDLFMERVQNNGQWSLFCPNELADCWG-----AEFETLYTKYEREGKAKK-VVQAQQLWYEILTSQ
RIR1_ECOLI      GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
RIR1_DANRE      ALWIPDLFMKRVETNGDWSLMCPNDC-----PGLDECEFEKLYAKYEQEGRAKR-VVKAQQLWYAIIESQ
RIR1_BPT4       GVQLNDLMMERFGKNDYITLFSPHEMGGEYSYFKDQDRFRELYEAAEKDPNIRKKRIKARELFELLMTER
RIR1_TRYBB      GLWIPDLFMERVESHGTWTLMDPNTLSDCYGQEFTDLXXXXXXXXXX------VRTIQAQELWFLILESQ
RIR1_DICDI      ALWVSDIFMERVEQNGDWALFCPNEAPGLAETHSEE--HRALYLKYEATPDLPRRVIKAQELWFAIMESQ
RIR1_BUCAI      AIQINKLMYQRMLSGDQITLFSPSDVYKAF--FSDQKKFKKIYLQYEKNKNIRKKTIKALDLFSLMMQER
RIR1_HAEIN      GVQLNKLMYQRLIKGSEITLFSPSDVPGLYEAFFADQDFEELYVKYEQDPTIRKRTVKAVEIFSLLMQER
RIR1_BUCBP      SVQLNKLMYQRLILGEHITLFSPSDVPNLYDSFFNNQEKFELYIKYENDKTIRKKKVKASYLFSLMMQER
RIR1_ASFP4      GLWVPDLFMEILRGDGRWYLFSPHKVFDERSQHENHREFKKLYYQYVAEKRYTGVT-TAKEIIKAWFKTV
RIR1_ASFWA      GLWVPDLFMEILRGDGRWYLFSPHKVFDERSQHENHREFKKLYYQYVAEKRYTGVT-TAKEIIKAWFKTV
RIR1_ASFK5      GLWVPDLFMEILRGDGTWYLFSPHKVFDERSRHKNHREFRKLYYQYVAEKRYTGVT-TAKEIIKEWFKTV
RIR1_ASFB7      GLWVPDLFMEILRGDGTWYLFSPHKVFDERSQHENHREFKKLYYQYVAEKRYTGVT-TAKEIIKEWFKTV
RIR1_HHV2H      ALWMPDLFFKLDGEKNVTWSLFDRDTSMSLADFHGE-EFEKLYEHL--EAMGFGETIPIQDLAYAIVRSA
RIR1_HHV23      ALWMPDLFFKLDGEKNVTWSLFDRDTSMSLADFHGE-EFEKLYEHL--EAMGFGETIPIQDLAYAIVRSA
RIR1_ASFM2      GLWVPDLFMEILRGDGTWYLFSPHKVFDERSQHENHREFKKLYYQYVAEKRY-TGVTTAKEIIKEWFKTV
RIR1_HHV11      ALWMPDLFFKRLIRHLDGEKNVTWTLF-DRDTSMSLADFHEEFEKLYQHLEVMGEQIPIQELAYGIVRSA
RIR1_IIV3       GVNVPDSFMKLAPFVKMDPCPTTETLFKKFAALAEQLDVVNRWDLIDPHTGKVKETIKATELWERIILTR
RIR1_EHV1B      CMWTPDLFFDRYQRYLDGESGVMWTLFDDTASHLCHMEFEEEYER-LEQCGFGVDSIPIQDMAFIIVRSA
NRDJ_STRAW      AGFDMD----LGGDDITSV---------QYQNANNSVRVNDTFMKAVEESRMTGEEVDAKSLFRKMAEAA
RIR1_BHV1C      CLWVPDLLFDLAHLEGREGVVW--TLFDDRASHLSRLHGPAFTAEY---ERLEREGLGVETVVQDLAFLI
NRDJ_STRCL      AGFDMD----LGGDDITSV---------QYQNANNSVRVNDEFMRAVESGRARMEQVDAKALFRKMAQAA
NRDJ_STRCO      AGFDMD----LGGDDITSV---------QYQNANNSVRVNDTFMKAVQDSRMTGEEVDAKALFRKMAEAA
RIR1_VZVO       CLWTPDLFFERYLSYLKGASNVQWTLFDNRADILRTLHGEAFTSTYL---RLEREGLGVSSVIQDIAIIR
RIR1_VZVD       CLWTPDLFFERYLSYLKGASNVQWTLFDNRADILRTLHGEAFTSTYL---RLEREGLGVSSVIQDIAIIR
RIR1_EHV4       CMWTPDLFFDRYQRYVDGESGIMWTLFDDTASHLCHMDFTREYER-LERCGFGIDAIPIQDMAFIIVRSA
RIR1_SUHVK      CLWTPDLFFQRYQRHLDGERAVKWTLFDDRASHLASLDFAREYER-LERLGLGVESLPIQDMAFLIVRSA
NRDJ_BDEBA      SVRVSDAFMKAVEQERPWKLKARLT-----GKVLREIPAGEVWNR-----------------ITRAAWMC
RIR1_EBVB9      GLFVPELFFKLFRDTPWSYLFDPKDLERLYGEEFERE-----YYRLVTAGKFCG-RVSIKSLMFSIVNCA
RIR1_EBVA8      GLFVPELFFKLFRDTPWSYLFDPKDLERLYGEEFERE-----YYRLVTAGKFCG-RVSIKSLMFSIVNCA
RIR1_EBVG       GLFVPELFFKLFRDTPWSYLFDPKDLERLYGEEFERE-----YYRLVTAGKFCG-RVSIKSLMFSIVNCA
NRDJ_RHOBA      ---IREGYDSNFNGEAYASVCFQNASVRLTDDYMEAVRKNENFQTITDKPTTEPPSYVAKELLNKMAECA
RIR1_SHV21      GVCVPSLFFKMYESDPNGYLFDPQNLTRLYG-----LEFEEEYLRLVSEKKY-KQSVTLKSLMFSLINTI
RIR1_IIV6       GLNISDEFMELIEK-------------CDGGGNIDDT------WNLIDPHTKKITTVGARDLWQRILETR
NRDJ_AGRT5      --------------------------------------------------------LKARDLWEKISHAA
NRDJ_BRAJA      ------------------------------------------------NARTSKKTLKARDLWEKIGYAA
NRDJ_LEPIN      GVLIPDNYIDLARQGYKEILFEELTTDWQSDAYNTVSGQNSLTNEFMDQPRTEKEKLRARELWEKISYAA
NRDJ_LEPIC      GVLIPDNYIDLARQGYKEILFEELTTDWQSDAYNTVSGQNSLTNEFMDQPRTEKEKLRARELWEKISYAA
NRDJ_STRCT      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
RIR1_BACSU      SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
RIR1_MYCTU      FESGYPYIMFEDTVNR--ANPIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTM
RIR1_MYCBO      FESGYPYIMFEDTVNR--ANPIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTM
NRDEB_BPSPC     SESGYPYIMFADNVNKVHPNEHISKVKFSNLC--------------------------------------
NRDEB_BACSU     SESGYPYIMFADNVNKVHPNEHISKVKFSNLC--------------------------------------
RIR1_MYCLE      FESGYPYVMFEDTVNR--ANPIEGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTM
RIR3_SALTY      FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
RIR1_MYCPN      FESGYPYILFDDTVNR--RNAHPNRIVMSNLCSEIVQPSTPSEFHHDLAFKKVGNDISCNLGSLNIAKAM
RIR3_ECOLI      FESGYPYIMYEDTVNR--ANPIAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSLNIAHTM
RIR1_MYCGE      FESGYPYILFDDTVNR--RNAHKNRIVMSNLCSEIVQPSLPSEFYSDLTFKKVGSDISCNLGSLNIARAM
RIR1_AQUAE      FETGEPYIFFRDEANRKNPNKHTGMVYSSNLCHEIVQTMSPSKHEKPVLDPETG-EITCNLGSVNLGKVH
RIR1_TREPA      VETGTPFAFYRDHANRANPNGHRGIIYCSNLCTEIAQNMSAINITEVDGQKVVGDFVVCNLASLVLSNIS
RIR1_HELPY      FEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYIEFFEEKELGQTAVCNLASINLSKIN
RIR1_HELPJ      FEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYIEFFEEKELGQTAVCNLASINLSKIN
RIR1_CHLTR      FETGHPWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNC---------SETETAV---CNLGSINLVDGL
RIR1_CHLMU      FETGHPWMTFKDPSNIRSAQDHTGVVRCSNLCTEILLNC---------SETETAV---CNLGSVNLVDGL
RIR1_SYNY3      VETGMPYLSFKDTINKANPNKHLGYIPGTNLCCE--SFSNVTPGQDAH---------CCNLVSLNLAN-L
RIR1_ENCCU      IETGTPYMCYKDACNRLSNQQHLGTIKSSNLCAEIVEYSS-------GEETSV-----CNLASICLPMFV
RIR1_SCHPO      VETGNPFMLYKDSCNRKSNQKNVGTIRCSNLCTEIV---------EYSSPDEVAV---CNLASVALPTFI
RIR1_CHLPN      YETGHPWITFKDPSNIRSNQDHVGVVRCSNLCTEILLNC---------SESETAV---CNLGSINLVDKL
RIR1_DROME      VETGNPYMLFKDACNRKSNQQNVGTIKCSNLCTEIV---------EYSAPDEIAV---CNLASLNMFKTY
RIR1_MOUSE      TETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIV---------EYTSKDEVAV---CNLASLNMYVTP
RIR1_PLAF4      IETGVPYMLYKDSCNAKSNQKNLGTIKCSNLCCEII---------EYTSPDEVAV---CNLASIALCKFV
RIR1_CAEEL      IETGLPYITYKDAANRKSNQQNLGTIKCSNLCTEII---------EYSAPDEIAV---CNLASIALNRYV
RIR1_MIMIV      IETGVPYVMFKDAINDKSNQINIGVVNGSNLCCEIVEVSDKNNFS------------VCNLSSIKIIDEV
RIR1_HUMAN      TETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIV---------EYTSKDEVAV---CNLASLNMYVTS
RIR3_YEAST      TETGTPFMVYKDACNRKTNQQNLGTIKSSNLCCEIVE---------YSSPDETAV---CNLASIALPAFV
RIR1_PONAB      TETGTPYMLYKDSCNRKSNQQNLGTIKCSSLCTEIV---------EYTSKDEVAV---CNLASLNMYVTS
RIR1_VARV       IETGTPFILYKDACNKKSNQQNLGTIKCSNLCTEIIQ---------YADANEVAV---CNLASLNMFVIF
RIR1_NEUCR      TETGNPFMLYKDACNRKSNQKNLGTIRSSNLCTEII---------EYSAPDEVAV---CNLASLALSAFI
RIR1_YEAST      TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE---------YSAPDETAV---CNLASVALPAFI
RIR1_BUCAP      ASTGRIYIQHVDHCNSHSANSKLATIRQSNLCLEITLPTKPLNNID-DKNGEIAL---CTLSALNLGLIN
RIR1_CRYPV      IETGTPFICYKDAANSKSNQKNLGTIVSSNLCTEII---------EYTSTDEVAV---CNLASIGLPKFV
RIR1_PLAFG      IETGVPIYLYKDSCNAKPIKN-LGTIKCSNLCCEII---------EYTSPDEVAV---CNLASIALCKFV
RIR1_VACCW      IETGTPFILYKDACNKKSNQQNLGTIKCSNLCTEIIQ---------YADANEVAV---CNLASLNMFVIF
RIR1_VACCC      IETGTPFILYKDACNKKSNQQNLGTIKCSNLCTEIIQ---------YADANEVAV---CNLASLNMFVIF
RIR1_VACCA      IETGTPFILYKDACNKKSNQQNLGTIKCSNLCTEIIQ---------YADANEVAV---CNLASLNMFVIF
RIR1_SALTY      ASTGRIYIQ-----NVDHCNTHVAPVRQSNLCLEIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIK
RIR1_OSHV1      WSTGEPYILFKDAVNERSNHKHLGTIKNSNLCCEIVQYCDVSNFVNVEEIDFEGIADAAGVACKGINNLI
RIR1_ARATH      VETGTPYMLFKDSCNRKSNQQNLGTIKSSNLCTEIIE------YTSPTE------TAVCNLASIALPRFV
RIR1_ECOLI      ASTGRIYIQ-----NVDHCNTHIAPVRQSNLCLEIALPTKPLNDVN-DENGEIAL---CTLSAFNLGAIN
RIR1_DANRE      TETGTPYMLYKDACNRKSNRQNLGTIKCSNLCTEIV---------EYTSADEVAV---CNLASLNMYVTS
RIR1_BPT4       SGTARIYVQFIDNTNNTPFIREKAPIRQSNLCCEIIPTNDVNS-----PDAEIGL---CTLSAF-VLDNF
RIR1_TRYBB      VETGVPFMLYKDACNFKSNQKNLGTIKCSNLCTEIVE---------YTSRDEVAV---CNLASIALPRFV
RIR1_DICDI      VETGTPFILYKDACNAKSNQKNLGTISSSNLCTEIIQ---------YTSPDEIAV---CNLASIALPKFV
RIR1_BUCAI      TSTGRIYVQNVDHCNLHSANPELSPIRQSNLCLEITLPTK-SLNDVHDTDGEIAL---CTLSAFNLGKI-
RIR1_HAEIN      ASTGRIYIQNVDHCN-THSDPQVAPVRQSNLCLEIALPTKPLQHIN-DENGEIAL---CTLSAFNLGKIX
RIR1_BUCBP      TSTGRIYIQNVDHCNSHSANPKIAPIRQSNLCLEITLPTKALQDV-HDKNGEISL---CTLSAIXXXXXX
RIR1_ASFP4      IQVGNPYIGFKDAINRKSNLSHVGTITNSNLCIEVT----IPCWEGDKAEQGV-----CNLAAVNLANGY
RIR1_ASFWA      IQVGNPYIGFKDAINRKSNLSHVGTITNSNLCIEVT----IPCWEGDKAEQGV-----CNLAAVNLANGY
RIR1_ASFK5      IQVGNPYIGFKDAINRKSNLSHVGTITNSNLCIEITIPCWEGS------EAEQGV---CNLAAVNLANSY
RIR1_ASFB7      IQVGNPYIGFKDAINRKSNLSHVGTITNSNLCIEVT----IPCWEGDKAEQGV-----CNLAAVNLANGY
RIR1_HHV2H      ATTGSPFIMFKDAVNRHYIDTQGAAIAGSNLCTEIVHASKRSSGV-------------CNLGSVNLARCV
RIR1_HHV23      ATTGSPFIMFKDAVNRHYIDTQGAAIAGSNLCTEIVHPSSKRSSG------------VCNLGSVNLARCV
RIR1_ASFM2      VQVGNPYIGFKDAINRKSNLSHVGTITNSNLCIEI----TIPCWEGNEAEQGV-----CNLAAVNLAAFI
RIR1_HHV11      ATTGSPFVMFKDAVNRHYIDTQGAAIAGSNLCTEIVHASKRSSGV-------------CNLGSVNLARCV
RIR1_IIV3       AETGEPYIHWIDTSNRAFQKNLGLSIRQSNLCSEVVLPT-----------DETRTAVCC-LASLNLDYFD
RIR1_EHV1B      VMTGSPFLMFKDACNK-HYHFDLRRIMGSNLCTEIIQ---------HADETQNGV---CNLASINLPKCL
NRDJ_STRAW      WACADPGIQYDDTINHWHTCPESGRINGSNPCSEYMHLDNTS----------------CNLASLNLMKFL
RIR1_BHV1C      VRSGSPFVMFKDACNRYHMDTAGDALTGSNLCTEIVQRASPDAHG------------VCNLASVNLPRCV
NRDJ_STRCL      WACADPGIQYDDTINRWHTCPESGRINGSNPCSEYMHLDNTS----------------CNLASLNLMKFL
NRDJ_STRCO      WACADPGIQYDDTINAWHTCPESGRINGSNPCSEYMHLDNTS----------------CNLASLNLMKFL
RIR1_VZVO       SAAGSPFLMFKDACNRYHMNTQGNAITGSNLCTEIVQKADAHQHG------------VCNLASINLTTCL
RIR1_VZVD       SAAGSPFLMFKDACNRYHMNTQGNAITGSNLCTEIVQKADAHQHG------------VCNLASINLTTCL
RIR1_EHV4       VMTGSPFLMFKDACNRHYHFDMRQRIMGSNLCTEIIQ---------HADETQNGV---CNLASINLIAGV
RIR1_SUHVK      VMTGSPFLMMKDACNRFHTDTRGAALATSNLCTEIVQRATP------------GENGVCNLASVNLXXXX
NRDJ_BDEBA      ADPG---IQFHDTINKWHTCPETDIIHSSNPCSEYM-------FLD---------DSACNLASINLV---
RIR1_EBVB9      VKAGSPFILLKEACN-AHFWRDLQAMNAANLCAEVLQPSRKSVATRAQRADTQGDELLLALPRLSVTAVG
RIR1_EBVA8      VKAGSPFILLKEACN-AHFWRDLQAMNAANLCAEVLQPSRKSVATRAQRADTQGDELLLALPRLSVTAVG
RIR1_EBVG       VKAGSPFILLKEACN-AHFWRDLQAMNAANLCAEVLQPSRKSVATRAQRADTQGDELLLALPRLSVTAIG
NRDJ_RHOBA      WHCGDPGVQYDTTINKWHTCPNSGAINASNPCSEYM-------FLD---------DTACNLASINLMKFV
RIR1_SHV21      IKTGSPYVISKEAMNKHHYETQGEAINCSNLCAEIVQ--QPKQFTS-----------TCNLANVCLPKCL
RIR1_IIV6       MKTGEPYICFIDTCNK-HMYDFQKKIKQSNLC--------------------------------------
NRDJ_AGRT5      WASADPGLHFNTTMNDWHTSPAEGPIRASNPCSEYM-------FLD---------DTACNLASLNLLQFK
NRDJ_BRAJA      WASADPGLHFNTTMNDWHTCKASGDIRASNPCSEYM-------FLD---------DTACNLASANLLTAT
NRDJ_LEPIN      WASADPGTQYHTTINEWHTCPEDGPINASNPCSEYM-------FLD---------NTACNLASANLQKFV
NRDJ_LEPIC      WASADPGTQYHTTINEWHTCPEDGPINASNPCSEYM-------FLD---------NTACNLASANLQKFV
NRDJ_STRCT      ---------------------------------------------------------SCNLASLNLMKFL
PBPX_STRR6      --------------------------------------------------DRNGVPIAEDATSYNVYAV-
PBPX_STRPN      --------------------------------------------------DRNGVPIAEDATSYNVYAV-


                         .         .         +         .         .         .         .:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
RIR1_BACSU      EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
RIR1_MYCTU      DSPDFAQTIEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNI
RIR1_MYCBO      DSPDFAQTIEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNI
NRDEB_BPSPC     ----------------------------------------------------------------------
NRDEB_BACSU     ----------------------------------------------------------------------
RIR1_MYCLE      DSPDFAQTVEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLSREGIFYGSEEGVDFTNI
RIR3_SALTY      DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
RIR1_MYCPN      ESPEFSELVKLAIESLDLVSRVSNLETAPSIQKGNSENHALGLGAMNLHGFLATNQIYYNSPEAIDFTNI
RIR3_ECOLI      DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
RIR1_MYCGE      ESGSLAELIQLAIESLDLVSRISSLETAPSIKKGNSENHALGLGAMNLHGFLATNAIYYDSKEAVDFTNI
RIR1_AQUAE      TEEEIKEVLPLLVRMLDNVIEM-NFYAIPEAEYTNKRYRAIGIGVSNYHYCLVKNGIKWESEEHLKFADK
RIR1_TREPA      DDKXXXXXXXXXXXXXDNVIDLT-YYPVPYAQVTNAYYRAIGLGVSGYHHVLAQQGIDWESDEHLAFADR
RIR1_HELPY      TEEDIKRVVPIMVRLLDNVIDLNFYPNR-KVKATNLQNRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDA
RIR1_HELPJ      TEEDIKRVVPIMVRLLDNVIDLNFYPNR-KVKATNLQNRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDA
RIR1_CHLTR      DEEKLSETISIAVRMLDNV---IDINFYPTAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEFADY
RIR1_CHLMU      DEEKLSETISIAVRMLDNV---IDINFYPTAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEFADY
RIR1_SYNY3      DLQDIAGVSQIAVRMLDNTIELTAPPFADAKSHNNK-YRTIGVGAMGLADWLAKRRLNYD--ELADI-NR
RIR1_ENCCU      DFEAFRRVVKILTVNLNRV---IDFNYYPVARRSNMRNRPIGIGVQGLADLFAILRLAFESDGARSLNQD
RIR1_SCHPO      KFQKLHDVVKVVTRNLNKIID-VNYYPVPEARRSNMRHRPVGLGVQGLADAFFALRLPFESAGAKKLNIQ
RIR1_CHLPN      DEEKLKETISIAIRILDNVID-LNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSDE
RIR1_DROME      DFKKLKEVTKIVTKNLNKIID-INYYPLPEARKSNLRHRPVGIGIQGFADALILMRFPYESEEAGLLNQQ
RIR1_MOUSE      EHTDFEKLAEVTKVIVRNLNKIIDINPIPEAHLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQ
RIR1_PLAF4      DFKKLYEITKIITRNLDKIIE----RNYYPVKEANTRHRPIGIGVQGLADTFMLLRYPYESDAAKELNKR
RIR1_CAEEL      TPEKKFDFVKLATKVITNLNKIIDVNYYPVARNSNMRHRPIGLGVQGLADCFMLMRYPFTSAEARDLNKR
RIR1_MIMIV      PTFNYQKLFKISRILTRNLNNIIDINFYPKTRITNLRDRPIGIGVQGLADVFAMFKTPFDSEIARDLNRK
RIR1_HUMAN      EHKKLAEVTKVVVRNLNKIID-INYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQ
RIR3_YEAST      EVSEDGKTASYNFERLTHNLNRVIDRNVPEARNSNMKHRPIALGVQGLADTYMMLRLPFESEEAQTLNKQ
RIR1_PONAB      EHKKLAEVTKVVVRNLNKIID-INYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQ
RIR1_VARV       DFLKLKDVVKVIVRNLNKIID-INYYPIPEAEISNKRHRPIGIGVQGLADAFILLNYPFDSLEAQDLNKK
RIR1_NEUCR      DYENFKKLHEVTQVVVRNLNKIIDINHYPVKEAHNSNMRPIGVGVQGLADAFLALRMPFDSDAASKLNIQ
RIR1_YEAST      EFKKLHEIAKVVTRNLNRVIDR-NYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
RIR1_BUCAP      DLHDLK---ELSTLSVRALDEILEYQNYPVVKKSAISRRSLGIGVINFAYYLAKNKVRYSDGSAKNLTHK
RIR1_CRYPV      DKNNLKEVTKVITRNLNKLID-VGYYSLKECKKSNLRHRPLGIGIQGLADCFMMLRMPYESEGAKKLNKQ
RIR1_PLAFG      DFKKLYEITKIITRNLDKIIE----RNYYPVKEANTRHRPIGIGVQGLADTFMLLRYLYESDAAKELNKR
RIR1_VACCW      DFLKLKDVVKVIVRNLNKIID-INYYPIPEAEISNKRHRPIGIGVQGLADAFILLNYPFDSLEAQDLNKK
RIR1_VACCC      DFLKLKDVVKVIVRNLNKIID-INYYPIPEAEISNKRHRPIGIGVQGLADAFILLNYPFDSLEAQDLNKK
RIR1_VACCA      DFLKLKDVVKVIVRNLNKIID-INYYPIPEAEISNKRHRPIGIGVQGLADAFILLNYPFDSLEAQDLNKK
RIR1_SALTY      TLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYWLAKNGKRYSDGSANNLTHK
RIR1_OSHV1      DKQNYEQLMRLADERTEEVVEVNGIKKYNLVSYSNLKHRPQGIGMQGLHDVFMKLKIPYDSEMAFRLAAL
RIR1_ARATH      REKGVEKLAEVTATVTVNLNKIIDVNYYPTAKTSNMRHRPIGIGVQGLADAFILLGMPFDSPEAQQLNKD
RIR1_ECOLI      NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
RIR1_DANRE      ERTDFQKLASVTKVIVKNLNKIIDINYYPVAENSNKRHRPIGIGVQGLADAFILMRFPFESTEAQ-LLNT
RIR1_BPT4       DWQDQDKINELAEVQVRALDNLLDYQGYP-VPEAEKAKKNLGVGVTNYAAWLASNFASYE--DANDLTHE
RIR1_TRYBB      DYVALKEVTKVVTRNLNRVIDRNHYPVCEA-RYSNLRHRPVGIGVQGLADAFALLSLPFAHPEAKKLNRQ
RIR1_DICDI      DHQFLFEITKLITVNLNVIIDRNYYPVAEA-KTSNLRHRPIGIGIQGLADVFIKMRMPFDSVAAAKLNVE
RIR1_BUCAI      --KSLDDFKELSILSVRALDEILDYQNYPAAKKSAISRRSLGIGVINFAYYLAKNKVRYSDGSAHNLTHK
RIR1_HAEIN      XXXXXXXXXXXXVRSLDALLDYQDYP-VVAAKRSSLARRSLGIGVINYAYYLAKNGVRYSDGSANDLTHR
RIR1_BUCBP      XXXXXXXXXXXIVRALDSV---LDYQEYPILSAKKSALRTLGIGVINFAYYLAKNGVRYSDGSANNLTHR
RIR1_ASFP4      DYRGLIEASGNVTENLDNIIDN-GYYPTEATRRSNMRHRPIGIGVFGLADVFASLKIKFGSPEAIAMDEA
RIR1_ASFWA      DYRGLIEASGNVTENLDNIIDN-GYYPTEATRRSNMRHRPIGIGVFGLADVFASLKIKFGSPEAIAMDEA
RIR1_ASFK5      DYRGLIEAAGNVTENLDNIIDN-GYYPTEATRRSNMRHRPIGIGVFGLADVFASFKMKFGSPEAIAMDEA
RIR1_ASFB7      DYRGLIEASGNVTENLDNIIDN-GYYPTEATRRSNMRHRPIGIGVFGLADVFASLKMKFGSPEAIAMDEA
RIR1_HHV2H      SRQTFDRDAVQACVLMVNIMIDSTLQPTPQCTRGNDNLRSMGIGMQGLHTACLKMGLDLESAEFRDLNTH
RIR1_HHV23      SRRTFDRDAVQACVLMVNIMIDSTLQPTPQCARGHDNLRSMGIGMQGLHTACLKMGLDLESAEFRDLNTH
RIR1_ASFM2      RESSYD--YRGLIEAAGNVTENLDIDNTEATRRSNMRHRPIGIGVFGLADVFASLKMKFGSPXXXXXXXX
RIR1_HHV11      SRQTFDRDAVQACVLMVNIMIDSTLQPTPQCTRGNDNLRSMGIGMQGLHTACLKLGLDLESAEFQDLNKH
RIR1_IIV3       KWCNNEQFYLDVATYLDNVLQYFIDHAPPTLKRAARSERAIGIGALGFHSYLQSKMVDIESLPAYLINKK
RIR1_EHV1B      PYFDFXXXXXXXXXXTIFVNSMMRAGTYPTVKRGVDENRSLGLGIQGLHTAFLMLDLDMASPEARQLNKQ
NRDJ_STRAW      KDDGVERFAKVVELVITAMDISICFADFPTIGENTRAFRQLGIGYANLGALLMATGHAYDSDGGRALAGA
RIR1_BHV1C      REGEGGXXXXXXXXXXXXXXXXXIFVNAPTEKAARGVARSLGIGFQGLHTLLLELGMDMLSPAARRLNVE
NRDJ_STRCL      QSFDVERFAKVVELVITAMDISICFADFPTIGENTRAFRQLGIGYANLGALLMATGHAYDSDGGRAIAGA
NRDJ_STRCO      KDDGAERFSKVVELVITAMDISICFADFPTIGENTRAFRQLGIGYANLGALLMATGHAYDSDGGRALAGA
RIR1_VZVO       SKGPVSFNLNTARTTVIFLNGVLAAGNFPCKKSCKKNNRSLGIGIQGLHTTCLRLGFDLTSQPARRLNVQ
RIR1_VZVD       SKGPVSFNLNTARTTVIFLNGVLAAGNFPCKKSCKKNNRSLGIGIQGLHTTCLRLGFDLTSQPARRLNVQ
RIR1_EHV4       PYFDFXXXXXXXXXXTIFVNAMMCASTYPTVKKGVEENRSLGLGIQGLHTTFLMLDLDMASPEAHQLNKQ
RIR1_SUHVK      XXXXXXXXXXXXXXXMMRIGNYPTGASVEGVRRS----RSLGIGLQGLHTTVXXXXXXXXXXXXXXXNAA
NRDJ_BDEBA      --KFLNDTGDFDFESFIHTARTVDYSSYPTQRVAQNSYRPLGLGFANLGSLLMRKGVAYDSDEGRAWAGA
RIR1_EBVB9      DGFSLAR-LRDATQCATFVVACSILQGSPTYD--SRDMASMGLGVQGLADVFADLGWQYTDPPSRSLNKE
RIR1_EBVA8      DGFSLAR-LRDATQCATFVVACSILQGSPTYD--SRDMASMGLGVQGLADVFADLGWQYTDPPSRSLNKE
RIR1_EBVG       DGFSLAR-LRDATQCATFVVACSILQGSPTYD--SRDMASMGLGVQGLADVFADLGWQYTDPPSRSLNKE
NRDJ_RHOBA      QQRAACRTFFIAQEILVHASYPTE----PIARNSHK-FRPLGLGYSNLGSVIMTAGLPYDSDAARGMCGS
RIR1_SHV21      NSSNFPYTLEYAVQAAVFIINACILSPSPSSATVGQRERSMGIGCHGLADVFSEMGYGYLDLESECLDRD
RIR1_IIV6       ----------------------------------------------------------------------
NRDJ_AGRT5      DAKTYEHAVRLWTVVL-EVSVMMAQFPSRQIAERSYEYRTLGLGYANIGGLLMSSGIPYDSDEGRAIAGA
NRDJ_BRAJA      KHFDVEGYEHLCRLWTVVLEISVMMAQFPAIAELSYEFRTLGLGYANIGGLLMTMGLPYDSKEGRALCGA
NRDJ_LEPIN      NLETLNFDVKLWTIIL-EISVTMAQFPSKEIAELSYKFRTLGLGYANLGSVLMVLGIPYDSQQAMAITGA
NRDJ_LEPIC      NLETLNFDVKLWTIIL-EISVTMAQFPSKEIAELSYKFRTLGLGYANLGSVLMVLGIPYDSQQAMAITGA
NRDJ_STRCT      RXXDAERFAKVVELVITAMDISICFADFPTIGETTRAFRQLGIGYANLGALLMATGHAYDSDGGRALAGA
PBPX_STRR6      ----IDENYKSATGKILYVEKTQFNKVAEVFH------KYLDMEESYVREQLSQPNLKQVSFGAKGNGIT
PBPX_STRPN      ----IDENYKSATGKILYVEKTQFNKVAEVFH------KYLDMEESYVREQLSQPNLKQVSFGAKGNGIT


                         *         .         .         .         .         +         .:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
RIR1_BACSU      FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
RIR1_MYCTU      YFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYTDQIWEPKTQKVRQLFAGIRIPTQDDWRR
RIR1_MYCBO      YFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYTDQIWEPKTQKVRQLFAGIRIPTQDDWRR
NRDEB_BPSPC     ----------------------------------------------------------------------
NRDEB_BACSU     ----------------------------------------------------------------------
RIR1_MYCLE      YFYTVLFHVLLASNSIAIERGTFFKGFERSKYASGEFFDKYIEQTWEPKTDKVRQLFAAIRIPTQNDWKR
RIR3_SALTY      YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
RIR1_MYCPN      FFYTVAYHAFKASSELALEKGK-FKNFENTKFADGSYFDKYIKVEWTPKTERVKALFQQVEIPTRENWKE
RIR3_ECOLI      YFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQGNWQPKTAKVGELFSGITLPTREMWAQ
RIR1_MYCGE      FFYTVAYHAFSASNKLALELGK-FKDFENTKFADGSYFDKYVASDFTCKTEKVQALFDQVKIPTQENWKQ
RIR1_AQUAE      LFELIAFYALKGSLELAKERGR-YKLFDGSNWSKGILFGRSVEEIEENSRQNGNNL----------PWRE
RIR1_TREPA      IFERINRAAIEASMTIAREKG-AYGCFTGSDWCTGAYFRKYVS----------------------EDWQR
RIR1_HELPY      LMEQISYHAIDTSANLAKEKG-VYKDFENSEWSKGIFPIDKANNEALKLTEK--GLFN-----HACDWQG
RIR1_HELPJ      LMEQISYHAIDTSANLAKEKG-VYKDFENSEWSKGIFPIDKANNEALKLTEK--GLFN-----HACDWQG
RIR1_CHLTR      SSELISYYAIQASCLLAKERG-TYSSYKGSKWDRG--LLPIDTIQLLANYRGEANL--QMDTSSRKDWEP
RIR1_CHLMU      SSELISYYAIQASCLLAKERG-TYSSYKGSKWDRG--LLPIDTIQLLANYRGKDNL--QMDTSVRKDWEP
RIR1_SYNY3      LFEEIGYWCTQSSMELAKERG-AYPAFPGSDWQKGLLIGSKPVSWFQANAAK------------PERWEK
RIR1_ENCCU      IFEAMYYSAMEASCELAEKEG-PFPSYEGSPISKGIFHFELAGRKASGNW----------------DWEG
RIR1_SCHPO      IFETIYHAALEASCEIAQVEG-TYESYEGSPASQG--ILQYDMWNVNP-----TDLW---------DWAE
RIR1_CHLPN      CSEXXXXXXXXXXXXXXKERG-TYASYSGSKWDRG-----YLPLDTIELLKETRGEHNVLDTSSKKDWTP
RIR1_DROME      IFETIYYGALEASCELAQTEG-PYETYEGSPVSKG--ILQYDMWDKVP-----TNLW---------DWQK
RIR1_MOUSE      IFETIYYGALEASCELAKEYG-PYETYEGSPVSKG--ILQYDMWNVAP-----TDLW---------DWKP
RIR1_PLAF4      IFETMYYAALEMSVELASIHG-PYESYQGSPASQG-------ILQFDMWNAKVDNKY--------WDWDE
RIR1_CAEEL      IFETI-YYXXXXXXXXXXXXNGPYSTYEGSPVSKGQQFDMWGVT------------------PTDQDWAT
RIR1_MIMIV      IFETIYYGALTESNKLAREFG-TYQTYQGSPISQGKFFDLW--------------NFDKSQLSGMWDWEL
RIR1_HUMAN      IFETIYYGALEASCDLAKEQG-PYETYEGSPVSKG--ILQYDMWNVTP-----TDLW---------DWKV
RIR3_YEAST      IFETIYHATLEASCELAQKEGK-YSTFEGSPASKGILFDMWNAKPF------------GMW-----DWET
RIR1_PONAB      IFETIYYGALEASCDLAKEQG-PYETYEGSPVSKG--ILQYDMWNVTP-----TDLW---------DWKL
RIR1_VARV       IFETIYYGALEASCELAEKEG-PYDTYVGSYASNG--ILQYDLWNVVP-----SDLW---------NWEP
RIR1_NEUCR      IFETIYHAALTASCQLAKEQG-PYATYEGSPVSQG--ILQYDMWNVTP-----TNLW---------DWTA
RIR1_YEAST      IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILFDMWDQKPY------------GMW-----DWDT
RIR1_BUCAP      TFEAIQYYLLKASCELAKEKGSLFNQ-------TNYYLGKFPIDTYKKDIDSICN--EPLHL----NWNL
RIR1_CRYPV      IFEVIYYAALDASCELAEKYG-PYETYSGSPASKGLQFDMWGVTPDSGLC----------------DWDL
RIR1_PLAFG      IYETMYYAALEMSVDWL--QSGPYESYQGSPGSQG-------ILQFDMWNAKVDNKY--------WDWDE
RIR1_VACCW      IFETIYYGALEASCELAEKEG-PYDTYVGSYASNG--ILQYDLWNVVP-----SDLW---------NWEP
RIR1_VACCC      IFETIYYGALEASCELAEKEG-PYDTYVGSYASNG--ILQYDLWNVVP-----SDLW---------NWEP
RIR1_VACCA      IFETIYYGALEASCELAEKEG-PYDTYVGSYASNG--ILQYDLWNVVP-----SDLW---------NWEP
RIR1_SALTY      TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-------KKDLDAIVNEPLHY----DWEQ
RIR1_OSHV1      IQEAIYYGAVRESVKIAEEKGPYPSYYDNNTHREGK-----LQFDFLEGFDRDRDLTHELF-----NWRE
RIR1_ARATH      IFETIYYHALKASTELAARLG-PYETYAGSPVSKG---------ILQPDMWNV--------IPSDRDWAV
RIR1_ECOLI      TFEAIQYYLLKASNELAKEQG-ACPWFNETTYAKGILIDTY-----KKDLDTIAN--EPLHY----DWEA
RIR1_DANRE      QIFETIYYXXXXXXXXXXXXYGPYQTYAGCPVSKGLQYDMWEKT------------------PTLWDWAA
RIR1_BPT4       LFERLQYGLIKASIKLAKEKGPS-EYYSDTRWSRGEWYNKKIDQIAAPKY--------------VCDWSA
RIR1_TRYBB      IFETIYIAAVEASTELAEKDGP-YETFKGSPASEGK-----LQFDLWDEERRIRGMNESVHSHCLWDWDS
RIR1_DICDI      IAETIYFAALTASHELAIRDG-TYESFKGSPASKGLQFDMWNVTPSS-----------------RWNWAE
RIR1_BUCAI      TFEAMQYYLLEASCELAKEKGAC------SLFNHTNYYLGKLPIDTYKKYDDICN--EPLHL----DWNL
RIR1_HAEIN      TFEAIQYYLLKASMNLAKEQG-ACEYFNETTYAKGILIDTYKKDLDSLTQE-----------PLHYDWES
RIR1_BUCBP      TFEAIQYHLLNASCVLAQEKGAC------HWFSHTNYYKGILPIDYKKNVDEICN--EPLHL----DWEL
RIR1_ASFP4      IHAALYYGAMRRSIELAKEKG-SHPSFPGSAASKGLLQDLWVRCDLIPSWERVAQTTQG--VLTRKSWRQ
RIR1_ASFWA      IHAALYYGAMRRSIELAKEKG-SHPSFPGSAASKGLLQDLWVRCDLIPSWERVAQTTQG--VLTRKSWRQ
RIR1_ASFK5      IHAALYYGAMRRSVELAKEKG-SHPSFPGSAASKGLLQDLWVRCDFSWE-ERVAQTTQG--VLTPKKWWQ
RIR1_ASFB7      IHAALYYGAMRRSIELAKEKG-SHPSFPGSAASKGLLQDLWVRCDLSSSWERVAQTTQG--VLTRKSWWQ
RIR1_HHV2H      IAEVMLLAAMKTSNALCVRGARPFSHFKRSMYRAGRFHWERFS-NASPRYE--------------GEWEM
RIR1_HHV23      IAEVMLLAAMKTSNALCVRGARPFSHFKRSMYRAGRFHWERFS-NASPRYE--------------GEWEM
RIR1_ASFM2      XXXXLYYGAMRRSIELAKEKG-SHPSFPGSAASKGLLQDLWVRCDLIPSWERVAQTTQG--VLTPKKWWQ
RIR1_HHV11      IAEVMLLSAMKTSNALCVRGARPFNHFKRSMYRAGRFWERF--PDARPRYE--------------GEWEM
RIR1_IIV3       IFKTISSHLERVNLELGELRGEAPD-----CVGTGRRFSH--MTAIAP--NATSSIIMGNTSPSCEPFRA
RIR1_EHV1B      IAERLLLNSMKASATLCRLGMKPFKGFEDSKYSLGELFDSY----------------PGVTLANRNAWRR
NRDJ_STRAW      ITSLMTGTSYKRSAELAAVVG-PYDGYARNAQPHQRVMKQH--SDANGVAVRVDDLDTPIWAAATEAWQD
RIR1_BHV1C      IAERLLLAVMATSATLCEYGCAPFEDFARSKFARGLMFDGY----------------EGVVLSLPRAWAR
NRDJ_STRCL      ISSLMTGTSYRRSAELAAVVG-PYDGYARNAAPHNQVMRQH--ADANDTAVRMDDLDTPIWAAATETWQD
NRDJ_STRCO      ITSLMTGTSYRRSAELAAIVG-PYDGYARNAKPHLRVMKQH--SDENAKAVRMDDLDTPIWAAATEAWQD
RIR1_VZVO       IAELMLYETMKTSMEMCKIGGAPFKGFTESKYAKGWLHQDGFST------------ISYLDLP----WCT
RIR1_VZVD       IAELMLYETMKTSMEMCKIGGAPFKGFTESKYAKGWLHQDGFST------------ISYLDLP----WCT
RIR1_EHV4       IAERLLLNSMKASATLCKLGMQPFKGFEDSKYSRGELFDAYPNVTLTNR----------------NAWRR
RIR1_SUHVK      IAEELLYGVMDASVELCERGLRPFDGFEHSRYARGVMFD---------AYERV-SLREPMR------WDA
NRDJ_BDEBA      LTSLMSGVAYLTSSEMARAKG-PFAGYRKNSKS---------MLKVMKMHERALNQVAWKMLPAGIDWKG
RIR1_EBVB9      IFEHMYFTALCTSSLIGLHTRKIFPGFKQSKYAGGWFWHDWAGTDLS--------------IPR-EIWSR
RIR1_EBVA8      IFEHMYFTALCTSSLIGLHTRKIFPGFKQSKYAGGWFWHDWAGTDLS--------------IPR-EIWSR
RIR1_EBVG       IFEHMYFTALCTSSLIGLHTRKIFPGFKQSKYAGGWFWHDWAGTDLS--------------IPR-EIWSR
NRDJ_RHOBA      LTALLHGEANRTSAELASVVG-TFDGYVENEAPMLRVMQMHRDACDQINDDGPAELKEA----ARELWDG
RIR1_SHV21      IFETMYYTAVKTSSEICSGKGQPFAGFRKSKLAHGVF--HWATWDAMPQ-----------RVP-MKQWIH
RIR1_IIV6       ----------------------------------------------------------------------
NRDJ_AGRT5      LTAIMTGVSYATSAEMAGELGRVIRNHRRAAHGQSEGYEGLSVNPVALIHADCTD--QDLVAHATAAWDK
NRDJ_BRAJA      LTAVMTGITYKTSAEIAAELG-TFPGYKKNARAAHGQSNGYEALSVNPVPLDLVSCPQADLVSHAQAWDA
NRDJ_LEPIN      ISSIMHMTAYATSAEMAKEQG-------------------------------------------------
NRDJ_LEPIC      ISSIMHMTAYATSAEMAKEQG-------------------------------------------------
NRDJ_STRCT      ITSLMTGTSYRRSAELAAVVG----PYEG--YARNADAHKRVHADANTAAQRMDDLDTPVWAAATEAWQD
PBPX_STRR6      Y---ANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIG---------LAQLHEN------EDGSK
PBPX_STRPN      Y---ANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIG---------LAQLHEN------EDGSK


                         .         .         .         *         .         .         .:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
RIR1_BACSU      LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
RIR1_MYCTU      LKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKGRVYYPAPYMTNDNLEYYEDAY
RIR1_MYCBO      LKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKGRVYYPAPYMTNDNLEYYEDAY
NRDEB_BPSPC     ----------------------------------------------------------------------
NRDEB_BACSU     ----------------------------------------------------------------------
RIR1_MYCLE      LKELVVAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKGRVYYPAPYMTNDNLQYYQDAY
RIR3_SALTY      LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
RIR1_MYCPN      LALNIQKNGLANSHLLAIAPTGSISYLSSCTPSLQPVVSPVEVRKEGRGRIYVPAYQLNKDSYPFYKDAY
RIR3_ECOLI      LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTRVYYPAPFMTNENLALYQDAY
RIR1_MYCGE      LVASIQKDGLANSHLMAIAPTGSISYLSSCTPSLQPVVSPVEVRKEGKGRIYVPAYKLDNDNYQYFKDAY
RIR1_AQUAE      LAEEIKKYGIRNAYLLALMPTGSTSLILGATPSIDPIFARFYKEE--NMSGILPVPPEVDRFYWHYKTAY
RIR1_TREPA      LQREVATHGMRNGYLLAVAPXXXXXXXXXXXXXVDPIMKQYFLEEKKGMLMPRVAPSLSQKTCPLYKSAH
RIR1_HELPY      LREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKKFEENLSGLIPVV--VPNLNVETWNFYTSXX
RIR1_HELPJ      LREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKKFEENLSGLIPVV--VPNLNVETWNFYTSXX
RIR1_CHLTR      IRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPIERIPDHLKHIFLTAF
RIR1_CHLMU      IRSLIREHGMRNCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKS--NLSGEFTIPNLDDLKYFIFLTAF
RIR1_SYNY3      LSNDIQTHGIRNSHITAIAPNTSSSLVQGCTASILPVYSRFFYDKWAKG-TVPIAPPFIGNCFWFYPENK
RIR1_ENCCU      LRERIRRHGVRNSLLIALMPTAGTSQIFGNNEAFEPHASNITRRTHAGEFQIYEMKNLVIENREIYKTAW
RIR1_SCHPO      LKEKIAKHGIRNSLLVAPMPTASTSQILGFNECFEPLLKDLVERDLWNEDSIQAIPEIPQDLKDLYKTVW
RIR1_CHLPN      VRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLFVKSNLSGEFTIPNTYLIKKKYFLFLTAF
RIR1_DROME      LKESIRMHGVRNSLLVAPMPTASTAQIMGNNESFEPYTTNIYTRSRGSIQNIETIPPKVRD---LYKTVW
RIR1_MOUSE      LKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPLLKDLTERGLWNKESIQSIPEIPDDLKQLYKTVW
RIR1_PLAF4      LKAKIRKHGLRNSLLLAPMPTASTSQILGNNESFEPYTSNIYYRRVLSGEFFVVNPHLLKDLFELYKTVW
RIR1_CAEEL      LRKKIAKHGIRNSLLMAPMPTASTAQILGNNESIEPLVERMKNRLIANNGSIQNIDGIPSDIKELYRTVW
RIR1_MIMIV      LRQEILNHGVRNSLVTTCMPTASTSQIMGWNECIEPYTENIYSRSVWNSEKYYKIPNIPDNIKAIYRTVW
RIR1_HUMAN      LKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVGEFQIVNPIPEIPDDLKQLYKTVW
RIR3_YEAST      LRKDIVKHGLRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVGEFQVVNPLPNVPQELKELYKTVW
RIR1_PONAB      LKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVGEFQIVNPIPEIPDDLKQLYKTVW
RIR1_VARV       LKDKIRTYGLRNSLLVAPMPTASTAQILGNNESVEPLLRVLTERKLWNDKNRIMVDGGSIQNTNLYKTIW
RIR1_NEUCR      LKADIKKYGVRNSLLLAPMPTASTSQILGNNECFEPYTSNIYQRRVGEFQVVNPIQSIPNDIKALYKTVW
RIR1_YEAST      LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVGEFQVVNPLPNVPQELKDLYKTVW
RIR1_BUCAP      LRKKIKKYGLRNSTLSALMPSETSSQISNATNGIEPPRGFISIKSSKDGMLRQVVP-----EYKKLKSEY
RIR1_CRYPV      LKDRISKHGIRNSLLISPMPTASTSQILGNNESFEPFTSNIYHRRVLSGEFFVVNPNIIANNGSLYKTVW
RIR1_PLAFG      LKLKIAKTGLRNLLLLAPMPTASTSQILGNNESFEPYTSNIYYRRVLSGEFFVVNPHLLKDLFELYKTVW
RIR1_VACCW      LKDKIRTYGLRNSLLVAPMPTASTAQILGNNESVEPYTSNIYTRRVLSGEFQVVNPNLPEDIKRVYKTIW
RIR1_VACCC      LKDKIRTYGLRNSLLVAPMPTASTAQILGNNESVEPYTSNIYTRRVLSGEFQVVNPNLPEDIKRVYKTIW
RIR1_VACCA      LKDKIRTYGLRNSLLVAPMPTASTAQILGNNESVEPYTSNIYTRRVLSGEFQVVNPNLPEDIKRVYKTIW
RIR1_SALTY      LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLKDAY
RIR1_OSHV1      VLKKFEKFGINNSVVTAQPPSASSSQLNDNVESIEAITSNIKDGKFANDGSIQNIERIPKNIREIYKTAR
RIR1_ARATH      LRDMISKNGVRNSLLVAPMPTASTSQILGNNECFEPYTSNIKNKLINENGSIVNVAEIPDDLKAIYRTVW
RIR1_ECOLI      LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVP-----DYEHLHDAY
RIR1_DANRE      LKEKIANDGVRNSLLLAPMPTASTAQILGNNESIEPLLKDLTERGLWNEESIQTIPAIPDDLKELYKTVW
RIR1_BPT4       LREDLKLFGIRNSTLSALMPCESSSQVSNSTNGYEPPRGPVSVKESKEGSFNQVVPNIEHNTWKLAKKGN
RIR1_TRYBB      LKERVVKVGMRNSLLIAPMPTASTSQILGNNECIEPFTSNIYVRRVLSGE--FPVVNIALNGSVLYKVVW
RIR1_DICDI      LKNIVNKGGLRNSLLIAPMPTASTSQILGNNECFEPYTSNIYSRTIVNKQSIQSIGGIPDDLKELYKTVW
RIR1_BUCAI      LRSKIKKYGLRNSTLSALMPSETSSQISNATNGIEP----------------------------------
RIR1_HAEIN      LRKDIQEFGLRNSTLTALMPSETSSQISNATNGIEPPRGHVSIKASGILKQVVPEYENLMDNYELLWDIP
RIR1_BUCBP      LRKKIKKYGLRNSTLSALMPSETSSQISNATNGIEPPLISIKASKDGMLRQVVPEYKRLKNN---YELLW
RIR1_ASFP4      LR-LAAIQGVRNGYLTALMPTATSS---------------------------------------------
RIR1_ASFWA      LR-LAAIQGVRNGYLTALMPTATSS---------------------------------------------
RIR1_ASFK5      LR-LAAMQGVRNGYLTALMPTATSS---------------------------------------------
RIR1_ASFB7      LR-LAAMQGVRNGYLTALMPTATSS---------------------------------------------
RIR1_HHV2H      LRQSMMKHGLRNSQFIALMPTAASAQISDVSEGFAPLFTNLLERTFGGKRLLDAMDGLEAKQWSVFKTAF
RIR1_HHV23      LRQSMMKHGLRNSQFIALMPTAASAQISDVSEGFAPLFTNLLERTFGGKRLLDAMDGLEAKQWSVFKTAF
RIR1_ASFM2      LR-LAAIQGVRNGYLTALMPTATSS---------------------------------------------
RIR1_HHV11      LRQSMMKHGLRNSQFVALMPTAASAQISDVSEGFAPLFTNLLERTFSGKRLLEVMDSLDAKQWSVFKTAF
RIR1_IIV3       --------------NIYKQDTISGSFVTYNKHLKRLLEERIRERVWSSIKMHQHLNQLTVQEKKVFKTWP
RIR1_EHV1B      LRTEIKQHGLYNSQFVAYMPXXXXXXXXXXXXGFSPVYTNLFSKVTATGEVLRPLSTLEMAQWSVFKTAF
NRDJ_STRAW      VLHLGEKNGFRNAQASVIAPTGTIGLAMSDTTGLEPVPQALRRLGYQEEQIEAIVAHIAENGNVIDAPGL
RIR1_BHV1C      LREKVARHGLYNAQFVALMPTVSSSQVTEGSEGFSPVFTNMFSKVTMSGELLRPVRALDREQWSVFKTAF
NRDJ_STRCL      VLRLGEKNGFRNAQASVIAPTGTIGLAMS-----------------------------------------
NRDJ_STRCO      VLRLGEKNGFRNSQASVIAPTGTIGLAMSDTTGLEPVPQALRRLGYQEEQIEAIVAHIAENGNVIDAPGL
RIR1_VZVO       LRDDICAYGLYNSQFLALMPTVSSAQVTECSEGFSPIMDELRDMYSCEEKRLEVINILEKNQWLKYKTAF
RIR1_VZVD       LRDDICAYGLYNSQFLALMPTVSSAQVTECSEGFSPIMDELRDMYSCEEKRLEVINILEKNQWLKYKTAF
RIR1_EHV4       LRTDIKQYGLYNSQFVAYMPXXXXXXXXXXXXGFSPVYTNLFSKVTATGEVLRPLSTLEAAKWSVFKTAF
RIR1_SUHVK      LRVRIAEHGVYNAQFVALMPTNMFSKVTISGELLLPLMERLERAQWSVAAAFGELP--AGHPLAKFKTAF
NRDJ_BDEBA      VLYNGEKYGYRNAQATVIAPTGTIGLLMDDTTGIEPDFSLIKKKLVGGGEIQIVNAALASLQYFYVEEPE
RIR1_EBVB9      LSERIVRDGLFNSQFIALMPTSGCAQVTGCSDAFYPFYANASTKVTNKEEALRPLPEALRQRYLRFQTAF
RIR1_EBVA8      LSERIVRDGLFNSQFIALMPTSGCAQVTGCSDAFYPFYANASTKVTNKEEALRPLPEALRQRYLRFQTAF
RIR1_EBVG       LSERIVRDGLFNSQFIALMPTSGCAQVTGCSDAFYPFYANASTKVTNKEEALRPLPEALRQRYLRFQTAF
NRDJ_RHOBA      VLEIGEKYGFRNAQATVLAPTGTISFMMDDTTGIEP----------------------------------
RIR1_SHV21      LQDNIKKFGVFNSQFIALMPTAGTSQLTGYTDSFYPYFANMSSKVSNKEEIMKPMPEDVSTRYKHFLTAF
RIR1_IIV6       ----------------------------------------------------------------------
NRDJ_AGRT5      ALELGEKHGYRNAQTTVIAPTGTIGLVMDDTTGIEP----------------------------------
NRDJ_BRAJA      ALELGEKHGYRNAQTTVIAPTGTIGLVMDDTTGIEP----------------------------------
NRDJ_LEPIN      ----------------------------------------------------------------------
NRDJ_LEPIC      ----------------------------------------------------------------------
NRDJ_STRCT      VLRLGEQNRFRNAQASVLAPTGTIGLMMDDTTGVEP----------------------------------
PBPX_STRR6      --SLLGTSGMESSLNSILAGTGIITYEKDRLGNIVPGTEQVSQRTMDGKDVY------------------
PBPX_STRPN      --SLLGTSGMESSLNSILAGTGIITYEKDRLGNIVPGTEQVSQRTMDGKDVY------------------


                         .         +         .         .         .         .         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
RIR1_BACSU      DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
RIR1_MYCTU      EIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQTEVEGCVSCML
RIR1_MYCBO      EIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQTEVEGCVSCML
NRDEB_BPSPC     ----------------------------------------------------------------------
NRDEB_BACSU     ----------------------------------------------------------------------
RIR1_MYCLE      EIGYQKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQTEVEGCVSCTL
RIR3_SALTY      DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQTEIEGCVSCAL
RIR1_MYCPN      ELGPEPIINIAAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVREVLEDSCEACVI
RIR3_ECOLI      EIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQTEIEGCVSCAL
RIR1_MYCGE      ELGFEPIINIVAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRDVLKDS------
RIR1_AQUAE      TIDHEWTIRAAAVRQKWIDQAQSLNLFVPQNIDGPRLSRLYELAWELGLKTIYYLRSRSAMDEECEACSV
RIR1_TREPA      AVEQRWSIRAAGLRQRHIDQAQSVNLYITTDFTLKQVLDLYVYAWEVGMKSLYYVRSQSLEIDLCGYC--
RIR1_HELPY      XXXXXXXXXXXXVRQKWIDQGQSLNVFLRENASGKTLHDIYTLAWKLGLKSTYYLRSESPSID-------
RIR1_HELPJ      XXXXXXXXXXXXVRQKWIDQGQSINVFLRENASGKTLHEIYTLAWKLGLKSTYYLRSESPSID-------
RIR1_CHLTR      EIEPEWIIECASRRQKWIDMGQSLNLYLAQP-DGKKLSNMYLTAWKKGLKTTYYLRS-------------
RIR1_CHLMU      EIEPEWILECASRRQKWIDMGQSLNLYLAQP-DGKKLSNMYLTAWKKGLKTTYYLRS-------------
RIR1_SYNY3      TMDQRKVVKAVAAIQQWTDTGISMELLFNPEEPERSLNAKDIFAWEAGCKAIYYIRTKDDFKDSSDGCV-
RIR1_ENCCU      EIKMKSVIDLAADRQVFVDQSQSLNIFIAKP-TYSQLTSMHFYGYHCGLKTMYYLRTR------------
RIR1_SCHPO      EISQKTVIDYAADRGPFIDQSQSLNIHLKDPSYGK-ITSMHFYGWKKGLKTMYYLRT-------------
RIR1_CHLPN      EIEPEWIIECTSRRQKWIDMGVSLNLYLAEP-DGKKLSNMYLTAWKKGLKTTYYLRSQ------------
RIR1_DROME      EISVKSTIKMAADRGAFIDQSQSFNIHVAEPNYGK-LTSIHFYSWKAGLKTMYYLRTK------------
RIR1_MOUSE      EISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGK-LTSMHFYGWKQGLKTMYYLRTR------------
RIR1_PLAF4      EIKQKNIIDMAADRGIFIDQSQSLNIYIQKP-TFAKLSSMHFYGWEKGLKTAYYLRTQ------------
RIR1_CAEEL      EISQKDIIEMAADRGAYIDQSQSLNIHMAKP-SYAGITSMHFYGWKKGLKTMYYLRTK------------
RIR1_MIMIV      EIPQKSIIEMAADRAPFVDQTQSMNLYI-DKPSFARLNSCLFYAWRKGLKTMYYLRSK------------
RIR1_HUMAN      EISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGK-LTSMHFYGWKQGLKTMYYLRTR------------
RIR3_YEAST      EISQKTIINMAADRAIYIDQSHSLNLFLQ-APSMGKITSMHFYGWKKGLKTMYYLRTQ------------
RIR1_PONAB      EISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGK-LTSMHFYGWKQGLKTMYYLRTR------------
RIR1_VARV       EIPQKTIIKMAADRGAFIDQSQSMNIHIADPSYSK-LTSMHFYGWSLGLKTMYYLRTK------------
RIR1_NEUCR      EISQRTIVKMAADRGAFIDQSQSLNIHMREP-TMGKITSMHFAGWKMGLKTMYYLRTQAAAQ--------
RIR1_YEAST      EISQKTIINMAADRSVYIDQSHSLNLFLR-APTMGKLTSMHFYGWKKGLKTMYYLRTQ------------
RIR1_BUCAP      ELNNIGYLELVAIMQKFVDQSISANTFLNEKIPMKQLIYDLLVAYKLGIKTLYYQNTRDGAEDN------
RIR1_CRYPV      EIKQKTVIDMAADRGPYVCQSQSLNIHMENANFAK-LSSMHFYGWKKGLKTIYYLRTQ------------
RIR1_PLAFG      EIKQKNIIDMAADRGYFIDQSQSLNIYIQKP-TFAKLSSMHFYGWEKGLKTAYYLRTQ------------
RIR1_VACCW      EIPQKTIIKMAADRGAFIDQSQSMNIHIADPSYSK-LTSMHFYGWSLGLKTMYYLRTK------------
RIR1_VACCC      EIPQKTIIKMAADRGAFIDQSQSMNIHIADPSYSK-LTSMHFYGWSLGLKTMYYLRTK------------
RIR1_VACCA      EIPQKTIIKMAADRGAFIDQSQSMNIHIADPSYSK-LTSMHFYGWSLGLKTMYYLRTK------------
RIR1_SALTY      ELNNDGYLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRDGAEDA------
RIR1_OSHV1      EIDHKAVVKICAAIQPFIDQTISKNMFVPKNVPVQLIMENVILGHKMKLKTMYYTR--------------
RIR1_ARATH      EIKQRTVVDMAADRGCYIDQSQSLNIHM-DKPNFAKLTSLHFYTWKKGLKTMYYLRSR------------
RIR1_ECOLI      EL-LWEMLQLVGIMQKFIDQSISASRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRDGAEDA------
RIR1_DANRE      EISQKTILKMAADRGAYIDQSQSLNIHIAEPNYGK-LTSMHFYGWKQGLKTMYYLRTK------------
RIR1_BPT4       KPYLTQVAIMLKWVCQSASANTYYQIFPKGKVPMSIMIDDMLYGWYYGIKNFYYHNTRD-----------
RIR1_TRYBB      EIRQKDLIDMAADRGRYIDQSQSLNLFLA-TPTSSQLTSMHFYSWKKGLKTMYYLRSQ------------
RIR1_DICDI      EIRQRTLIDMAADRGAFIDQSQSFNVFIAEP-TFAKLTSMHFYSWKKGLKTMYYLRTR------------
RIR1_BUCAI      ----------------------------------------------------------------------
RIR1_HAEIN      SNDGY--LHLVGIMQKFVDQAISANTFEDGKVPMKVLLKDLLTAYKYGLKTLYYQNTRDGAED-------
RIR1_BUCBP      NINNTGYLQLASIMQKFVDQSISANLFPNNKIPMQQLILDLLTAYKLGLKTLYYQNTRDGASD-------
RIR1_ASFP4      ----------------------------------------------------------------------
RIR1_ASFWA      ----------------------------------------------------------------------
RIR1_ASFK5      ----------------------------------------------------------------------
RIR1_ASFB7      ----------------------------------------------------------------------
RIR1_HHV2H      DYDQELLIDLCADRAPYVDHSQSMTLYVTETLPASTLVRLLVHAYKRGLKTMYYCKVRKAGDDNCTSCAL
RIR1_HHV23      DYDQELLIDLCADRAPYVDHSQSMTLYVTETLPASTLVRLLVHAYKRGLKTMYYCKVRKAGDDNCTSCAL
RIR1_ASFM2      ----------------------------------------------------------------------
RIR1_HHV11      DYDQKLLIDLCADRAPYVDHSQSMTLYVTETLPASTLVRLLVHAYKRGLKTMYYCKVRKAGDDNCMSCAL
RIR1_IIV3       EINQLSLVMLAADRQKWIDQSQSTSLFFNPDERISYVHKIHLKAWLHGLKTLYYFRSR------------
RIR1_EHV1B      EYDQRTLIDMCADRAPFVDQSQSMSLFITEKLPASKIMSLLVHAYKRGLKTMYYCKIKKAGDLVCTSC--
NRDJ_STRAW      KHEHYEVFDMMAAIQPWISGALSKTVNLPETATVEDVEEVYFEAWKMGVKAL------------------
RIR1_BHV1C      EYDQERLIDLCADRAPFVDQSQSMSLFVTEPMDGKQIMNLLVYAYKKGLKTLYYCKIR------------
NRDJ_STRCL      ----------------------------------------------------------------------
NRDJ_STRCO      KPEHYEVFDMMAAIQPWISGALSKTVNLPESATVEDVEEVYFEAWKMGVKAL------------------
RIR1_VZVO       EYEQEDLVDMCAERAPFIDQSQSMTLFIEETIPASKIMNLLIRAYKAGLKTMYYCKIRKAGELTCTSCAL
RIR1_VZVD       EYEQEDLVDMCAERAPFIDQSQSMTLFIEETIPASKIMNLLIRAYKAGLKTMYYCKIRKAGELTCTSCAL
RIR1_EHV4       EYDQTMLINMCADRAAFVDQSQSMSLFITEPAASRIMNLL-VHAYKRGLKTMYYCKIKKAGDLVCTSC--
RIR1_SUHVK      EYDQELLIDMCADRAPFVDHSQSMSLFLTEKLHASRVMGLLMRAYNLGLKTMYYCKIRKTGGDVCTSC--
NRDJ_BDEBA      DLPVFDTVKMMAAVQPFISGAISKTVNMPSTATEEDISRIYFLAWKLGVKAV------------------
RIR1_EBVB9      DYNQEDLIQMSRDRAPFVDQSQSHSLFLRDAARASTLANLLVRSYELGLKTIYYCRIEKAADLGVMEC--
RIR1_EBVA8      DYNQEDLIQMSRDRAPFVDQSQSHSLFLRDAARASTLANLLVRSYELGLKTIYYCRIEKAADLGVMEC--
RIR1_EBVG       DYNQEDLIQMSRDRAPFVDQSQSHSLFLRDAARASTLANLLVRSYELGLKTIYYCRIEKAADLGVMEC--
NRDJ_RHOBA      ----------------------------------------------------------------------
RIR1_SHV21      DYCPEAQMRRASIRAPYVDQSQSLTLFLENVQSAKYXXXXXXXXXXXXXXTIYYCRVKKTTKLLQLECL-
RIR1_IIV6       ----------------------------------------------------------------------
NRDJ_AGRT5      ----------------------------------------------------------------------
NRDJ_BRAJA      ----------------------------------------------------------------------
NRDJ_LEPIN      ----------------------------------------------------------------------
NRDJ_LEPIC      ----------------------------------------------------------------------
NRDJ_STRCT      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------