[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB13639.1

[Show Plain Result]


## Summary of Sequence Search
    1::91
    1::91      5e-42 100%   91 aa  YNAG_BACSU RecName: Full=Uncharacterized protein ynaG;
    1::91

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNVKKAAAVFSXXXXXXXXXXXXNFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTNKRCAVYGIVL
YNAG_BACSU      MNVKKAAAVFSXXXXXXXXXXXXNFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTNKRCAVYGIVL


                         .         .         *         .         .         .         .:140
query           NAIMFPFPFFWFIGGALLFGV
YNAG_BACSU      NAIMFPFPFFWFIGGALLFGV