[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB14191.1

[Show Plain Result]


## Summary of Sequence Search
    1::233
    1::233     e-138 100%  233 aa  UBIE_BACSU RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-130  93%  233 aa  UBIE_BACA2 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-119  85%  234 aa  UBIE_BACP2 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::231     e-118  85%  232 aa  UBIE_BACLD RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-104  75%  237 aa  UBIE_BACCN RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACC1 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACHK RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACCZ RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACCQ RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACC7 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACC3 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACC0 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACAN RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACAC RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  76%  237 aa  UBIE_BACAA RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-103  75%  237 aa  UBIE_BACWK RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-101  74%  237 aa  UBIE_BACCR RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-101  74%  237 aa  UBIE_BACC4 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-101  74%  237 aa  UBIE_BACC2 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-100  71%  234 aa  UBIE_GEOSW RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     e-100  72%  237 aa  UBIE_ANOFW RecName: Full=Menaquinone biosynthesis methyltransferase
    1::231     3e-98  73%  234 aa  UBIE_LYSSC RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     7e-97  69%  234 aa  UBIE_GEOKA RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     2e-95  69%  234 aa  UBIE_BACST RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     2e-91  65%  245 aa  UBIE_BACHD RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     4e-90  62%  237 aa  UBIE_LISMO RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     4e-90  62%  237 aa  UBIE_LISMF RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     4e-90  62%  237 aa  UBIE_LISMC RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     4e-90  62%  237 aa  UBIE_LISIN RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     5e-90  62%  236 aa  UBIE_LISW6 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     2e-89  62%  237 aa  UBIE_LISMH RecName: Full=Menaquinone biosynthesis methyltransferase
    6::235     4e-89  64%  238 aa  UBIE_OCEIH RecName: Full=Menaquinone biosynthesis methyltransferase
    6::233     6e-88  64%  241 aa  UBIE_STACT RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     7e-88  64%  235 aa  UBIE_BACSK RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAW RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAT RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAS RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAN RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAM RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAE RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAC RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAAB RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAA9 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAA2 RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     1e-87  63%  241 aa  UBIE_STAA1 RecName: Full=Menaquinone biosynthesis methyltransferase
    5::233     8e-87  63%  239 aa  UBIE_STAHJ RecName: Full=Menaquinone biosynthesis methyltransferase
    1::233     8e-87  63%  241 aa  UBIE_STAAR RecName: Full=Menaquinone biosynthesis methyltransferase
    6::233     4e-86  62%  233 aa  UBIE_STAS1 RecName: Full=Menaquinone biosynthesis methyltransferase
    6::233     1e-85  62%  241 aa  UBIE_STAES RecName: Full=Menaquinone biosynthesis methyltransferase
    6::233     1e-85  62%  241 aa  UBIE_STAEQ RecName: Full=Menaquinone biosynthesis methyltransferase
   16::242     1e-80  60%  246 aa  UBIE_MICLU RecName: Full=Menaquinone biosynthesis methyltransferase
    1::218     2e-77  61%  221 aa  UBIE_BACPF RecName: Full=Menaquinone biosynthesis methyltransferase
    7::239     4e-68  52%  252 aa  UBIE_LACLA RecName: Full=Menaquinone biosynthesis methyltransferase
    9::234     4e-62  50%  237 aa  UBIE_LACPL RecName: Full=Menaquinone biosynthesis methyltransferase
   22::251     1e-54  45%  253 aa  UBIE_DESHY RecName: Full=Menaquinone biosynthesis methyltransferase
   13::242     3e-47  43%  243 aa  UBIE_BURTA RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURPS RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURP6 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURP1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURP0 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURMS RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURMA RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURM9 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-47  43%  243 aa  UBIE_BURM7 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::240     1e-46  43%  244 aa  UBIE_LACJO RecName: Full=Menaquinone biosynthesis methyltransferase
   13::242     1e-46  42%  243 aa  UBIE_BURCH RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     1e-46  42%  243 aa  UBIE_BURCA RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     1e-46  43%  243 aa  UBIE_BURM1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     1e-46  42%  243 aa  UBIE_BURCJ RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     1e-46  42%  243 aa  UBIE_BURCC RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     2e-46  43%  243 aa  UBIE_BURS3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     2e-46  42%  243 aa  UBIE_BURCM RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     2e-46  42%  243 aa  UBIE_BURA4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     4e-46  43%  243 aa  UBIE_BURVG RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::248     7e-46  39%  249 aa  UBIE_TERTT RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     7e-46  40%  251 aa  UBIE_IDILO RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     9e-46  39%  251 aa  UBIE_ENTS8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-45  38%  251 aa  UBIE_PROMH RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     2e-45  39%  269 aa  UBIE_BRUME RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     2e-45  39%  269 aa  UBIE_BRUMB RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     2e-45  39%  269 aa  UBIE_BRUAB RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     2e-45  39%  269 aa  UBIE_BRUA2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     2e-45  39%  269 aa  UBIE_BRUA1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-45  38%  251 aa  UBIE_KLEP3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     5e-45  39%  269 aa  UBIE_BRUSU RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     5e-45  39%  269 aa  UBIE_BRUC2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPY RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPP RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPN RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPG RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPE RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPB RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     6e-45  38%  251 aa  UBIE_YERP3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     1e-44  39%  251 aa  UBIE_SHEAM RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     1e-44  38%  251 aa  UBIE_KLEP7 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::248     1e-44  39%  249 aa  UBIE_SACD2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   34::268     1e-44  39%  269 aa  UBIE_BRUSI RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::269     2e-44  41%  291 aa  UBIE_RHOBA RecName: Full=Menaquinone biosynthesis methyltransferase
   28::262     2e-44  38%  263 aa  UBIE_OCHA4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-44  38%  250 aa  UBIE_FRAP2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-44  38%  251 aa  UBIE_YERE8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     3e-44  38%  251 aa  UBIE_SHEWM RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     3e-44  39%  251 aa  UBIE_SHEON RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     4e-44  38%  251 aa  UBIE_SHESW RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     4e-44  38%  251 aa  UBIE_SHEPC RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     4e-44  39%  250 aa  UBIE_LEGPC RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     4e-44  39%  250 aa  UBIE_LEGPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   17::248     4e-44  39%  249 aa  UBIE_CELJU RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     5e-44  38%  251 aa  UBIE_SHEB9 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     5e-44  38%  251 aa  UBIE_SHEB8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     5e-44  38%  251 aa  UBIE_SHEB5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     5e-44  38%  251 aa  UBIE_SHEB2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     5e-44  39%  250 aa  UBIE_LEGPL RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     7e-44  38%  251 aa  UBIE_SHESR RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     7e-44  38%  251 aa  UBIE_SHESM RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     7e-44  38%  251 aa  UBIE_SHESA RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     7e-44  40%  243 aa  UBIE_BURPP RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     9e-44  39%  250 aa  UBIE_LEGPH RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     1e-43  37%  251 aa  UBIE_SERP5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     1e-43  37%  251 aa  UBIE_ERWT9 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     1e-43  37%  251 aa  UBIE_SHESH RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     1e-43  38%  251 aa  UBIE_MARMS RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     1e-43  40%  243 aa  UBIE_BURXL RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-43  38%  250 aa  UBIE_FRATN RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  38%  251 aa  UBIE_ESCF3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     2e-43  40%  243 aa  UBIE_BURP8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_SHISS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_SHIFL RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_SHIF8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_SHIDS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_SHIBS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_SHIB3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-43  38%  250 aa  UBIE_FRATM RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOSM RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOSE RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOLU RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOLI RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOLC RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOHS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECODH RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECOBW RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO8A RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO7I RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO5E RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO57 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO55 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO27 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-43  37%  251 aa  UBIE_ECO24 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     3e-43  37%  251 aa  UBIE_SHEHH RecName: Full=Ubiquinone/menaquinone biosynthesis
   21::250     4e-43  38%  251 aa  UBIE_ENT38 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     4e-43  37%  251 aa  UBIE_ECOUT RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     4e-43  37%  251 aa  UBIE_ECOL6 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     4e-43  37%  251 aa  UBIE_ECOL5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     4e-43  37%  251 aa  UBIE_ECOK1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     4e-43  37%  251 aa  UBIE_ECO81 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     4e-43  37%  251 aa  UBIE_ECO45 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  38%  250 aa  UBIE_FRATW RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  38%  250 aa  UBIE_FRATT RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  38%  250 aa  UBIE_FRAT1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  37%  250 aa  UBIE_COXBU RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  37%  250 aa  UBIE_COXBR RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  37%  250 aa  UBIE_COXBN RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     6e-43  37%  250 aa  UBIE_COXB2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     7e-43  37%  251 aa  UBIE_SHEPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     7e-43  37%  251 aa  UBIE_PSYIN RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     7e-43  38%  251 aa  UBIE_PECCP RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     7e-43  38%  251 aa  UBIE_ERWCT RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     9e-43  38%  251 aa  UBIE_SHEFN RecName: Full=Ubiquinone/menaquinone biosynthesis
   11::247     1e-42  39%  251 aa  UBIE_SYMTH RecName: Full=Menaquinone biosynthesis methyltransferase
   23::255     1e-42  38%  256 aa  UBIE_PSEU5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::258     1e-42  38%  259 aa  UBIE_HAEDU RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     2e-42  38%  251 aa  UBIE_SHEDO RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     2e-42  37%  251 aa  UBIE_PHOLL RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-42  37%  250 aa  UBIE_FRATO RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-42  37%  250 aa  UBIE_FRATH RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-42  37%  250 aa  UBIE_FRATF RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     3e-42  37%  251 aa  UBIE_SHEPW RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALTY RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALTI RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALSV RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALPK RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALPC RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALPB RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALNS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALHS RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALG2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALEP RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALDC RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALCH RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     3e-42  36%  251 aa  UBIE_SALA4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   21::250     4e-42  36%  251 aa  UBIE_EDWI9 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     5e-42  37%  251 aa  UBIE_PSEHT RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     5e-42  37%  250 aa  UBIE_COXB1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   17::250     5e-42  41%  252 aa  UBIE_CAUSK RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     6e-42  38%  256 aa  UBIE_PSEA7 RecName: Full=Ubiquinone/menaquinone biosynthesis
   20::252     6e-42  37%  253 aa  UBIE_AZOVD RecName: Full=Ubiquinone/menaquinone biosynthesis
   25::259     8e-42  37%  260 aa  UBIE_BART1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     1e-41  36%  251 aa  UBIE_SALAR RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     1e-41  36%  251 aa  UBIE_CITK8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   28::259     1e-41  38%  260 aa  UBIE_BARBK RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-41  37%  256 aa  UBIE_PSEE4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-41  37%  256 aa  UBIE_PSEAE RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-41  37%  256 aa  UBIE_PSEAB RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-41  37%  256 aa  UBIE_PSEA8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-41  37%  256 aa  UBIE_PSEPU RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     3e-41  37%  256 aa  UBIE_PSEPK RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     3e-41  37%  256 aa  UBIE_PSEP1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     3e-41  37%  256 aa  UBIE_PSEMY RecName: Full=Ubiquinone/menaquinone biosynthesis
   28::259     3e-41  36%  260 aa  UBIE_BARQU RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     4e-41  37%  256 aa  UBIE_PSEPG RecName: Full=Ubiquinone/menaquinone biosynthesis
   35::267     4e-41  36%  268 aa  UBIE_PASMU RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     5e-41  37%  256 aa  UBIE_PSEPF RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     7e-41  38%  250 aa  UBIE_SILST RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     7e-41  37%  256 aa  UBIE_PSEFS RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     9e-41  36%  256 aa  UBIE_PSEPW RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-40  37%  256 aa  UBIE_PSEU2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     2e-40  37%  256 aa  UBIE_PSE14 RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     2e-40  38%  253 aa  UBIE_XANOM RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::242     2e-40  41%  243 aa  UBIE_RALEH RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::235     2e-40  36%  235 aa  UBIE_GEOUR RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::257     3e-40  38%  258 aa  UBIE_RHILO RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     3e-40  40%  243 aa  UBIE_RALEJ RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::235     3e-40  36%  235 aa  UBIE_GEOSF RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::238     3e-40  37%  238 aa  UBIE_WOLWR RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::255     3e-40  37%  256 aa  UBIE_PSESM RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     4e-40  40%  243 aa  UBIE_CUPTR RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::250     7e-40  37%  252 aa  UBIE_METNO RecName: Full=Ubiquinone/menaquinone biosynthesis
   28::259     7e-40  36%  260 aa  UBIE_BARHE RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     1e-39  38%  253 aa  UBIE_XANCP RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::235     1e-39  36%  235 aa  UBIE_GEOSM RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     1e-39  38%  253 aa  UBIE_XANAC RecName: Full=Ubiquinone/menaquinone biosynthesis
   25::253     1e-39  36%  256 aa  UBIE_GEOSL RecName: Full=Ubiquinone/menaquinone biosynthesis
   43::309     2e-39  40%  310 aa  COQ5_XENLA RecName: Full=Ubiquinone biosynthesis methyltransferase
    7::238     2e-39  36%  238 aa  UBIE_WOLPM RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::250     2e-39  35%  251 aa  UBIE_SHELP RecName: Full=Ubiquinone/menaquinone biosynthesis
   15::244     4e-39  38%  245 aa  UBIE_NEIM0 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     4e-39  38%  250 aa  UBIE_DINSH RecName: Full=Ubiquinone/menaquinone biosynthesis
   25::252     4e-39  39%  256 aa  UBIE_BORA1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   32::253     5e-39  38%  254 aa  UBIE_THICR RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::242     5e-39  38%  243 aa  UBIE_RALME RecName: Full=Ubiquinone/menaquinone biosynthesis
   15::244     5e-39  38%  245 aa  UBIE_NEIMF RecName: Full=Ubiquinone/menaquinone biosynthesis
   15::244     6e-39  37%  245 aa  UBIE_NEIMB RecName: Full=Ubiquinone/menaquinone biosynthesis
   22::250     6e-39  39%  252 aa  UBIE_CAUCR RecName: Full=Ubiquinone/menaquinone biosynthesis
   22::250     6e-39  39%  252 aa  UBIE_CAUCN RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::258     8e-39  35%  259 aa  UBIE_VIBHB RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     8e-39  38%  253 aa  UBIE_STRM5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   15::244     8e-39  37%  245 aa  UBIE_NEIMA RecName: Full=Ubiquinone/menaquinone biosynthesis
   14::243     8e-39  38%  244 aa  UBIE_LARHH RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::235     8e-39  35%  235 aa  UBIE_GEOBB RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     1e-38  37%  250 aa  UBIE_ROSDO RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::240     1e-38  41%  243 aa  UBIE_RALSO RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::258     1e-38  34%  259 aa  UBIE_VIBPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::240     1e-38  40%  243 aa  UBIE_RALPJ RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::326     1e-38  38%  327 aa  COQ5_DANRE RecName: Full=Ubiquinone biosynthesis methyltransferase
   23::252     2e-38  38%  253 aa  UBIE_XYLFM RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     2e-38  38%  253 aa  UBIE_XYLFA RecName: Full=Ubiquinone/menaquinone biosynthesis
   15::244     2e-38  37%  245 aa  UBIE_NEIG2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   15::244     2e-38  37%  245 aa  UBIE_NEIG1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     2e-38  38%  253 aa  UBIE_STRMK RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     3e-38  37%  253 aa  UBIE_XYLFT RecName: Full=Ubiquinone/menaquinone biosynthesis
   23::252     3e-38  37%  253 aa  UBIE_XYLF2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::326     3e-38  39%  327 aa  COQ5_RAT RecName: Full=Ubiquinone biosynthesis methyltransferase
   61::326     3e-38  38%  327 aa  COQ5_MOUSE RecName: Full=Ubiquinone biosynthesis methyltransferase
   27::259     4e-38  34%  260 aa  UBIE_VIBVY RecName: Full=Ubiquinone/menaquinone biosynthesis
   27::259     4e-38  34%  260 aa  UBIE_VIBVU RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::254     7e-38  39%  258 aa  UBIE_BORPE RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::254     7e-38  39%  258 aa  UBIE_BORPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::254     7e-38  39%  258 aa  UBIE_BORBR RecName: Full=Ubiquinone/menaquinone biosynthesis
   24::253     9e-38  36%  254 aa  UBIE_BLOFL RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::326     9e-38  38%  327 aa  COQ5_HUMAN RecName: Full=Ubiquinone biosynthesis methyltransferase
   61::326     9e-38  38%  330 aa  COQ5_BOVIN RecName: Full=Ubiquinone biosynthesis methyltransferase
   27::259     1e-37  34%  260 aa  UBIE_VIBCM RecName: Full=Ubiquinone/menaquinone biosynthesis
   27::259     1e-37  34%  260 aa  UBIE_VIBCH RecName: Full=Ubiquinone/menaquinone biosynthesis
   27::259     1e-37  34%  260 aa  UBIE_VIBC3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::326     2e-37  38%  327 aa  COQ5_PONAB RecName: Full=Ubiquinone biosynthesis methyltransferase
   17::252     3e-37  35%  253 aa  UBIE_RHOP2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   20::252     3e-37  36%  253 aa  UBIE_NITHX RecName: Full=Ubiquinone/menaquinone biosynthesis
   20::252     3e-37  35%  253 aa  UBIE_BRAJA RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::252     8e-37  34%  253 aa  UBIE_RHOPT RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::252     8e-37  34%  253 aa  UBIE_RHOPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   14::243     8e-37  35%  244 aa  UBIE_NITEU RecName: Full=Ubiquinone/menaquinone biosynthesis
   19::248     8e-37  37%  249 aa  UBIE_HAHCH RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::229     1e-36  38%  231 aa  UBIE_STRAW RecName: Full=Menaquinone biosynthesis methyltransferase
   14::243     1e-36  37%  244 aa  UBIE_CHRVO RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::252     1e-36  34%  253 aa  UBIE_RHOPS RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::257     2e-36  36%  258 aa  UBIE_RHISN RecName: Full=Ubiquinone/menaquinone biosynthesis
   22::249     2e-36  38%  252 aa  UBIE_PHEZH RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     2e-36  37%  250 aa  UBIE_RHOS5 RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::229     3e-36  37%  231 aa  UBIE_STRCO RecName: Full=Menaquinone biosynthesis methyltransferase
   26::257     3e-36  35%  258 aa  UBIE_SINMW RecName: Full=Ubiquinone/menaquinone biosynthesis
   10::236     4e-36  36%  238 aa  UBIE_ROSCS RecName: Full=Menaquinone biosynthesis methyltransferase
   53::313     4e-36  36%  314 aa  COQ5_DICDI RecName: Full=Ubiquinone biosynthesis methyltransferase
   26::257     5e-36  35%  258 aa  UBIE_RHIME RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     5e-36  35%  250 aa  UBIE_PARDP RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     7e-36  37%  250 aa  UBIE_RHOSK RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     7e-36  37%  250 aa  UBIE_RHOS4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   18::249     7e-36  37%  250 aa  UBIE_RHOS1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   53::282     7e-36  36%  285 aa  COQ5_CAEEL RecName: Full=Ubiquinone biosynthesis methyltransferase
   15::245     9e-36  33%  245 aa  UBIE_BACV8 RecName: Full=Menaquinone biosynthesis methyltransferase
   15::235     1e-35  36%  237 aa  UBIE_NOCFA RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     1e-35  37%  231 aa  UBIE_MYCMM RecName: Full=Menaquinone biosynthesis methyltransferase
   26::257     1e-35  34%  258 aa  UBIE_RHILW RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::245     1e-35  32%  245 aa  UBIE_PORGI RecName: Full=Menaquinone biosynthesis methyltransferase
   16::245     1e-35  32%  245 aa  UBIE_PORG3 RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     1e-35  38%  230 aa  UBIE_MYCSJ RecName: Full=Menaquinone biosynthesis methyltransferase
   44::293     1e-35  34%  294 aa  COQ5_ORYSJ RecName: Full=Ubiquinone biosynthesis methyltransferase
   10::236     2e-35  35%  238 aa  UBIE_ROSS1 RecName: Full=Menaquinone biosynthesis methyltransferase
   16::247     2e-35  37%  248 aa  UBIE_RICCK RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::257     2e-35  35%  258 aa  UBIE_RHIEC RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::223     2e-35  37%  230 aa  UBIE_CORGB RecName: Full=Menaquinone biosynthesis methyltransferase
   16::247     2e-35  36%  248 aa  UBIE_RICTY RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::247     2e-35  37%  248 aa  UBIE_RICAH RecName: Full=Ubiquinone/menaquinone biosynthesis
   14::243     2e-35  33%  244 aa  UBIE_NITMU RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::223     2e-35  37%  230 aa  UBIE_CORGL RecName: Full=Menaquinone biosynthesis methyltransferase
   26::257     3e-35  34%  258 aa  UBIE_RHIL3 RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::227     3e-35  37%  231 aa  UBIE_MYCUA RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     3e-35  37%  230 aa  UBIE_MYCSS RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     3e-35  37%  230 aa  UBIE_MYCSK RecName: Full=Menaquinone biosynthesis methyltransferase
   47::310     3e-35  38%  311 aa  COQ5_CHICK RecName: Full=Ubiquinone biosynthesis methyltransferase
   15::247     4e-35  33%  248 aa  UBIE_METCA RecName: Full=Ubiquinone/menaquinone biosynthesis
   21::253     4e-35  32%  254 aa  UBIE_BLOPB RecName: Full=Ubiquinone/menaquinone biosynthesis
   13::227     6e-35  39%  229 aa  UBIE_MYCS2 RecName: Full=Menaquinone biosynthesis methyltransferase
   16::247     7e-35  37%  248 aa  UBIE_RICFE RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::257     7e-35  34%  258 aa  UBIE_RHIE6 RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::227     7e-35  36%  234 aa  UBIE_MYCTU RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     7e-35  36%  234 aa  UBIE_MYCTA RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     7e-35  36%  234 aa  UBIE_MYCBT RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     7e-35  36%  234 aa  UBIE_MYCBP RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     7e-35  36%  234 aa  UBIE_MYCBO RecName: Full=Menaquinone biosynthesis methyltransferase
   13::224     7e-35  37%  227 aa  UBIE_MYCA9 RecName: Full=Menaquinone biosynthesis methyltransferase
   23::257     7e-35  34%  258 aa  UBIE_AGRVS RecName: Full=Ubiquinone/menaquinone biosynthesis
   55::300     7e-35  34%  301 aa  COQ5_DROME RecName: Full=Ubiquinone biosynthesis methyltransferase
   16::243     1e-34  38%  248 aa  UBIE_RICRS RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::243     1e-34  38%  248 aa  UBIE_RICRO RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::243     1e-34  38%  248 aa  UBIE_RICCN RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::243     1e-34  38%  248 aa  UBIE_RICAE RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::225     1e-34  36%  240 aa  UBIE_BEUC1 RecName: Full=Menaquinone biosynthesis methyltransferase
   24::258     1e-34  34%  259 aa  UBIE_AGRT5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   21::248     1e-34  35%  249 aa  UBIE_ACICJ RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::241     2e-34  34%  242 aa  UBIE_ZYMMO RecName: Full=Ubiquinone/menaquinone biosynthesis
    9::225     2e-34  34%  233 aa  UBIE_SYNP6 RecName: Full=Menaquinone biosynthesis methyltransferase
    9::225     2e-34  34%  233 aa  UBIE_SYNE7 RecName: Full=Menaquinone biosynthesis methyltransferase
   16::243     2e-34  37%  248 aa  UBIE_RICM5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   20::252     2e-34  34%  253 aa  UBIE_BRASB RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::243     3e-34  38%  248 aa  UBIE_RICPU RecName: Full=Ubiquinone/menaquinone biosynthesis
   20::252     3e-34  34%  253 aa  UBIE_BRASO RecName: Full=Ubiquinone/menaquinone biosynthesis
   17::245     3e-34  32%  245 aa  UBIE_BACTN RecName: Full=Menaquinone biosynthesis methyltransferase
   26::257     3e-34  34%  258 aa  UBIE_AGRRK RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::247     4e-34  36%  248 aa  UBIE_RICPR RecName: Full=Ubiquinone/menaquinone biosynthesis
   14::247     4e-34  35%  248 aa  UBIE_RICB8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   17::245     4e-34  33%  245 aa  UBIE_BACFR RecName: Full=Menaquinone biosynthesis methyltransferase
   17::245     4e-34  33%  245 aa  UBIE_BACFN RecName: Full=Menaquinone biosynthesis methyltransferase
   38::283     5e-34  37%  288 aa  COQ5_ARATH RecName: Full=Ubiquinone biosynthesis methyltransferase
    7::227     6e-34  36%  229 aa  UBIE_CORK4 RecName: Full=Menaquinone biosynthesis methyltransferase
   14::247     1e-33  35%  248 aa  UBIE_RICBR RecName: Full=Ubiquinone/menaquinone biosynthesis
    1::217     2e-33  35%  220 aa  UBIE_THET2 RecName: Full=Menaquinone biosynthesis methyltransferase
    7::227     2e-33  36%  228 aa  UBIE_MYCGI RecName: Full=Menaquinone biosynthesis methyltransferase
    7::229     2e-33  36%  237 aa  UBIE_RENSM RecName: Full=Menaquinone biosynthesis methyltransferase
   13::227     2e-33  37%  228 aa  UBIE_MYCVP RecName: Full=Menaquinone biosynthesis methyltransferase
   13::223     2e-33  36%  230 aa  UBIE_COREF RecName: Full=Menaquinone biosynthesis methyltransferase
    5::221     2e-33  33%  229 aa  UBIE_ANAVT RecName: Full=Menaquinone biosynthesis methyltransferase
   21::238     4e-33  34%  251 aa  UBIE_RHOGE RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::223     5e-33  36%  230 aa  UBIE_MYCPA RecName: Full=Menaquinone biosynthesis methyltransferase
    7::223     5e-33  36%  229 aa  UBIE_CORA7 RecName: Full=Menaquinone biosynthesis methyltransferase
    7::225     5e-33  36%  253 aa  UBIE_ARTAT RecName: Full=Menaquinone biosynthesis methyltransferase
   17::249     7e-33  31%  250 aa  UBIE_WIGBR RecName: Full=Ubiquinone/menaquinone biosynthesis
    4::221     9e-33  31%  229 aa  UBIE_ANASP RecName: Full=Menaquinone biosynthesis methyltransferase
    7::225     2e-32  37%  230 aa  UBIE_STRGG RecName: Full=Menaquinone biosynthesis methyltransferase
    5::221     2e-32  35%  230 aa  UBIE_NOSP7 RecName: Full=Menaquinone biosynthesis methyltransferase
    7::225     2e-32  34%  229 aa  UBIE_NOCSJ RecName: Full=Menaquinone biosynthesis methyltransferase
    4::225     6e-32  34%  225 aa  UBIE_THEEB RecName: Full=Menaquinone biosynthesis methyltransferase
    7::223     6e-32  35%  230 aa  UBIE_MYCLE RecName: Full=Menaquinone biosynthesis methyltransferase
   21::246     7e-32  36%  246 aa  UBIE_DESPS RecName: Full=Ubiquinone/menaquinone biosynthesis
   11::227     1e-31  36%  230 aa  UBIE_CORU7 RecName: Full=Menaquinone biosynthesis methyltransferase
    9::232     2e-31  33%  245 aa  UBIE_CLAMS RecName: Full=Menaquinone biosynthesis methyltransferase
   13::242     4e-31  31%  242 aa  UBIE_CHLTE RecName: Full=Menaquinone biosynthesis methyltransferase
    9::230     3e-30  32%  237 aa  UBIE_PELCD RecName: Full=Ubiquinone/menaquinone biosynthesis
   11::232     7e-30  33%  235 aa  UBIE_BDEBA RecName: Full=Ubiquinone/menaquinone biosynthesis
   11::224     9e-30  34%  238 aa  UBIE_SYNY3 RecName: Full=Menaquinone biosynthesis methyltransferase
   25::243     3e-29  34%  244 aa  UBIE_THIDA RecName: Full=Ubiquinone/menaquinone biosynthesis
   12::241     6e-29  30%  241 aa  UBIE_CHLP8 RecName: Full=Menaquinone biosynthesis methyltransferase
    3::234     8e-29  33%  235 aa  UBIE_CAMJ8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   12::240     1e-28  34%  241 aa  UBIE_DEIRA RecName: Full=Menaquinone biosynthesis methyltransferase
    3::234     2e-28  33%  235 aa  UBIE_CAMJE RecName: Full=Ubiquinone/menaquinone biosynthesis
    3::234     5e-28  33%  235 aa  UBIE_CAMJR RecName: Full=Ubiquinone/menaquinone biosynthesis
    3::234     5e-28  33%  235 aa  UBIE_CAMJJ RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::234     7e-28  31%  236 aa  UBIE_THEFY RecName: Full=Menaquinone biosynthesis methyltransferase
   18::255     2e-27  33%  288 aa  A41_LEIDO RecName: Full=Putative ubiquinone biosynthesis
   13::226     2e-27  33%  230 aa  UBIE_CHLCV RecName: Full=Menaquinone biosynthesis methyltransferase
   58::304     2e-27  34%  305 aa  COQ5_SCHPO RecName: Full=Ubiquinone biosynthesis methyltransferase
   59::306     9e-27  33%  307 aa  COQ5_YEAST RecName: Full=Ubiquinone biosynthesis methyltransferase
   12::225     3e-26  33%  229 aa  UBIE_THEMA RecName: Full=Menaquinone biosynthesis methyltransferase
   20::244     3e-26  34%  249 aa  UBIE_LEPIN RecName: Full=Menaquinone biosynthesis methyltransferase
   20::244     3e-26  34%  249 aa  UBIE_LEPIC RecName: Full=Menaquinone biosynthesis methyltransferase
   23::170     8e-26  37%  170 aa  UBIE_PSEOL RecName: Full=Ubiquinone/menaquinone biosynthesis
    7::239     1e-24  28%  242 aa  UBIE_PARUW RecName: Full=Menaquinone biosynthesis methyltransferase
   13::222     5e-23  30%  230 aa  UBIE_CHLPN RecName: Full=Menaquinone biosynthesis methyltransferase
    7::226     2e-22  30%  230 aa  UBIE_CHLFF RecName: Full=Menaquinone biosynthesis methyltransferase
   13::226     9e-22  28%  229 aa  UBIE_CHLTR RecName: Full=Menaquinone biosynthesis methyltransferase
   13::226     9e-22  28%  229 aa  UBIE_CHLTB RecName: Full=Menaquinone biosynthesis methyltransferase
   13::226     9e-22  28%  229 aa  UBIE_CHLTA RecName: Full=Menaquinone biosynthesis methyltransferase
   13::226     9e-22  28%  229 aa  UBIE_CHLT2 RecName: Full=Menaquinone biosynthesis methyltransferase
    5::226     2e-20  27%  229 aa  UBIE_CHLMU RecName: Full=Menaquinone biosynthesis methyltransferase
  122::245     2e-19  38%  254 aa  UBIE_FRASN RecName: Full=Menaquinone biosynthesis methyltransferase
   19::232     9e-19  29%  239 aa  UBIE_TROWT RecName: Full=Menaquinone biosynthesis methyltransferase
   19::232     9e-19  29%  239 aa  UBIE_TROW8 RecName: Full=Menaquinone biosynthesis methyltransferase
  112::227     9e-12  30%  345 aa  YT37_STRFR RecName: Full=Uncharacterized 37.1 kDa protein in
   32::151     2e-11  34%  278 aa  YE16_SCHPO RecName: Full=Uncharacterized methyltransferase
    2::131     7e-11  34%  247 aa  YQEM_BACSU RecName: Full=Uncharacterized protein yqeM;
   43::198     1e-09  32%  212 aa  Y829_SYNY3 RecName: Full=Uncharacterized methyltransferase sll0829;
   24::139     3e-09  34%  251 aa  Y095_HAEIN RecName: Full=Uncharacterized protein HI0095;
   40::145     4e-09  26%  253 aa  YCGJ_BACSU RecName: Full=Uncharacterized methyltransferase ycgJ;   
   50::214     5e-09  33%  237 aa  UBIG_METCA RecName: Full=3-demethylubiquinone-9
  118::235     5e-09  31%  361 aa  SMT2_ARATH RecName: Full=24-methylenesterol C-methyltransferase 2; 
   96::198     7e-09  34%  344 aa  SMT1_ORYSJ RecName: Full=Cycloartenol-C-24-methyltransferase 1;    
   96::223     9e-09  30%  378 aa  ERG6_SCHPO RecName: Full=Sterol 24-C-methyltransferase;       
  130::235     9e-09  31%  390 aa  ERG6_MAGGR RecName: Full=Sterol 24-C-methyltransferase;       
   52::150     2e-08  36%  234 aa  UBIG_VIBFM RecName: Full=3-demethylubiquinone-9
   13::102     3e-08  30%  207 aa  YAFE_ECOLI RecName: Full=Uncharacterized protein yafE;
   50::159     3e-08  28%  274 aa  Y1440_MYCBO RecName: Full=Uncharacterized protein Mb1440c;Flags:
   50::159     3e-08  28%  274 aa  Y1405_MYCTU RecName: Full=Uncharacterized protein
   52::150     3e-08  36%  234 aa  UBIG_VIBF1 RecName: Full=3-demethylubiquinone-9
    4::151     3e-08  30%  247 aa  BIOC_BUCBP RecName: Full=Biotin synthesis protein bioC;
  118::235     3e-08  29%  359 aa  SMT3B_ARATH RecName: Full=24-methylenesterol C-methyltransferase 3;
   52::222     6e-08  28%  238 aa  UBIG_RALSO RecName: Full=3-demethylubiquinone-9
   48::146     8e-08  37%  232 aa  UBIG_PSESM RecName: Full=3-demethylubiquinone-9
  112::210     8e-08  29%  354 aa  SMT1_DICDI RecName: Full=Probable
  184::290     1e-07  34%  352 aa  Y2104_ARATH RecName: Full=Uncharacterized methyltransferase
   25::142     1e-07  35%  251 aa  Y1252_METJA RecName: Full=Uncharacterized protein MJ1252;
   39::146     1e-07  36%  232 aa  UBIG_PSEFS RecName: Full=3-demethylubiquinone-9
  118::233     1e-07  29%  363 aa  SMT2_ORYSJ RecName: Full=24-methylenesterol C-methyltransferase 2; 
  124::227     1e-07  32%  381 aa  ERG6_YARLI RecName: Full=Sterol 24-C-methyltransferase;       
   48::173     2e-07  32%  232 aa  UBIG_PSEU5 RecName: Full=3-demethylubiquinone-9
   39::146     2e-07  38%  232 aa  UBIG_PSEPF RecName: Full=3-demethylubiquinone-9
   48::146     2e-07  39%  232 aa  UBIG_PSEE4 RecName: Full=3-demethylubiquinone-9
   33::206     2e-07  26%  336 aa  SMT1_ARATH RecName: Full=Cycloartenol-C-24-methyltransferase;      
   28::138     2e-07  34%  203 aa  PMTA_RHOSH RecName: Full=Phosphatidylethanolamine
  124::227     2e-07  31%  379 aa  ERG6_NEUCR RecName: Full=Sterol 24-C-methyltransferase;       
   48::146     2e-07  37%  232 aa  UBIG_PSEPK RecName: Full=3-demethylubiquinone-9
   48::146     2e-07  37%  232 aa  UBIG_PSEPG RecName: Full=3-demethylubiquinone-9
   48::146     2e-07  37%  232 aa  UBIG_PSEP1 RecName: Full=3-demethylubiquinone-9
   48::146     2e-07  39%  232 aa  UBIG_PSEF5 RecName: Full=3-demethylubiquinone-9
   48::205     3e-07  31%  232 aa  UBIG_PSEAE RecName: Full=3-demethylubiquinone-9
   48::205     3e-07  31%  232 aa  UBIG_PSEAB RecName: Full=3-demethylubiquinone-9
   48::205     3e-07  31%  232 aa  UBIG_PSEA8 RecName: Full=3-demethylubiquinone-9
   48::146     4e-07  39%  232 aa  UBIG_THIDA RecName: Full=3-demethylubiquinone-9
   51::150     4e-07  32%  237 aa  UBIG_ACIBY RecName: Full=3-demethylubiquinone-9
   51::150     4e-07  32%  237 aa  UBIG_ACIBS RecName: Full=3-demethylubiquinone-9
   51::150     4e-07  32%  237 aa  UBIG_ACIB5 RecName: Full=3-demethylubiquinone-9
   51::150     4e-07  32%  237 aa  UBIG_ACIB3 RecName: Full=3-demethylubiquinone-9
   51::151     4e-07  32%  238 aa  UBIG_ACIAC RecName: Full=3-demethylubiquinone-9
   48::146     5e-07  35%  232 aa  UBIG_PSEU2 RecName: Full=3-demethylubiquinone-9
   48::146     5e-07  38%  232 aa  UBIG_PSEPW RecName: Full=3-demethylubiquinone-9
   48::146     5e-07  35%  232 aa  UBIG_PSE14 RecName: Full=3-demethylubiquinone-9
   51::150     5e-07  31%  237 aa  UBIG_ACIBC RecName: Full=3-demethylubiquinone-9
   62::160     8e-07  32%  245 aa  UBIG_VIBCM RecName: Full=3-demethylubiquinone-9
   62::160     8e-07  32%  245 aa  UBIG_VIBCH RecName: Full=3-demethylubiquinone-9
   62::160     8e-07  32%  245 aa  UBIG_VIBC3 RecName: Full=3-demethylubiquinone-9
   49::147     8e-07  32%  234 aa  UBIG_AZOSE RecName: Full=3-demethylubiquinone-9
   81::176     8e-07  29%  258 aa  PHMT2_MYCUA RecName: Full=Probable phthiotriol/phenolphthiotriol
  124::225     1e-06  28%  377 aa  ERG6_PNECA RecName: Full=Sterol 24-C-methyltransferase;       
   48::146     1e-06  38%  232 aa  UBIG_PSEA7 RecName: Full=3-demethylubiquinone-9
   58::222     1e-06  30%  241 aa  UBIG_BORA1 RecName: Full=3-demethylubiquinone-9
   71::182     1e-06  29%  376 aa  AS3MT_MOUSE RecName: Full=Arsenite methyltransferase;       
   52::150     2e-06  34%  235 aa  UBIG_VIBPA RecName: Full=3-demethylubiquinone-9
   51::150     2e-06  31%  238 aa  UBIG_ACIAD RecName: Full=3-demethylubiquinone-9
  211::291     2e-06  33%  387 aa  Y1649_METJA RecName: Full=Putative ribosomal RNA large subunit
   79::186     2e-06  27%  225 aa  PIMT_CAEEL RecName: Full=Protein-L-isoaspartate
   81::176     2e-06  29%  270 aa  PHMT_MYCTU RecName: Full=Phthiotriol/phenolphthiotriol
   81::176     2e-06  29%  270 aa  PHMT_MYCTA RecName: Full=Phthiotriol/phenolphthiotriol
   81::176     2e-06  29%  270 aa  PHMT_MYCBP RecName: Full=Phthiotriol/phenolphthiotriol
   81::176     2e-06  29%  270 aa  PHMT_MYCBO RecName: Full=Phthiotriol/phenolphthiotriol
   57::155     3e-06  32%  245 aa  UBIG_PROMH RecName: Full=3-demethylubiquinone-9
   48::146     3e-06  29%  232 aa  UBIG_BURVG RecName: Full=3-demethylubiquinone-9
   48::146     3e-06  30%  232 aa  UBIG_BURM1 RecName: Full=3-demethylubiquinone-9
   48::146     3e-06  31%  232 aa  UBIG_BURCJ RecName: Full=3-demethylubiquinone-9
  263::377     3e-06  34%  498 aa  THUM2_MOUSE RecName: Full=THUMP domain-containing protein 2;
  263::377     3e-06  33%  473 aa  THUM2_HUMAN RecName: Full=THUMP domain-containing protein 2;
   36::142     3e-06  27%  199 aa  CBIT_SULIY RecName: Full=Probable cobalt-precorrin-6Y
   36::142     3e-06  27%  199 aa  CBIT_SULIN RecName: Full=Probable cobalt-precorrin-6Y
   36::142     3e-06  27%  199 aa  CBIT_SULIM RecName: Full=Probable cobalt-precorrin-6Y
   36::142     3e-06  27%  199 aa  CBIT_SULIL RecName: Full=Probable cobalt-precorrin-6Y
   36::142     3e-06  27%  199 aa  CBIT_SULIK RecName: Full=Probable cobalt-precorrin-6Y
   36::142     3e-06  27%  199 aa  CBIT_SULIA RecName: Full=Probable cobalt-precorrin-6Y
   58::156     4e-06  34%  243 aa  UBIG_IDILO RecName: Full=3-demethylubiquinone-9
   48::146     4e-06  30%  232 aa  UBIG_BURCH RecName: Full=3-demethylubiquinone-9
   48::146     4e-06  30%  232 aa  UBIG_BURCC RecName: Full=3-demethylubiquinone-9
   48::146     4e-06  30%  232 aa  UBIG_BURCA RecName: Full=3-demethylubiquinone-9
   81::178     4e-06  30%  270 aa  PHMT_MYCLE RecName: Full=Phthiotriol/phenolphthiotriol
  117::224     4e-06  29%  371 aa  ERG6_KLULA RecName: Full=Sterol 24-C-methyltransferase;       
    1::146     5e-06  23%  244 aa  YXBB_BACSU RecName: Full=Uncharacterized protein yxbB;
   52::150     5e-06  33%  235 aa  UBIG_VIBHB RecName: Full=3-demethylubiquinone-9
   57::155     5e-06  35%  242 aa  UBIG_KLEP3 RecName: Full=3-demethylubiquinone-9
   36::101     5e-06  32%  199 aa  CBIT_SULSO RecName: Full=Probable cobalt-precorrin-6Y
  210::290     7e-06  33%  385 aa  Y1653_METJA RecName: Full=Putative ribosomal RNA large subunit
   52::150     7e-06  33%  235 aa  UBIG_VIBVY RecName: Full=3-demethylubiquinone-9
   52::150     7e-06  33%  235 aa  UBIG_VIBVU RecName: Full=3-demethylubiquinone-9
   55::154     7e-06  30%  241 aa  UBIG_THICR RecName: Full=3-demethylubiquinone-9
   57::155     7e-06  35%  242 aa  UBIG_KLEP7 RecName: Full=3-demethylubiquinone-9
   48::146     7e-06  29%  232 aa  UBIG_BURCM RecName: Full=3-demethylubiquinone-9
   48::146     7e-06  29%  232 aa  UBIG_BURA4 RecName: Full=3-demethylubiquinone-9
   49::149     7e-06  29%  234 aa  UBIG_ACTP7 RecName: Full=3-demethylubiquinone-9
   52::150     9e-06  29%  235 aa  UBIG_PHOPR RecName: Full=3-demethylubiquinone-9
   54::215     9e-06  29%  248 aa  UBIG_DINSH RecName: Full=3-demethylubiquinone-9
   48::146     9e-06  29%  232 aa  UBIG_BURS3 RecName: Full=3-demethylubiquinone-9
   39::146     9e-06  37%  232 aa  UBIG_AZOVD RecName: Full=3-demethylubiquinone-9
   57::157     9e-06  34%  247 aa  UBIG_ALHEH RecName: Full=3-demethylubiquinone-9
   81::179     9e-06  27%  271 aa  PHMT1_MYCUA RecName: Full=Phthiotriol/phenolphthiotriol
   70::181     9e-06  29%  369 aa  AS3MT_RAT RecName: Full=Arsenite methyltransferase;       
   70::181     9e-06  29%  375 aa  AS3MT_HUMAN RecName: Full=Arsenite methyltransferase;       
   86::132     1e-05  47%  286 aa  Y0656_EMENI RecName: Full=Uncharacterized methyltransferase AN0656;
   48::148     1e-05  27%  235 aa  UBIG_LEPCP RecName: Full=3-demethylubiquinone-9
   49::149     1e-05  29%  234 aa  UBIG_ACTP2 RecName: Full=3-demethylubiquinone-9
  276::381     1e-05  25%  490 aa  PEAM3_ARATH RecName: Full=Putative phosphoethanolamine
  278::382     1e-05  27%  491 aa  PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase
   52::150     2e-05  35%  236 aa  UBIG_SHEB9 RecName: Full=3-demethylubiquinone-9
   52::150     2e-05  35%  236 aa  UBIG_SHEB8 RecName: Full=3-demethylubiquinone-9
   52::150     2e-05  35%  236 aa  UBIG_SHEB5 RecName: Full=3-demethylubiquinone-9
   52::150     2e-05  35%  236 aa  UBIG_SHEB2 RecName: Full=3-demethylubiquinone-9
   51::218     2e-05  27%  238 aa  UBIG_HAHCH RecName: Full=3-demethylubiquinone-9
   49::149     2e-05  30%  236 aa  UBIG_HAEDU RecName: Full=3-demethylubiquinone-9
   39::146     2e-05  39%  232 aa  UBIG_DECAR RecName: Full=3-demethylubiquinone-9
  297::400     2e-05  29%  449 aa  RUMA_MARAV RecName: Full=23S rRNA (uracil-5-)-methyltransferase
  285::361     2e-05  26%  463 aa  RUMA_ACIBS RecName: Full=23S rRNA (uracil-5-)-methyltransferase
  183::337     2e-05  30%  355 aa  Y1814_ARATH RecName: Full=Uncharacterized methyltransferase
   62::162     2e-05  29%  247 aa  UBIG_RHOS4 RecName: Full=3-demethylubiquinone-9
   57::155     2e-05  32%  240 aa  UBIG_PHOLL RecName: Full=3-demethylubiquinone-9
   55::153     2e-05  35%  239 aa  UBIG_PECCP RecName: Full=3-demethylubiquinone-9
   68::169     2e-05  30%  254 aa  UBIG_MARMM RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  31%  238 aa  UBIG_HAES2 RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  31%  238 aa  UBIG_HAES1 RecName: Full=3-demethylubiquinone-9
   55::153     2e-05  31%  241 aa  UBIG_ERWCT RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  30%  234 aa  UBIG_COXBU RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  30%  234 aa  UBIG_COXBR RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  30%  234 aa  UBIG_COXBN RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  30%  234 aa  UBIG_COXB2 RecName: Full=3-demethylubiquinone-9
   51::149     2e-05  30%  234 aa  UBIG_COXB1 RecName: Full=3-demethylubiquinone-9
   48::146     2e-05  33%  232 aa  UBIG_CHRVO RecName: Full=3-demethylubiquinone-9
   59::222     2e-05  29%  241 aa  UBIG_BORBR RecName: Full=3-demethylubiquinone-9
   52::150     2e-05  30%  238 aa  UBIG_AERS4 RecName: Full=3-demethylubiquinone-9
  285::361     2e-05  23%  463 aa  RUMA_ACIBY RecName: Full=23S rRNA (uracil-5-)-methyltransferase
  285::361     2e-05  23%  463 aa  RUMA_ACIBC RecName: Full=23S rRNA (uracil-5-)-methyltransferase
  284::360     2e-05  23%  462 aa  RUMA_ACIB5 RecName: Full=23S rRNA (uracil-5-)-methyltransferase
  285::361     2e-05  23%  463 aa  RUMA_ACIB3 RecName: Full=23S rRNA (uracil-5-)-methyltransferase
  281::385     2e-05  25%  494 aa  PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase; 
   17::157     2e-05  25%  235 aa  CMOA_SULNB RecName: Full=tRNA (cmo5U34)-methyltransferase;       
   40::153     2e-05  29%  201 aa  CBIT_THEVO RecName: Full=Probable cobalt-precorrin-6Y
   56::228     3e-05  23%  239 aa  UBIG_XANC5 RecName: Full=3-demethylubiquinone-9
   49::147     3e-05  29%  233 aa  UBIG_AZOSB RecName: Full=3-demethylubiquinone-9
  285::363     3e-05  24%  463 aa  RUMA_ACIAD RecName: Full=23S rRNA (uracil-5-)-methyltransferase
   78::180     3e-05  30%  227 aa  PIMT_MOUSE RecName: Full=Protein-L-isoaspartate(D-aspartate)
   78::180     3e-05  29%  228 aa  PIMT_DANRE RecName: Full=Protein-L-isoaspartate(D-aspartate)
  262::380     3e-05  27%  475 aa  PEAM2_ARATH RecName: Full=Putative phosphoethanolamine
   24::122     3e-05  28%  184 aa  CBIT_METMA RecName: Full=Probable cobalt-precorrin-6Y
   65::163     3e-05  31%  249 aa  UBIG_SODGM RecName: Full=3-demethylubiquinone-9
   52::150     3e-05  36%  236 aa  UBIG_SHESR RecName: Full=3-demethylubiquinone-9
   50::177     3e-05  29%  238 aa  UBIG_MARAV RecName: Full=3-demethylubiquinone-9
   57::155     3e-05  34%  240 aa  UBIG_ECO7I RecName: Full=3-demethylubiquinone-9
   48::146     3e-05  28%  232 aa  UBIG_BURXL RecName: Full=3-demethylubiquinone-9
   78::180     3e-05  29%  227 aa  PIMT_PIG RecName: Full=Protein-L-isoaspartate(D-aspartate)
   46::145     3e-05  24%  202 aa  CBIT_THEAC RecName: Full=Probable cobalt-precorrin-6Y
   56::228     5e-05  24%  239 aa  UBIG_XANCP RecName: Full=3-demethylubiquinone-9
   56::228     5e-05  24%  239 aa  UBIG_XANCB RecName: Full=3-demethylubiquinone-9
   56::228     5e-05  24%  239 aa  UBIG_XANC8 RecName: Full=3-demethylubiquinone-9
   67::161     5e-05  35%  246 aa  UBIG_COLP3 RecName: Full=3-demethylubiquinone-9
   57::155     5e-05  33%  242 aa  UBIG_CITK8 RecName: Full=3-demethylubiquinone-9
   59::222     5e-05  28%  241 aa  UBIG_BORPE RecName: Full=3-demethylubiquinone-9
   78::180     5e-05  30%  227 aa  PIMT_RAT RecName: Full=Protein-L-isoaspartate(D-aspartate)
    9::138     5e-05  27%  454 aa  K1456_HUMAN RecName: Full=Putative methyltransferase KIAA1456;     
    9::138     5e-05  27%  453 aa  K1456_BOVIN RecName: Full=Putative methyltransferase KIAA1456
   52::150     6e-05  30%  236 aa  UBIG_SHESW RecName: Full=3-demethylubiquinone-9
   52::150     6e-05  30%  236 aa  UBIG_SHEPC RecName: Full=3-demethylubiquinone-9
   57::155     6e-05  33%  242 aa  UBIG_SALPC RecName: Full=3-demethylubiquinone-9
   57::155     6e-05  33%  242 aa  UBIG_SALG2 RecName: Full=3-demethylubiquinone-9
   57::155     6e-05  33%  242 aa  UBIG_SALEP RecName: Full=3-demethylubiquinone-9
   57::155     6e-05  33%  242 aa  UBIG_SALCH RecName: Full=3-demethylubiquinone-9
   38::146     6e-05  28%  232 aa  UBIG_BURPP RecName: Full=3-demethylubiquinone-9
   38::146     6e-05  30%  232 aa  UBIG_BURP8 RecName: Full=3-demethylubiquinone-9
  130::237     6e-05  29%  312 aa  PRMA_CLOBM RecName: Full=Ribosomal protein L11 methyltransferase;  
  130::237     6e-05  29%  312 aa  PRMA_CLOBL RecName: Full=Ribosomal protein L11 methyltransferase;  
  130::237     6e-05  29%  312 aa  PRMA_CLOBK RecName: Full=Ribosomal protein L11 methyltransferase;  
  130::237     6e-05  29%  312 aa  PRMA_CLOBJ RecName: Full=Ribosomal protein L11 methyltransferase;  
  130::237     6e-05  29%  312 aa  PRMA_CLOBH RecName: Full=Ribosomal protein L11 methyltransferase;  
  173::237     6e-05  31%  312 aa  PRMA_CLOB6 RecName: Full=Ribosomal protein L11 methyltransferase;  
  130::237     6e-05  29%  312 aa  PRMA_CLOB1 RecName: Full=Ribosomal protein L11 methyltransferase;  
   78::180     6e-05  28%  228 aa  PIMT_CHICK RecName: Full=Protein-L-isoaspartate(D-aspartate)
   34::148     8e-05  27%  180 aa  YRHH_BACSU RecName: Full=Putative methyltransferase yrhH;       
   59::155     8e-05  34%  242 aa  UBIG_YERPY RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPS RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPP RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPN RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPG RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPE RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPB RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERPA RecName: Full=3-demethylubiquinone-9
   59::155     8e-05  34%  242 aa  UBIG_YERP3 RecName: Full=3-demethylubiquinone-9
   56::228     8e-05  23%  239 aa  UBIG_XANAC RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_SHISS RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_SHIFL RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_SHIF8 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_SHIDS RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_SHIBS RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_SHIB3 RecName: Full=3-demethylubiquinone-9
   61::155     8e-05  30%  241 aa  UBIG_SERP5 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALTY RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALTI RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALSV RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALNS RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALHS RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALDC RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  242 aa  UBIG_SALA4 RecName: Full=3-demethylubiquinone-9
   62::162     8e-05  28%  247 aa  UBIG_RHOSK RecName: Full=3-demethylubiquinone-9
   62::162     8e-05  28%  247 aa  UBIG_RHOS1 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  34%  242 aa  UBIG_ENT38 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOUT RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOSM RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOSE RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOLU RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOLI RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOLC RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOL6 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOL5 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOHS RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECODH RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECOBW RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO8A RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO81 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO5E RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO57 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO55 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO45 RecName: Full=3-demethylubiquinone-9
   57::155     8e-05  33%  240 aa  UBIG_ECO24 RecName: Full=3-demethylubiquinone-9
   76::180     8e-05  28%  227 aa  PIMT_BOVIN RecName: Full=Protein-L-isoaspartate(D-aspartate)
    9::138     8e-05  26%  447 aa  K1456_MOUSE RecName: Full=Putative methyltransferase KIAA1456;     
   57::155     1e-04  33%  242 aa  UBIG_SALAR RecName: Full=3-demethylubiquinone-9
   63::163     1e-04  29%  248 aa  UBIG_ROSDO RecName: Full=3-demethylubiquinone-9
   57::155     1e-04  28%  243 aa  UBIG_ENTS8 RecName: Full=3-demethylubiquinone-9
   57::155     1e-04  33%  240 aa  UBIG_ECO27 RecName: Full=3-demethylubiquinone-9
  101::175     1e-04  24%  433 aa  TRM61_CRYNE RecName: Full=tRNA (adenine-N(1)-)-methyltransferase
   71::180     1e-04  22%  219 aa  PIMT2_ARCFU RecName: Full=Protein-L-isoaspartate
   37::131     1e-04  28%  192 aa  CBIT_METTH RecName: Full=Probable cobalt-precorrin-6Y
   43::144     1e-04  26%  250 aa  Y028_RICPR RecName: Full=Uncharacterized protein RP028;
   56::228     1e-04  23%  239 aa  UBIG_XANOR RecName: Full=3-demethylubiquinone-9
   56::228     1e-04  23%  239 aa  UBIG_XANOP RecName: Full=3-demethylubiquinone-9
   56::228     1e-04  23%  239 aa  UBIG_XANOM RecName: Full=3-demethylubiquinone-9
   52::150     1e-04  30%  237 aa  UBIG_VIBSL RecName: Full=3-demethylubiquinone-9
   52::150     1e-04  35%  236 aa  UBIG_SHESM RecName: Full=3-demethylubiquinone-9
   62::162     1e-04  27%  247 aa  UBIG_RHOS5 RecName: Full=3-demethylubiquinone-9
   57::216     1e-04  30%  235 aa  UBIG_NITEU RecName: Full=3-demethylubiquinone-9
   52::152     1e-04  30%  238 aa  UBIG_NEIMA RecName: Full=3-demethylubiquinone-9
   57::155     1e-04  33%  240 aa  UBIG_ESCF3 RecName: Full=3-demethylubiquinone-9
   78::180     1e-04  28%  227 aa  PIMT_PONAB RecName: Full=Protein-L-isoaspartate(D-aspartate)
   72::177     1e-04  22%  216 aa  PIMT_META3 RecName: Full=Protein-L-isoaspartate
   78::180     1e-04  28%  227 aa  PIMT_MACFA RecName: Full=Protein-L-isoaspartate(D-aspartate)
   78::180     1e-04  28%  227 aa  PIMT_HUMAN RecName: Full=Protein-L-isoaspartate(D-aspartate)
  103::203     1e-04  30%  300 aa  CMOB_NAUPA RecName: Full=tRNA (mo5U34)-methyltransferase;       
   92::154     2e-04  35%  225 aa  Y638_METJA RecName: Full=Uncharacterized protein MJ0638;
    2::117     2e-04  29%  205 aa  Y1498_MYCTU RecName: Full=Uncharacterized protein Rv1498c/MT1546;
   52::150     2e-04  35%  236 aa  UBIG_SHEON RecName: Full=3-demethylubiquinone-9
   59::222     2e-04  28%  241 aa  UBIG_BORPA RecName: Full=3-demethylubiquinone-9
  118::221     2e-04  27%  376 aa  ERG6_CANAL RecName: Full=Sterol 24-C-methyltransferase;       
   17::118     2e-04  26%  235 aa  CMOA_ARCB4 RecName: Full=tRNA (cmo5U34)-methyltransferase;       
   33::133     2e-04  30%  251 aa  YL89_SCHPO RecName: Full=Uncharacterized methyltransferase
   52::150     2e-04  30%  236 aa  UBIG_SHESA RecName: Full=3-demethylubiquinone-9
   52::150     2e-04  29%  237 aa  UBIG_SHEAM RecName: Full=3-demethylubiquinone-9
   57::155     2e-04  32%  242 aa  UBIG_SALPK RecName: Full=3-demethylubiquinone-9
   57::155     2e-04  32%  242 aa  UBIG_SALPA RecName: Full=3-demethylubiquinone-9
   49::156     2e-04  30%  242 aa  UBIG_PASMU RecName: Full=3-demethylubiquinone-9
   52::152     2e-04  30%  238 aa  UBIG_NEIMB RecName: Full=3-demethylubiquinone-9
   52::152     2e-04  30%  238 aa  UBIG_NEIM0 RecName: Full=3-demethylubiquinone-9
   57::155     2e-04  28%  243 aa  UBIG_ERWT9 RecName: Full=3-demethylubiquinone-9
   32::122     2e-04  33%  258 aa  TAM_DEIRA RecName: Full=Trans-aconitate 2-methyltransferase;       
  265::349     2e-04  22%  438 aa  RUMA_EDWI9 RecName: Full=23S rRNA (uracil-5-)-methyltransferase
   36::136     2e-04  24%  192 aa  CBIT_SULTO RecName: Full=Probable cobalt-precorrin-6Y
   37::136     2e-04  26%  192 aa  CBIT_SULAC RecName: Full=Probable cobalt-precorrin-6Y
  279::353     2e-04  35%  620 aa  ANM3_ORYSJ RecName: Full=Probable protein arginine
  279::353     2e-04  35%  620 aa  ANM3_ORYSI RecName: Full=Probable protein arginine
   18::130     3e-04  27%  181 aa  YDAC_BACSU RecName: Full=Uncharacterized methyltransferase ydaC;   
   56::205     3e-04  27%  246 aa  UBIG_XYLFA RecName: Full=3-demethylubiquinone-9
   63::162     3e-04  27%  252 aa  UBIG_RHOFD RecName: Full=3-demethylubiquinone-9
   57::155     3e-04  35%  239 aa  UBIG_NITMU RecName: Full=3-demethylubiquinone-9
  273::351     3e-04  27%  442 aa  RUMA_SHESH RecName: Full=23S rRNA (uracil-5-)-methyltransferase
   41::144     4e-04  29%  243 aa  Y3374_MYCBO RecName: Full=Uncharacterized methyltransferase Mb3374;
   41::144     4e-04  29%  243 aa  Y3342_MYCTU RecName: Full=Uncharacterized methyltransferase
   70::169     4e-04  28%  254 aa  UBIG_JANSC RecName: Full=3-demethylubiquinone-9
   33::134     4e-04  29%  256 aa  TAM_RHILW RecName: Full=Trans-aconitate 2-methyltransferase;       
  549::631     4e-04  32%  725 aa  RLML_PSEAE RecName: Full=Ribosomal RNA large subunit
  184::228     4e-04  36%  348 aa  GTOMC_ARATH RecName: Full=Tocopherol O-methyltransferase,
  146::232     4e-04  28%  373 aa  ERG6_ASHGO RecName: Full=Sterol 24-C-methyltransferase;       
   93::195     5e-04  25%  238 aa  PIMT2_METAC RecName: Full=Protein-L-isoaspartate
   76::183     7e-04  28%  284 aa  YGE9_SCHPO RecName: Full=Uncharacterized methyltransferase
  173::360     7e-04  20%  366 aa  Y906_METJA RecName: Full=Uncharacterized protein MJ0906;
  130::240     7e-04  33%  288 aa  Y1233_METJA RecName: Full=Uncharacterized protein MJ1233;
   59::155     7e-04  33%  242 aa  UBIG_YERE8 RecName: Full=3-demethylubiquinone-9
   56::205     7e-04  27%  246 aa  UBIG_XYLFT RecName: Full=3-demethylubiquinone-9
   56::205     7e-04  27%  246 aa  UBIG_XYLF2 RecName: Full=3-demethylubiquinone-9
   64::162     7e-04  29%  248 aa  UBIG_RHIEC RecName: Full=3-demethylubiquinone-9
   64::162     7e-04  24%  249 aa  UBIG_RALEJ RecName: Full=3-demethylubiquinone-9
   66::175     7e-04  29%  269 aa  RRMA_ECOLI RecName: Full=Ribosomal RNA large subunit
   17::118     7e-04  28%  240 aa  CMOA_WOLSU RecName: Full=tRNA (cmo5U34)-methyltransferase;       
   29::148     7e-04  23%  195 aa  CBIT_PYRCJ RecName: Full=Probable cobalt-precorrin-6Y
  240::395     7e-04  29%  601 aa  ANM3_ARATH RecName: Full=Probable protein arginine
   56::205     9e-04  27%  246 aa  UBIG_XYLFM RecName: Full=3-demethylubiquinone-9
   64::162     9e-04  29%  252 aa  UBIG_RHILW RecName: Full=3-demethylubiquinone-9
   48::146     9e-04  25%  232 aa  UBIG_BURTA RecName: Full=3-demethylubiquinone-9
   48::146     9e-04  25%  232 aa  UBIG_BURPS RecName: Full=3-demethylubiquinone-9
   48::146     9e-04  25%  232 aa  UBIG_BURP1 RecName: Full=3-demethylubiquinone-9
   48::146     9e-04  25%  232 aa  UBIG_BURMA RecName: Full=3-demethylubiquinone-9
    4::134     9e-04  28%  256 aa  TAM_RHIE6 RecName: Full=Trans-aconitate 2-methyltransferase;       
   41::79      9e-04  38%  203 aa  RRMJ_DESAH RecName: Full=Ribosomal RNA large subunit
   18::104     9e-04  30%  239 aa  CMOA_NITSB RecName: Full=tRNA (cmo5U34)-methyltransferase;       
   49::95      9e-04  40%  234 aa  CMOA_CAMHC RecName: Full=tRNA (cmo5U34)-methyltransferase;       
    1::233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
UBIE_BACSU      MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
UBIE_BACA2      MQESKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMQIMNVKEGAKALDVCCGTADWTIALAEAAG
UBIE_BACP2      MQQSKEQRVHGVFEKIYKNYDQMNSVISFKQHKKWRDKTMKLMNVQKGAKALDVCCGTADWTIALADAVG
UBIE_BACLD      MVQSKEQRVHGVFEKIYKNYDQMNSVISFKQHKKWRDKTMQLMNVPKGATALDVCCGTGDWTIALADAAG
UBIE_BACCN      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALANAVG
UBIE_BACC1      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAEAVG
UBIE_BACHK      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACCZ      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACCQ      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACC7      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACC3      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACC0      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACAN      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACAC      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACAA      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACWK      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVG
UBIE_BACCR      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVQPGSQALDVCCGTADWTIALAGAVG
UBIE_BACC4      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVQPGSQALDVCCGTADWTIALAGAVG
UBIE_BACC2      MQQSKEERVHDVFEKISDKYDVMNSVISFQRHKAWRKETMRIMDVQPGSQALDVCCGTADWTIALAGAVG
UBIE_GEOSW      MYQSKEERVHHVFEKIYKHYDRMNSVISFRRHLKWREDTMKRMNVQKGKKALDVCCGTADWTIALAEAVG
UBIE_ANOFW      MQQSKEERVHRVFEKISDHYDRMNSVISFKRHVAWRKDTMKRMNVQKGTKALDVCCGTADWTIALAEAVG
UBIE_LYSSC      MAKTKAEHVHEVFESISDNYDKMNGVISFQMHIGWRNDTMKHMAVKPGSKALDVCCGTADWTIALAEAVG
UBIE_GEOKA      MHQSKEERVHRVFEKISAHYDRMNSVISFRRHLKWREDVMRRMNVQKGKRALDVCCGTADWAIALAEAVG
UBIE_BACST      MRQSKEERVHRVFENISAHYDRMNSVISFRRHLKWRKDVMRRMNVQKGKKALDVCCGTADWTIALAEAVG
UBIE_BACHD      MTETKEERVHQVFEKIYKRYDVMNSVISFQRHKAWRKDTMKRMNVQEGQSALDVCCGTADWAIALGKAVG
UBIE_LISMO      MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIG
UBIE_LISMF      MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIG
UBIE_LISMC      MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIG
UBIE_LISIN      MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIG
UBIE_LISW6      MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIG
UBIE_LISMH      MTETKEEKVHKVFEKISPSYDRMNSVISFKLHVKWRKETMKLMRVQKGTNVLDVCCGTADWSIMMAEEIG
UBIE_OCEIH      ---SKEERVHHVFENIYSKYDSMNSIISFQRHKSWRKDTMKRMNVQAGETALDVCCGTGDWSISLSEAVG
UBIE_STACT      ---AEKEKVHKVFQNISTNYDKLNNIISFEQHKVWRKRVMKSMQVKKGSKALDVCCGTADWTIALSKAVG
UBIE_BACSK      MAQSKEQRVHDVFQSIYKKYDVMNSVISLQQHKSWRKDTMKQMDVQAGTSALDVCCGTGDWTLALSEAVG
UBIE_STAAW      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAT      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAS      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAN      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAM      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAE      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAC      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAAB      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAA9      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAA2      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAA1      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVG
UBIE_STAHJ      --NAKKEQVHTVFQNISSKYDRLNNIISFEQHKVWRKHVMKDMHVKVGSKALDVCCGTADWTIALSKAVG
UBIE_STAAR      MADNKKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGMKALDVCCGTGDWTIALSKAVG
UBIE_STAS1      ---AKKEQVHDVFQNISGKYDRLNNIISFEQHKTWRKRVMKEMNVKSGSKALDVCCGTADWTISLSKAVG
UBIE_STAES      ---AKKEQVHTVFQNISQKYDRLNNIISFEQHKVWRKHVMSTMNVQKGSKALDVCCGTADWTIALSEAVG
UBIE_STAEQ      ---AKKEQVHTVFQNISQKYDRLNNIISFEQHKVWRKHVMSTMNVQKGSKALDVCCGTADWTIALSEAVG
UBIE_MICLU      ----KSELVHNVFQNVSTKYDRLNDIISFNQHKSWRKYTMKQMNVKKGSKALDVCCGTGDWTIQMAQAVG
UBIE_BACPF      ---------------IYKRYDMMNSVISFQRHKAWRKDTMKRMKVQPGDHALDVCCGTADWTIALGEAVG
UBIE_LACLA      MTKVNEERVQEIFNSISSDYDKMNAIISFKQHDLWRAKTMKRMGDLTGLSILDLCCGTGDWTFDLSESVG
UBIE_LACPL      --------VQGLFDTIAPNYDRMNNIISLGTHRHWRKQTMAQIHLASNAHVLDLCCGTGDWTIALAKELQ
UBIE_DESHY      ----KAAYVQDTFNSIAKRYDVMNTLMSFGLDKGWRKKAVQTVEAKPGMTMVDICCGTAQLSLELAMTVG
UBIE_BURTA      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURPS      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURP6      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURP1      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURP0      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURMS      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURMA      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURM9      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_BURM7      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGLHRAWKAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAG
UBIE_LACJO      -----EKDVHDLFTRVAPHYDQMNNLISLGTQNGWRXXXXXXXXXXAGDFALDLCCGTGDLTIALAKQVG
UBIE_BURCH      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAG
UBIE_BURCA      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAG
UBIE_BURM1      -ETDKAKKVAGVFHSVANNYDLMNDLMSAGMHRAWKAFTIAQANVRPGYKVLDIAAGTGDLTKAFAKAAG
UBIE_BURCJ      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAG
UBIE_BURCC      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAG
UBIE_BURS3      -ENEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDLAAGTGDLTKAFAKAAG
UBIE_BURCM      -ETEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAG
UBIE_BURA4      -ETEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAG
UBIE_BURVG      -ETEKAKKVAGVFHSVASNYDLMNDLMSAGMHRAWKAFTIAQANVRPGFKVLDIAAGTGDLTRAFAKAAG
UBIE_TERTT      ----KAERVAGVFHSVAAKYDLMNDVMSGGIHRLWKKFTIELSGVRPGDRVLDIAGGTGDLTAKFARLVG
UBIE_IDILO      -RNQKKNLVADVFQSVAAKYDVMNDLMSFGIHRLWKRYTIDCSGVRRGMKVLDIAGGTGDLTAQFSRRVG
UBIE_ENTS8      -KEQKADMVAQVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQKVLDLAGGTGDLTAKFSRLVG
UBIE_PROMH      -KDEKQTMVAKVFHSVASKYDLMNDLMSFGIHRVWKRYTIEASGVRRNQRVLDLAGGTGDLTAKFSRLVG
UBIE_BRUME      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_BRUMB      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_BRUAB      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_BRUA2      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_BRUA1      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_KLEP3      -KEQKQDMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_BRUSU      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEVSG
UBIE_BRUC2      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEVSG
UBIE_YERPY      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPS      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPP      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPN      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPG      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPE      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPB      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERPA      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_YERP3      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_SHEAM      --DKKADLVAGVFHSVAAKYDIMNDVMSFGIHRLWKRFTIETAGARPGMKVLDLAGGTGDLTAKFSRLVG
UBIE_KLEP7      -KEQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SACD2      ----KARRVAGVFHSVAAKYDIMNDVMSGGIHRIWKQFTIELSGVRSGHKVLDIAGGTGDLTKKFSRIVG
UBIE_BRUSI      -ENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_RHOBA      --DKSGERVREMFRQIAPRYDVMNHLLSLNIDKWWRRKAVQTLKIKGDDPILDLCCGTGDLAIAIADSAG
UBIE_OCHA4      -ESEKQGLVNDVFHKVASKYDVMNDLMSAGMHRVWKDAMIAWLSKRPGWTSLDVAGGTGDIAFRIVEASG
UBIE_FRAP2      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKTGVRKGDKVLDLAGGTGDLAYKFCQMVG
UBIE_YERE8      -KEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_SHEWM      --DQKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSHIVG
UBIE_SHEON      --DKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHESW      --DKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRHTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHEPC      --DKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRHTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_LEGPC      --NEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVRPGQSVLDLAGGSGDLTRLLSQKVG
UBIE_LEGPA      --NEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVRPGQSVLDLAGGSGDLTRLLSQKVG
UBIE_CELJU      --EEKAQRVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIEASGVRTGHKVLDIAGGTGDLSYQFARLVG
UBIE_SHEB9      --DKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHEB8      --DKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHEB5      --DKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHEB2      --DKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_LEGPL      --NEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVRPGQSVLDLAGGSGDLTRLLSQKVG
UBIE_SHESR      --DKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHESM      --DKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SHESA      --DKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_BURPP      -EQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAG
UBIE_LEGPH      --NEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVRPGQSVLDLAGGSGDLTRLLLQKVG
UBIE_SERP5      -RDEKQAMVADVFHSVAAKYDVMNDLMSFGIHRIWKRFTIDCSGVRRGQRVLDLAGGTGDLAAKFSRMVG
UBIE_ERWT9      -KDEKADMVADVFHSVAAKYDLMNDLMSFGIHRVWKRFTIDCSGVRRGQRVLDLAGGTGDLTAKFSRLVG
UBIE_SHESH      --EQKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_MARMS      --DEKVKAVAQVFHSVAAKYDIMNDLMSGGIHRLWKRHTISQSGVRAGNCVLDIAGGTGDLTVKFSRLVG
UBIE_BURXL      -EQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAG
UBIE_FRATN      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_ESCF3      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_BURP8      -EQEKAKKVAGVFHSVASNYDLMNDLMSGGLHRAWKAFTIAQANVRPGYKVLDIAGGTGDLSKAFAKRAG
UBIE_SHISS      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SHIFL      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SHIF8      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SHIDS      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SHIBS      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SHIB3      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_FRATM      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_ECOSM      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOSE      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOLU      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOLI      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOLC      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOHS      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECODH      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOBW      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO8A      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO7I      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO5E      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO57      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO55      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO27      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO24      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_SHEHH      --EKKADLVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSRIIG
UBIE_ENT38      ----KADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_ECOUT      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOL6      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOL5      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECOK1      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO81      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_ECO45      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_FRATW      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVHKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_FRATT      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_FRAT1      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_COXBU      --DQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVG
UBIE_COXBR      --DQKTDKVKHVFESVAAKYDLMNDLMSLGIHRCWKDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVG
UBIE_COXBN      --DQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVG
UBIE_COXB2      --DQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVG
UBIE_SHEPA      --EKKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSRIVG
UBIE_PSYIN      -EDTKADLVAGVFHSVAAKYDIMNDVLSMGVHRIWKRFTVDCSGIRKGQKVLDLAGGTGDLTAKFSRIVG
UBIE_PECCP      -RDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGVRRNQRVLDLAGGTGDLTAKFSRMVG
UBIE_ERWCT      -KDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGVRRNQRVLDLAGGTGDLTAKFSRMVG
UBIE_SHEFN      --DKKADLVADVFHSVAAKYDIMNDVMSFGVHRFWKRHTIEVAAARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_SYMTH      --EEKEQYVRELFDKIAENYDAMNQVMSAGQWEKWHREFVAQTHFRPGDHILDVACGTGDLTLLDAAQVA
UBIE_PSEU5      -ESQKAQKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIELSGARHGNRILDIAGGTGDLTRQFSRIVG
UBIE_HAEDU      -KEEKQQLVANVFHSVAAKYDLMNDLLSFGIHRIWKRFTIDCSGVRKGQKVLDLAGGTGDFSAKFSRIVG
UBIE_SHEDO      --DKKADLVASVFHSVAAKYDIMNDVMSFGIHRFWKRFTIETAAARPGMKVLDLAGGTGDLTAKFSHLVG
UBIE_PHOLL      -KDEKAGMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRVAIDASGVRRGQRILDLAGGTGDLTAKFSRIVG
UBIE_FRATO      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_FRATH      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_FRATF      --EEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVG
UBIE_SHEPW      --EQKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSHIVG
UBIE_SALTY      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALTI      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALSV      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALPK      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALPC      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALPB      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALPA      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALNS      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALHS      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALG2      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALEP      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALDC      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALCH      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_SALA4      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_EDWI9      ----KAGKVAQVFHSVAGKYDLMNDLMSFGIHRLWKRFTIDCSGVRQGQRVLDLAGGTGDLAARFSRMVG
UBIE_PSEHT      -ENDKASMVADVFHSVAAKYDVMNDLMSFGVHRLWKRQTIASSGVRKGHHVLDLAGGTGDLTAKFSQLVG
UBIE_COXB1      --DQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVG
UBIE_CAUSK      ---AKAGLVRGVFDRVAKNYDLMNDVMSGGVHRLWKDAVAARLNPQPGEIIIDCAGGTGDMARRFAKMTR
UBIE_PSEA7      -ESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIELSGVRSGNRVLDIAGGTGDLTRQFSRLVG
UBIE_AZOVD      -ESQKARKVAEVFHSVAAKYDLMNDVLSGGLHRLWKRFTIELSGVRRGNRVLDIAGGTGDLTLQFSRLVG
UBIE_BART1      -ETQKQSMVDSVFHSVAENYDKMNDILSLGLHRVWKNSMVAWLSPPALSKVLDVAGGTGDIAFRILKASR
UBIE_SALAR      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRMVG
UBIE_CITK8      -KEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVG
UBIE_BARBK      ----KQSMVDGVFHSVAENYDRMNDILSLGLHRIWKNSTWLAPPAISGWKVIDVAGGTGDIAFRILNASR
UBIE_PSEE4      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PSEAE      -ESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIELSGVRSGNRVLDIAGGTGDLTRQFSRLVG
UBIE_PSEAB      -ESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIELSGVRSGNRVLDIAGGTGDLTRQFSRLVG
UBIE_PSEA8      -ESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIELSGVRSGNRVLDIAGGTGDLTRQFSRLVG
UBIE_PSEPU      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRAGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PSEPK      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PSEP1      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PSEMY      -ESQKAEKVAEVFHSVAAKYDLMNDVLSGGLHRLWKRFTIELSGVRPGNRVLDIAGGTGDLTRKFASIVG
UBIE_BARQU      ----KQSMVDGVFHSVAENYDKMNDILSLGLHRTWKNSMVAWLSALSNWKVLDVAGGTGDIAFRILNASR
UBIE_PSEPG      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PASMU      -KSEKQKMVANVFHSVAGKYDLMNDLLSFGIHRVWKRFTIDCSGVRKGHKVLDLAGGTGDFTAKFSRLVG
UBIE_PSEPF      -ESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFAIELSGVRAGNRVLDIAGGTGDLTKKFSHLVG
UBIE_SILST      -EHEKAGRVQGVFNSVASKYDIMNDVMSVGIHRIWKDAMMDWLAPRPGQRLLDVAGGTGDISFRFLKRAG
UBIE_PSEFS      -ESQKAEKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRTGNRVLDIAGGTGDLAAKFSKLVG
UBIE_PSEPW      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PSEU2      -ESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFAIELSGVRTGNRVLDIAGGTGDLTRKFSNLVG
UBIE_PSE14      -ESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFAIELSGVRTGNRVLDIAGGTGDLTRKFSNLVG
UBIE_XANOM      ----KQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVTTAQVKPGDRVLDLAGGTGDIAVLLKERVG
UBIE_RALEH      ----KADKVAGVFHSVASKYDVMNDLMSGGMHRLWKMFTIAQAGVRPGHKVLDIAGGTGDLAKAFAKQAG
UBIE_GEOUR      ----KGEKIQEMFDTIAPRYDFLNRLLSFGIDRKWRRFAVKQIRYAEGGRILDVATGTGDVALEIAAQTP
UBIE_RHILO      -EGEKQSLVNDVFHKVANRYDLMNDLMSAGLHRLWKDAMVTWLNPRPGWKVLDVAGGTGDIAFRIVDASH
UBIE_RALEJ      -ETEKAGKVAGVFHSVASKYDVMNDLMSGGMHRLWKMFTIAQANVRPGHKVLDIAGGTGDLAKAFAKQAG
UBIE_GEOSF      ----KGEKIQEMFDTIAPRYDFLNRVLSFGIDRSWRRFAVKKIKYAPNGRILDVATGTGDVALEIAARTP
UBIE_WOLWR      --EKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDRMVNSVHFTKNSKVLDVAGGTGDIAIRIVRKE-
UBIE_PSESM      -ESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFAIELSGVRTGNRVLDIAGGTGDLTRKFSNLVG
UBIE_CUPTR      -ETEKAGKVAGVFHSVASKYDVMNDLMSGGMHRLWKMFTIAQAGVRPGHKVLDIAGGTGDLAKAFAKQAG
UBIE_METNO      --DEKQGRVNEVFRSVARRYDVMNDLMSGGLHRAWKSALISALRPSRTRRLLDVAGGTGDIAFRALQAGG
UBIE_BARHE      ----KQSMVDGVFHSVAENYDKMNDILSLGLHRMWKNSMVAWLSPPAVFKVLDVAGGTGDIAFRILNASR
UBIE_XANCP      ----KQKLVGEVFTSVARNYDLMNDLMSLGIHRAWKRYFVATAQVKPGDRVLDLAGGTGDIAVLLKERVG
UBIE_GEOSM      ----KGERIRAMFGSIAPRYDLLNRLLSLGIDRRWRRFAVKKIGLNGAGRVLDVATGTGDVALEIASQTP
UBIE_XANAC      ----KQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGDRVLDLAGGTGDIAVLLKERVG
UBIE_GEOSL      ----KGERIRDMFSDIAPRYDFLNRLLSFGVDRRWRRNAVKCIRWSEGGRVLDVATGTGDVALEIARQTP
COQ5_XENLA      -EEEKRERVYKVFENVAHNYDIMNDAMSLGVHRFWKDWLLQLMKPTPGMQLLDMAGGTGDWPISKTYQNK
UBIE_WOLPM      --EKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDKMVNSVHFTKNSKVLDVAGGTGDIAIRVVRKE-
UBIE_SHELP      --EKKADLVADVFHSVAAKYDIMNDVMSFGIHRLWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSHIVG
UBIE_NEIM0      -EDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGDKVLDIAGGTGDLSRGWAKRVG
UBIE_DINSH      -EDDKAGLVQGVFTNVASKYDIMNDLMSGGLHRVWKDAMMDWLAPRAAQRLLDVAGGTGDIAFRFLKRAP
UBIE_BORA1      -EGDKANKVAEVFHSVAARYDVMNDLMSAGLHRVWKAFTIGRANVRPGMKVLDIAGGTGDLARAFAKRAG
UBIE_THICR      ------------FDSVAGNYDIMNDVMSFGIHRLWKRHAIELSGIRPGNVVLDLAGGTGDLTKAFAKRVG
UBIE_RALME      -ESEKAGKVAGVFHSVASKYDVMNDLMSGGMHRLWKVFTIAQANVRPGQKVLDIAGGTGDLAKAFAKQAG
UBIE_NEIMF      -EDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGDKVLDIAGGTGDLSRGWAKRVG
UBIE_NEIMB      -EDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGDKVLDIAGGTGDLSRGWAKRVG
UBIE_CAUCR      --------VRGVFDRVAKNYDIMNDLMSGGVHRLWKDAVAARLNPQPGEVIIDCAGGTGDXXXXXXRRGG
UBIE_CAUCN      --------VRGVFDRVAKNYDIMNDLMSGGVHRLWKDAVAARLNPQPGEVIIDCAGGTGDXXXXXXRRGG
UBIE_VIBHB      -KDEKVTKVAEVFHSVAAKYDIMNDLMSGGVHRLWKRFTIDCSGARPGQRVXXXXXXXXXXXAKFSRIVG
UBIE_STRM5      ----KQKLVGQVFTSVARNYDLMNDLMSMGVHRAWKRYYVATAQVKPGDRVLDLAGGTGDIAALLKERVG
UBIE_NEIMA      -EDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGDKVLDIAGGTGDLSRGWAKRVG
UBIE_LARHH      -EDDKAGRVAEVFHSVAKKYDVMNDLMSGGLHRIWKHFTLSTAGVRPGMKVLDIAGGTGDLARGWKKRVG
UBIE_GEOBB      ----KGERIRAMFGSIAPRYDLLNRLLSLGIDRRWRRFAVKKIGLNGSGRVLDVATGTGDVALEIASQTP
UBIE_ROSDO      -EGEKAGRVQGVFSSVASKYDIMNDVMSVGIHRLWKEAMMDWLAPRAGQKLLDVAGGTGDISFRFLKRAG
UBIE_RALSO      ----KAGKVAGVFHSVASKYDVMNDLMSGGMHRLWKMFTIAQAAVRPGYKVLDIAGGTGDLAKAFARQAG
UBIE_VIBPA      -KEEKVTKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRIXXXXXXXXXXXAKFSRIVG
UBIE_RALPJ      -EQEKAGKVAGVFHSVASKYDVMNDLMSGGLHRVWKMFTIAQAAVRPGYKVLDIAGGTGDLAKAFARQAG
COQ5_DANRE      -EEEKAEKVYKVFESVAKKYDVMNDAMSLGIHRLWKDTLLHIMNPQPGLRLLDTAGGTGDISFAKSQQTP
UBIE_XYLFM      ----KKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVG
UBIE_XYLFA      ----KKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVG
UBIE_NEIG2      -EDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTIHTAHLKKGDKVLDIAGGTGDLSRGWAKRVG
UBIE_NEIG1      -EDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTIHTAHLKKGDKVLDIAGGTGDLSRGWAKRVG
UBIE_STRMK      ----KQKLVGQVFTSVARNYDLMNDLMSLGVHRAWKRYYVATAQVKPGDRVLDLAGGTGDIAALLKERVG
UBIE_XYLFT      ----KKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVG
UBIE_XYLF2      ----KKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVG
COQ5_RAT        -EKEKGGKVYQVFQSVARKYDLMNDMMSLGIHRAWKDLLIRKMHPLPGTQLLDVAGGTGDWEEIARKYQS
COQ5_MOUSE      -EGEKGSKVYQVFENVAKKYDLMNDMMSLGIHRAWKDLLIRKMHPLPGTQLLDMAGGTGDWEEIAKKYQN
UBIE_VIBVY      -KEEKVAKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRVXXXXXXXXXXXAKFSRIVG
UBIE_VIBVU      -KEEKVAKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRVXXXXXXXXXXXAKFSRIVG
UBIE_BORPE      ----KARKVAEVFHSVASRYDVMNDLMSAGLHRVWKAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAG
UBIE_BORPA      ----KARKVAEVFHSVASRYDVMNDLMSAGLHRVWKAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAG
UBIE_BORBR      ----KARKVAEVFHSVASRYDVMNDLMSAGLHRVWKAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAG
UBIE_BLOFL      ----KSYLVSNVFHKVATKYDLMNDLMSFGIHRIWKQFLIQQSEVHNGYKVLDLAGGTGDLSIKFSKLVG
COQ5_HUMAN      -EEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDWEEIAKEYQN
COQ5_BOVIN      -EEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPFPGTQLLDVAGGTGDWEEIARKYQN
UBIE_VIBCM      -KDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRIXXXXXXXXXXXAKFSRIVG
UBIE_VIBCH      -KDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRIXXXXXXXXXXXAKFSRIVG
UBIE_VIBC3      -KDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRIXXXXXXXXXXXAKFSRIVG
COQ5_PONAB      -EEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPLPGTQLLDVAGGTGDWEEIAKEYQN
UBIE_RHOP2      LQD-KQTLVNDVFHSVASRYDLMNDLMSGGMHRLWKDVMITTLNPPQPFRLLDVAGGTGDISFRAAKASG
UBIE_NITHX      ----KQTLVNGVFHNVAQRYDLMNDLMSAGLHRVWKDATITALNPPRNDTPLDVAGGTGDIAFRAAKAAG
UBIE_BRAJA      ----KQTLVNDVFHSVASRYDLMNDLMSGGLHRVWKDIMINALDPPRGDRPLDVAGGTGDISFRAAKAAG
UBIE_RHOPT      --DEKQTLVNDVFHSVAGRYDLMNDLMSGGMHRLWKDVMITTLNPPRDDRLLDVAGGTGDISFRAAKASG
UBIE_RHOPA      --DEKQTLVNDVFHSVAGRYDLMNDLMSGGMHRLWKDVMITTLNPPRDDRLLDVAGGTGDISFRAAKASG
UBIE_NITEU      -ETEKARKVAEVFHSVAARYNLMNDLMSMGLHRLWKRFAIDVSGAKPGDKVLDIAGGTADLTRLFLEKTG
UBIE_HAHCH      ----KESHVAKVFDSVAAKYDLMNDLMSMGIHRLWKRFTIDKSGVRAGASVLDIAGGTGDLTKKFSRLVG
UBIE_STRAW      --DKQPHEVASMFDDVAERYDLTNDLLSLGQDRVWRREVAKAVDARPAQKILDLAAGTATSSLPFARAGA
UBIE_CHRVO      -ESEKAGKVAEVFHSVASKYDVMNDLMSGGLHRVWKHFTLTTSGVRAGDKVLDIAGGTGDLSRGWAKRVG
UBIE_RHOPS      --NDKQTMVNDVFHSVASRYDLMNDLMSGGMHRLWKDVMITTLNPPRDDRLLDVAGGTGDISFRAAKASG
UBIE_RHISN      ----KQPLVNDVFHKVAKRYDVMNDVMSAGLHRVWKDAMIAALNPRENYRVLDVAGGTGDIAFRIVEASG
UBIE_PHEZH      --------VRGVFDRVARRYDLMNDLMSAGVHRLWKDAVAARLNPQPGETILDVAGGTGDMXXXXXXXGG
UBIE_RHOS5      -EGEKAGMVHGVFTRVASKYDIMNDLMSGGIHRLWKDAMMDWLAPRPGQKLLDVAGGTGDISFRFLKRA-
UBIE_STRCO      --NKQPHEVASMFDHVAERYDLTNAVLSLGQDRAWRKAVARAVDARPAQKVLDLAAGTATSSLPFARTGA
UBIE_SINMW      ----KQPLVNDVFHKVAKRYDIMNDVMSAGLHRVWKDAMIAALNPREDYRVLDVAGGTGDIAFRIVERSG
UBIE_ROSCS      --DQKAEYVERMFSRIASGYDTMNGIMTLGLDRGWRTATVALAAPPSCGRALDIGTGTGDFLVELAQWM-
COQ5_DICDI      -KEDKESMVKDVFDSVSSSYDLMNDVMSMGIHRLWKDELINTLNPTPGSHLLDVAGGTGDISFRINKSNN
UBIE_RHIME      ----KQPLVNDVFHKVAKRYDIMNDVMSAGLHRVWKDAMIAALNPREDYRVLDVAGGTGDIAFRIVERSG
UBIE_PARDP      -EKDKAGLVHGVFSRVASRYDVMNDLMSGGVHRIWKTAMMDWLAPRDGQHLLDVAGGTGDIAFRFLDRA-
UBIE_RHOSK      -EGEKAGMVHGVFTRVASKYDIMNDLMSGGVHRLWKDAMMDWLAPRPGQKLLDVAGGTGDISFRFLKRA-
UBIE_RHOS4      -EGEKAGMVHGVFTRVASKYDIMNDLMSGGVHRLWKDAMMDWLAPRPGQKLLDVAGGTGDISFRFLKRA-
UBIE_RHOS1      -EGEKAGMVHGVFTRVASKYDIMNDLMSGGVHRLWKDAMMDWLAPRPGQKLLDVAGGTGDISFRFLKRA-
COQ5_CAEEL      ----KEQKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQVPYNAKCLDMAGGTGDIAFRILRHS-
UBIE_BACV8      --EKKSVQVEKMFDNIAPAYDQLNHALSWNIDKSWRRKAINWLEPFHPQHIMDVATGTGDFAIQACQTLH
UBIE_NOCFA      --DKQPHEVASMFDGVAERYDLTNTVISMGQDRYWRWATRKALALRPGERVLDLAAGTGVSTVEFAKSGA
UBIE_MYCMM      --DKDPRDVASMFDGVARRYDLTNTVLSLGQDRYWRRATRSALRIGPGDKVLDLAAGTAVSTVELAKSGA
UBIE_RHILW      ----KQDLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAMISALNPRKGYRVLDVAGGTGDIAFRIVEASG
UBIE_PORGI      ----KNEQVEAMFNHIAGHYDRLNHLFSWGMDRVWRQKAIRMIEPFAPHTVLDVATGTGDLAIEICRHIP
UBIE_PORG3      ----KNEQVEAMFNHIAGHYDRLNHLFSWGMDRVWRQKAIRMIEPFAPHTVLDVATGTGDLAIEICRHIP
UBIE_MYCSJ      --DKNPHEVASMFDAVARRYDLTNTVLSLGQDRFWRRETCAALGIGPGDKVLDLAAGTAVSTVELAASGA
COQ5_ORYSJ      -EEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKHLDVAGGTGDVAFRALERIN
UBIE_ROSS1      --DKKAEYVERMFSRIAPGYDTMNGIITLGLDREWRATTVALAAPPSCGRALDIGTGTGDFLVELT-AWM
UBIE_RICCK      ----KQRLVNNVFSNVADKYDLMNDLMSFGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_RHIEC      ----KQGLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAMIAALNPRKGYKVLDVAGGTGDIAFRIVEASG
UBIE_CORGB      --------VASMFDDVGKNYDLTNTVLSFGQDRVWRKRTRQRLDLKPGEKVLDLAAGTAVSTVELAKSGA
UBIE_RICTY      ----KQWLVNNIFSRVADKYDLMNDLMSIGLHRLWKNEIMQIPNLN--SNILDVASGSGDIALQLAKKAK
UBIE_RICAH      ----KQGLVNSVFSNVADKYDLMNDLMSFGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_NITMU      -ETEKAREVAGVFDSVAERYNLMNDLMSGGMHRLWKRFAIEVSGVRTGERVLDIAGGTADLSSLFLEQVG
UBIE_CORGL      --------VASMFDDVGKNYDLTNTVLSFGQDRVWRKRTRQRLDLKPGEKVLDLAAGTAVSTVELAKSGA
UBIE_RHIL3      ----KQGLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAMISALNPRKGYKVLDVAGGTGDIAFRIVEASG
UBIE_MYCUA      --DKDPRDVASMFDGVARRYDLTNTVLSLGQDRYWRRATRSALRIGPGDKVLDLAAGTAVSSVELAKSGA
UBIE_MYCSS      --DKNPHEVASMFDAVARRYDLTNTVLSLGQDRFWRRETCAALGIGPGDRVLDLAAGTAVSTVELAASGA
UBIE_MYCSK      --DKNPHEVASMFDAVARRYDLTNTVLSLGQDRFWRRETCAALGIGPGDRVLDLAAGTAVSTVELAASGA
COQ5_CHICK      ----RREKIYQVFENVAEKYDVMNDSMSLGIHRVWKDILVHKMNPSPGTLLVDVAGGTGDWQISKSYQEE
UBIE_METCA      -EHEKANMVRAVFDSVAGKYDVMNDLMSIGIHRLWKRIAVDLAHVRSGEKVLDLAGGTGDLTALFRKRVG
UBIE_BLOPB      -KDKKTSLVSNVFHTVASQYDLMNDLMSFGIHRMWKRFTIYRSEVYVGCIVLDLAGGTGDLSIQFSRLVG
UBIE_MYCS2      --------VASMFDAVAKRYDLTNTVLSLGQDRFWRRETKSALRIGPADKVLDLAAGTAVSTVELAKSGA
UBIE_RICFE      ----KQGLVNSVFSNVADKYDLMNDLMSFGLHRLWKDEFSRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_RHIE6      ----KQGLVNQVFHKVAKRYDIMNDVMSMGMHRVWKDAMIAALNPRKGYKVLDVAGGTGDIAFRIVEASG
UBIE_MYCTU      --DKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGA
UBIE_MYCTA      --DKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGA
UBIE_MYCBT      --DKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGA
UBIE_MYCBP      --DKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGA
UBIE_MYCBO      --DKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGA
UBIE_MYCA9      --------VASMFDAVARRYDITNTVLSFGRDRFWRRATREALRLKPGDKVLDIAAGTA---VSTAELTQ
UBIE_AGRVS      -EGEKQGLVNDVFHKVAKRYDIMNDVMSAGMHRVWKDALIAALNPRKGYKVLDVAGGTGDIAFRIIEASR
COQ5_DROME      -ESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGPTHGMRLLDMAGGTGDITFRYLRYLN
UBIE_RICRS      ----KQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_RICRO      ----KQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_RICCN      ----KQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_RICAE      ----KQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_BEUC1      --DKDPHDVAGMFDDVARRYDLTNDVLSLGMDRLWRRATLDALGARPGERVLDLAAGTGT---SSADLAD
UBIE_AGRT5      -EGKKQGLVNEVFHKVAKRYDIMNDVMSAGLHRLWKDAMVSALSPRKDPKILDVAGGTGDVAFRIIEASN
UBIE_ACICJ      ----KRHKVREVFDSVAGRYDIMNDLMSLGVHRLWKREFVAMMDPRPHRTLLDLAGGTGD--ISLRWLAA
UBIE_ZYMMO      ----KTHLVGDVFRRVASRYDLMNDAMSGGLHRLWKDDFVRLVQPKASEHILDMAGGTGDIAFRLAKYGT
UBIE_SYNP6      --------VEGLFDQIAPIYDNLNDQLSFGLHRLWKRMAVKWSAAKPGDRVLDLCCGSGDLAFLLAKVVG
UBIE_SYNE7      --------VEGLFDQIAPIYDNLNDQLSFGLHRLWKRMAVKWSAAKPGDRVLDLCCGSGDLAFLLAKVVG
UBIE_RICM5      ----KQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_BRASB      ----KQTLVNDVFHSVAQRYDLMNDLMSAGLHRVWKDIMINTLNPPKSDAPLDVAGGTGDISFRAARKAG
UBIE_RICPU      ----KQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRIPNLN--SHILDVASGSGDIALKLAKKAR
UBIE_BRASO      ----KQTLVNDVFHSVASRYDLMNDLMSGGLHRVWKDIMINTLNPPKSDAPLDVAGGTGDISFRAAKKAG
UBIE_BACTN      ----KTEQVERMFDNIAHAYDKLNHTLSLGIDRSWRRKAIAWLRPFRPQHIMDVATGTGDFAILACRELN
UBIE_AGRRK      ----KQGLVNEVFHKVAKRYDIMNDVMSMGLHRAWKDAMISALNPRKDPKVLDVAGGTGDIAFRIVEASN
UBIE_RICPR      ----KQWLINNIFSRVADKYDLMNDLMSIGLHRLWKDEIMQIPNLN--SNILDVASGSGDIXXXXXXXXX
UBIE_RICB8      --NEKQSLVNSVFSNVADKYDLMNDLMSFGMHRLWKDEFIRIPNLN--SNILDVASGSGDIXXXXXXXXX
UBIE_BACFR      ----KSEQVEQMFDNIAPAYDQLNHTLSLGIDRSWRRKAINWLKPFRPQQIMDVATGTGDFAI-LACHEL
UBIE_BACFN      ----KSEQVEQMFDNIAPAYDQLNHTLSLGIDRSWRRKAINWLKPFRPQQIMDVATGTGDFAI-LACHEL
COQ5_ARATH      -EEEKSKLVGNVFTNVASSYDIMNDVMSGGLHRLWKERLVGKLSPFAGMKHLDVAGGTGDVAFALQKASL
UBIE_CORK4      --EKKPREVARMFDAVGKKYDLTNTVLTGGIDTLWRKATRKRLDPKPGEKVVDLAAGTGVSTAELSKSGA
UBIE_RICBR      --NEKQSLVNSVFSNVADKYDLMNDLMSFGMHRLWKDEFIRIPNLN--SNILDVASGSGDIXXXXXXXXX
UBIE_THET2      -----------MFSEIAPRYDLLNRLLSFGADLRWRRRAVDLALEKAPKRILDLATGTGDLALMLKERA-
UBIE_MYCGI      --EKNPHEVASMFDGVARRYDLTNTVLSLGQDRFWRRATREALQLSPADKVLDLAAGTAVSTVELASSGA
UBIE_RENSM      --DKRPDEVAAMFDDVAPKYDVTNDVLSMGQTRRWRRLVVDAVGAVPGQRVLDVAAGTGTSSEPYADAGL
UBIE_MYCVP      --------VASMFDGVARRYDLTNTVLSLGQDRFWRRATREALQLSPSDKVLDLAAGTAVSTVELA---G
UBIE_COREF      --------VASMFDDVGDKYDLTNTVLSFGQDRVWRRRTRERLDLKPGEKVLDLAAGTAVSTVELAKSGA
UBIE_ANAVT      --------IRAIFDRIAPVYDQLNDWLSLGQHRIWKEMAIKWTGAKPGDTCLDLCCGSGDLALRLARRVG
UBIE_RHOGE      ----REQRIRRVFSAVAARYDLMNDLMSFGIHRLWKRRFVRMAAPQAGQHIVDLAGGTGD-VAALMAAAD
UBIE_MYCPA      --DKNPRDVASMFDGVARRYDLTNTVLSLGQDRYWRKATRSALGIGPGQKVLDLAAGTAVSTVELNKSGA
UBIE_CORA7      --EKKPFDVARMFDAVGKKYDITNTVLSFGQDARWRRLTRERLNPQPGEKVLDLAAGTAVSTEELSKSGA
UBIE_ARTAT      --EKRPDEVATMFDDVAPKYDVVNDVLSMGQTRRWRRIVVDAMDVKVGQKVLDLAAGTGTSSEPYADAGV
UBIE_WIGBR      -KSKKNSMIEDIFNNVSYKYDLMNDIMSFGVHRIWKNILVYCNSTNPDQKILDLASGTGDITKRLSKLIN
UBIE_ANASP      -------KIRAIFDRIAPVYDQLNDWLSLGQHRIWKEMAIKWTGAKPGDTCLDLCCGSGDLALRLARRVG
UBIE_STRGG      --EKQPHEVASMFDGVAANYDLTNDVISLGQXXXXXXXXXXXXXXXXXQKILDLAAGTATSSQPFVKAGA
UBIE_NOSP7      --------VQSIFNRIAPVYDQLNDWLSLGQHRIWKEMAVKWSAAKSGNTALDLCCGSGDLALRLARRVG
UBIE_NOCSJ      --DKQPSDVRRMFDAVARRYDVTNDVLSMGQDRRWRRAVIAAVDPQPGERVLDLAAGTGT---SSQPFAD
UBIE_THEEB      --------IQALFERIAPLYDRLNDQLSFGLHHVWKQMAVDWLELPQGATALDLCCGTGDLTXXXXXXXX
UBIE_MYCLE      --DKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTAELSKSGA
UBIE_DESPS      ---SKGPGVEKMFDAIAGRYDLMNKVMTMGQDQRWRRFVVAKAGDPGAGQVLDLATGTGD-IAALMHRSY
UBIE_CORU7      ------REVATMFDAVGKNYDITNTVLSFGQDXXXXXXXXXXXXXAPGDKVLDLAAGTGVSTEELAESGA
UBIE_CLAMS      ----KPGQVSAMFDEVSSAYDRTNTLLSVGNDQLWXXXXXXXXXXXXGERILDXXXXXXXXXXXXXXXXX
UBIE_CHLTE      IQTKSRSSIRNMFDEVAPTYDFLNHLLSLGIDNYWRKKARKQLEGEREPKILDVATGTGDLAASMAKIPG
UBIE_PELCD      ------QDTRPLFDRIAPRYDLLNRLLSFGIDRRWRLAAVRELALAGAGRILDAATGTGDVALSIA-AAY
UBIE_BDEBA      --------IRNMFSKVAANYDKGNNVLSMGIHHLWRKKLVKYSGAKAGDQVLDCATGTGDLAIEFKKXXX
UBIE_SYNY3      -----QESVQQIFARIAPQYDDLNTFLSFGQHHIWKAMAVKWSGVSPGDRLLDVCCGSGDLAFQGAKVVG
UBIE_THIDA      ------------FHSVAAQYDIMNDLMSAGLHRLWKRFAVAQAGLRPGMKVLDVAGGTADLTRLFLKEVG
UBIE_CHLP8      IQTKSRSSIRNMFDEVAPTYDFLNHLLSLGIDNYWRKKARKQVEGEREPKILDVATGTGDLAASMAKIPG
UBIE_CAMJ8      ----KQEKIIEMFNQIAPTYDKANRILSFGADVVWRKKAQRVMSLKKDLKIADIACGTGDWQESALKMEK
UBIE_DEIRA      -KQDKGQAVQEMFASIAPRYDLLNRVLSLGVDXXXXXXXXXXXXXXXXXXVLDVATGTGDFAIELKERAP
UBIE_CAMJE      ----KQEKIIEMFNQIAPTYDKANRILSFGADVAWRKKAQRVMSLKKDLKIADIACGTGDWQESALKMEK
UBIE_CAMJR      ----KQEKIIEMFNQIAPTYDKANRILSFGADVAWRKKAQRVMSLKKDLKIADIACGTGDWQESALKMEK
UBIE_CAMJJ      ----KQEKIIEMFNQIAPTYDKANRILSFGADVAWRKKAQRVMSLKKDLKIADIACGTGDWQESALKMEK
UBIE_THEFY      --DKDPRDVAAMFDSIADRYDLLNRVLSLGRERYWRQATVAAVDAYSGELVLDLAAGTGTSSESFTR---
A41_LEIDO       --------VKKVFDSVATKYDMMNDVLSLGIHRIWKKHFVECVCPLPGSKFLDVAGGTGDIAFRITDSIR
UBIE_CHLCV      -----------MFDSLAPKYDRINSILSLGMHHLWNRKFSKMLGKSECL--LDLCSGTGKVAYRYIHDYP
COQ5_SCHPO      -EDEKEHLVKNVFSSVAKKYDEMNDAMSLGIHRLWKNIFVSRLNPGNSTKILDVAGGTGDIAFRILNHAD
COQ5_YEAST      LKSTKQKLVGDVFSSVANRYDLMNDVMSLGIHRLWKDHFINKLDAGKRPNSIDVAGGSGDIAFGLLDAES
UBIE_THEMA      -----------LFDRIAEKYDLLNRILSFGMDTKWRKRVVELILEVNPEKVLDLATGTGD-VARLLKRKA
UBIE_LEPIN      ------------FNKIAKKYDRFNDWNSFLLHRVWKNHLVREINFSGHLHVLDLCCGTGDISLRLENSSF
UBIE_LEPIC      ------------FNKIAKKYDRFNDWNSFLLHRVWKNHLVREINFSGHLHVLDLCCGTGDISLRLENSSF
UBIE_PSEOL      -ESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRAGNRVLDIAGGTGDLAAKFSRLVG
UBIE_PARUW      ---NRPQTIQIMFNSIAKQYDRTNAVLSFCLHRRWNELVKKVQSQQTSHTLLDLCAGTGDVAFSYLNQVS
UBIE_CHLPN      -----------IFDSIASKYDRTNTILSLGMHHFWNRSLIQILG--SGYSLLDLCAGTGK----VAKAAH
UBIE_CHLFF      -----EPNLQEMFDSLAPKYDRINSILSLGMHHLWNRTFARMLGKSE--HLLDLCSGTGK--VAYRYIRD
UBIE_CHLTR      -----------MFDSLAPTYDKINGILSLGLHIAWNNALVSLLG--ETNHLLDLCAGTGRVALSYVQNYP
UBIE_CHLTB      -----------MFDSLAPTYDKINGILSLGLHIAWNNALVSLLG--ETNHLLDLCAGTGRVALSYVQNYP
UBIE_CHLTA      -----------MFDSLAPTYDKINGILSLGLHIAWNNALVSLLG--ETNHLLDLCAGTGRVALSYVQNYP
UBIE_CHLT2      -----------MFDSLAPTYDKINGILSLGLHIAWNNALVSLLG--ETNHLLDLCAGTGRVALSYVQNYP
UBIE_CHLMU      -QDKPNIRI--MFDSLAPTYDKINKILSLGLHLTWNHSFVSLLGRSD--HLLDLCAGTGHVALSYIQKYP
UBIE_FRASN      ----------------------------------------------------------------------
UBIE_TROWT      --------IRKMFNRVAQAYDRTNLVLSFLQDAHWRRAACKMLGVTAGEEVLDXXXXXXXXXXXXXXXXX
UBIE_TROW8      --------IRKMFNRVAQAYDRTNLVLSFLQDAHWRRAACKMLGVTAGEEVLDXXXXXXXXXXXXXXXXX
YT37_STRFR      --------------------------------RSYKSVMLDALDARPGESALDLGCGPGTDLGTLAKAVS
YE16_SCHPO      --------------------------------------TYMLKYVKKTDRILDVGCGPGTITVGFPKYVP
YQEM_BACSU      -----------IYQGFASVYDELMSHAPYDQWTKWIEASL-----PEKGRILDLACGTGEISIRLAE---
Y829_SYNY3      --------------------------------------------ISPGQKVLDLCCGGGQATVYLAQS--
Y095_HAEIN      --------------------------------KKATDWLIANGGFSQDKKVLEVACNMGTTAIGLAKQFG
YCGJ_BACSU      -------------------------------------------------RVLDIGAGAGHTALAFSPYVQ
UBIG_METCA      -----------------------------------------------GRKAVDVGCGGGILTEALAKAGA
SMT2_ARATH      -----------------------------------------LIQVKPGQKILDVGCGVGGPMRAIASHS-
SMT1_ORYSJ      ------------------------------------------LGVKPGMKVLDVGCGIGGPLREIAKFSL
ERG6_SCHPO      ------------FSRFYKGEAFAQSIARHEHYLAYR------MGIKPGSRVLDVGCGVGGPAREITEFTG
ERG6_MAGGR      ------------------------------------------IGIKKGMKVLDIGCGVGGPARQIAKFTG
UBIG_VIBFM      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
YAFE_ECOLI      -------------------------------------------------------------------AAQ
Y1440_MYCBO     -----------------------------------------------GVRVLDVAAGSGNISLPAAKTGA
Y1405_MYCTU     -----------------------------------------------GVRVLDVAAGSGNISLPAAKTGA
UBIG_VIBF1      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
BIOC_BUCBP      -----KKKIAEAFGKAAANYDNF-SVIQRIAGNILLSKIETFFNIS----ILDAGCGTG-WFSKKWRQLG
SMT3B_ARATH     -----------------------------------------LIKVKPGQKILDAGCGVGGPMRAIA--AH
UBIG_RALSO      -----------------------------------------------GKRVVDVGCGGGILSESMARAGA
UBIG_PSESM      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
SMT1_DICDI      -----------------------------------------------GMKVIDIGCGVGGPMRTIARFSG
Y2104_ARATH     ----------------------------------------------EGGLLVDVSCGSGLFSRKFAQSGK
Y1252_METJA     ------------YDKLAKSYDKL-----------YKNKYMRIVEIKDGDFVLDIGCGTGEQLKILNNAVG
UBIG_PSEFS      ----------------------------------WIDERVNLA----GKKVLDVGCGGGILSEAMAQ---
SMT2_ORYSJ      ------------------------------------ERVADLLQAKPGHRLLDVGCGVGGPMRAIAAHSG
ERG6_YARLI      ------------------------------------------MGIQPGMKVLDVGCGVGGPAREIARFTG
UBIG_PSEU5      -----------------------------------------------GKKVIDIGCGGGILSEAMAQ---
UBIG_PSEPF      ----------------------------------WIDERVNLA----GKKVLDVGCGGGILSEAMAQ---
UBIG_PSEE4      -----------------------------------------------GKKVLDVGCGGGILSEAMAQ---
SMT1_ARATH      ---NEEERKANYTDMVNKYYDLATSFYSFHFAQRWKGESLRELGIQPGQKVLDVGCGIGGPLREIARFS-
PMTA_RHOSH      -----------------------------------RRRTAAHVNAR-GGRVLEVGVGTG---LSLPLYSH
ERG6_NEUCR      ------------------------------------------IGIKKDMKVLDVGCGVGGPAREIAKFT-
UBIG_PSEPK      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
UBIG_PSEPG      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
UBIG_PSEP1      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
UBIG_PSEF5      -----------------------------------------------GKKVLDVGCGGGILSEAMAQ---
UBIG_PSEAE      -----------------------------------------------GKKVLDIGCGGGILSEAMAQ---
UBIG_PSEAB      -----------------------------------------------GKKVLDIGCGGGILSEAMAQ---
UBIG_PSEA8      -----------------------------------------------GKKVLDIGCGGGILSEAMAQ---
UBIG_THIDA      -----------------------------------------------GKKVLDVGCGGG----ILAEAAG
UBIG_ACIBY      -----------------------------------------------GKKVLDVGCGGG---ILAESMAR
UBIG_ACIBS      -----------------------------------------------GKKVLDVGCGGG---ILAESMAR
UBIG_ACIB5      -----------------------------------------------GKKVLDVGCGGG---ILAESMAR
UBIG_ACIB3      -----------------------------------------------GKKVLDVGCGGG---ILAESMAR
UBIG_ACIAC      ----------------------------------------------QGRRVLDVGCGGGILADAMAR---
UBIG_PSEU2      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
UBIG_PSEPW      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
UBIG_PSE14      -----------------------------------------------GKKVLDVGCGGGILSEAMAL---
UBIG_ACIBC      -----------------------------------------------GKKVLDVGCGGG---ILAESMAR
UBIG_VIBCM      -----------------------------------------------GKRVLDVGCGGG----ILAESMA
UBIG_VIBCH      -----------------------------------------------GKRVLDVGCGGG----ILAESMA
UBIG_VIBC3      -----------------------------------------------GKRVLDVGCGGG----ILAESMA
UBIG_AZOSE      -----------------------------------------------GKRVLDIGCGGGILSESMAAAGA
PHMT2_MYCUA     -----------------------------------------------GKRVLEVSCGHGGGASYLTRTLG
ERG6_PNECA      --------------------------------------------IREGETVLDVGCGVGGPACQISVFTG
UBIG_PSEA7      -----------------------------------------------GKTVLDVGCGGGILSEAMAQ---
UBIG_BORA1      ----------------------------------------------QGRRVLDVGCGGGILSEAMAQAGA
AS3MT_MOUSE     ----------------------------------------------ENCRILDLGSGSGRDCYVLSQLVG
UBIG_VIBPA      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ACIAD      -----------------------------------------------GKKVLDVGCGGG---ILAESMAR
Y1649_METJA     --------------------------------------------IKEGDRVLDICCYTGGFSV---HAAI
PIMT_CAEEL      -----------------------------------------------GAKALDVGSGSGYLTVCMAMMVG
PHMT_MYCTU      -----------------------------------------------GKQVLEVSCGHGGGASYLTRTLH
PHMT_MYCTA      -----------------------------------------------GKQVLEVSCGHGGGASYLTRTLH
PHMT_MYCBP      -----------------------------------------------GKQVLEVSCGHGGGASYLTRTLH
PHMT_MYCBO      -----------------------------------------------GKQVLEVSCGHGGGASYLTRTLH
UBIG_PROMH      -----------------------------------------------GKKVLDVGCGGGILSESMARVGA
UBIG_BURVG      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
UBIG_BURM1      -----------------------------------------------GKRALDVGCGGG---ILSESMAG
UBIG_BURCJ      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
THUM2_MOUSE     -----------------------------------------IAEIKAGALVLDPMCGLGT---ILVEAAE
THUM2_HUMAN     -----------------------------------------LADIKAGAFVLDPMCGLGTILLEAAKEWP
CBIT_SULIY      ------------------------------------------LRIRKGDMILDIGCGTGSVTVEASLLVG
CBIT_SULIN      ------------------------------------------LRIRKGDMILDIGCGTGSVTVEASLLVG
CBIT_SULIM      ------------------------------------------LRIRKGDMILDIGCGTGSVTVEASLLVG
CBIT_SULIL      ------------------------------------------LRIRKGDMILDIGCGTGSVTVEASLLVG
CBIT_SULIK      ------------------------------------------LRIRKGDMILDIGCGTGSVTVEASLLVG
CBIT_SULIA      ------------------------------------------LRIRKGDMILDIGCGTGSVTVEASLLVG
UBIG_IDILO      -----------------------------------------------GKKVLDVGCGGGLLSEAMAE---
UBIG_BURCH      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
UBIG_BURCC      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
UBIG_BURCA      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
PHMT_MYCLE      -----------------------------------------------GKRILEVSCGHGGGASYLTRALH
ERG6_KLULA      --------------------------------------------IKENDLILDVGCGVGGPARTISRFTG
YXBB_BACSU      MITAEECRTYKEFVDLYQSY--LYPLLGARLSRMYSPKNKVIIDM-----------GTGPGYLSIQLAKR
UBIG_VIBHB      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_KLEP3      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
CBIT_SULSO      ------------------------------------------LRIKKGDKVLDIGCGTGSITVEASLLVG
Y1653_METJA     --------------------------------------------IKEGDRVLDICCYTGGFSV---HAAI
UBIG_VIBVY      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_VIBVU      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_THICR      ----------------------------------------------ENKTILDVGCGGGILSESLAKAGG
UBIG_KLEP7      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_BURCM      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
UBIG_BURA4      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
UBIG_ACTP7      -----------------------------------------------GKKVLDVGCGGGILSEAMAKAGA
UBIG_PHOPR      -----------------------------------------------GKKILDVGCGGG---ILAESMAI
UBIG_DINSH      -------------------------------------RDLKSPNPFKGLRILDIGCGGG----LLAEPMA
UBIG_BURS3      -----------------------------------------------GKRALDIGCGGG---ILSESMAG
UBIG_AZOVD      ----------------------------------WIEEHVRLA----GKKVLDVGCGGGILSEAMAL---
UBIG_ALHEH      ----------------------------------------------EGRRILDVGCGGGLLAEGMAR---
PHMT1_MYCUA     -----------------------------------------------GKRVLEVSCGHGGGASYLTRTLH
AS3MT_RAT       ----------------------------------------------ENCRILDLGSGSGRDCYVLSQLVG
AS3MT_HUMAN     ----------------------------------------------ENCWILDLGSGSGRDCYVLSQLVG
Y0656_EMENI     -------------------------------------------------KLVDLGCGTGRNTLQLAKSAP
UBIG_LEPCP      ----------------------------------------------DGLKVLDVGCGGGILSEAMAQ---
UBIG_ACTP2      -----------------------------------------------GKKVLDVGCGGGILSEAMARAGA
PEAM3_ARATH     -----------------------------------------MLDLKPGQKVLDVGCGIGGGDFYMAE--N
PEAM1_ARATH     ------------------------------------------MNLKPGQKVLDVGCGIGGGDFYMAEKF-
UBIG_SHEB9      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_SHEB8      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_SHEB5      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_SHEB2      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_HAHCH      -----------------------------------------------GKRVLDVGCGGGILSESMAR---
UBIG_HAEDU      -----------------------------------------------GKKVLDVGCGGGILSEAMAQAGA
UBIG_DECAR      ----------------------------------WIDQAISLA----GKRVLDVGCGGGLLSEGMAV---
RUMA_MARAV      ------------------------------------------LDVQPGERVLDLFCGLGNFTLPLAR---
RUMA_ACIBS      ------------------DFTQVNATVNEQMVQL----ACELLQLQQGERVLDLFCGLGNFSLPLARCVG
Y1814_ARATH     -----------------------------------------------GGNIIDASCGSGMFSRLFTRSDL
UBIG_RHOS4      ----------------------------------------------EGLRLLDIGCGGGLLSEPMARLGA
UBIG_PHOLL      -----------------------------------------------GKKVLDVGCGGGILSESMAR---
UBIG_PECCP      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_MARMM      ----------------------------------------------EGLRILDIGCGGG---LVCEPMAR
UBIG_HAES2      -------------------------------------------------KVLDVGCGGGILSEAMAK---
UBIG_HAES1      -------------------------------------------------KVLDVGCGGGILSEAMAK---
UBIG_ERWCT      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_COXBU      ----------------------------------------------KGKHVLDVGCGGGLLSEALAK---
UBIG_COXBR      ----------------------------------------------KGKHVLDVGCGGGLLSEALAK---
UBIG_COXBN      ----------------------------------------------KGKHVLDVGCGGGLLSEALAK---
UBIG_COXB2      ----------------------------------------------KGKHVLDVGCGGGLLSEALAK---
UBIG_COXB1      ----------------------------------------------KGKHVLDVGCGGGLLSEALAK---
UBIG_CHRVO      -----------------------------------------------GKKVLDVGCGGG---ILAESMAL
UBIG_BORBR      -----------------------------------------------GKRVLDVGCGGGILSESMAVAGA
UBIG_AERS4      -----------------------------------------------GKRILDIGCGGGILSESMAR---
RUMA_ACIBY      ------------------DFTQVNATVNEQMVQL----ACELLQLQQGERVLDLFCGLGNFSLPLARCVG
RUMA_ACIBC      ------------------DFTQVNATVNEQMVQL----ACELLQLQQGERVLDLFCGLGNFSLPLARCVG
RUMA_ACIB5      ------------------DFTQVNATVNEQMVQL----ACELLQLQQGERVLDLFCGLGNFSLPLARCVG
RUMA_ACIB3      ------------------DFTQVNATVNEQMVQL----ACELLQLQQGERVLDLFCGLGNFSLPLARCVG
PEAMT_SPIOL     ------------------------------------------LDLKPGQKVLDVGCGIGGGDFYMAE--N
CMOA_SULNB      -----DQAVASVFD------DMLSRSVPFYDEVRHLVISLILAEQREGMKVLDLGASTAKFLLDLHSKME
CBIT_THEVO      ------------------------------------------LGVRNGGHFLDIGTGTGSVAVDMSRLAG
UBIG_XANC5      -----------------------------------------------GARVLDVGCGGGLLSESMARLGA
UBIG_AZOSB      -----------------------------------------------GKKVLDVGCGGGLLSEGMAQ---
RUMA_ACIAD      ------------------DFTQVNATVNQQMLKLACD----LLKLQKGEHVLDLFCGLGNFSLPLARCVG
PIMT_MOUSE      ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
PIMT_DANRE      ----------------------------------------------EGAKALDVGSGSGILSVCFSRMVG
PEAM2_ARATH     ------------------------------------------MDLKPGQKVLDVGCGIGGGDFYMAE--N
CBIT_METMA      ------------------------------------------LGLKDGDRFADVGCGTGSVSIEAARIA-
UBIG_SODGM      -----------------------------------------------GKNVLDVGCGGGILAESMAREGA
UBIG_SHESR      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_MARAV      -----------------------------------------------GKRALDVGCGGGLLSEGMAL---
UBIG_ECO7I      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_BURXL      -----------------------------------------------GKTVLDIGCGGG---ILSESMAS
PIMT_PIG        ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
CBIT_THEAC      -----------------------------------------------GMRVMDIGCGSGSMTVEISNIIG
UBIG_XANCP      -----------------------------------------------GARVLDVGCGGGLLSEAMARLGA
UBIG_XANCB      -----------------------------------------------GARVLDVGCGGGLLSEAMARLGA
UBIG_XANC8      -----------------------------------------------GARVLDVGCGGGLLSEAMARLGA
UBIG_COLP3      ---------------------------------------------------IDVGCGGGILSESLAKLGA
UBIG_CITK8      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_BORPE      -----------------------------------------------GKRVLDMGCGGGILSESMAVAGA
PIMT_RAT        ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
K1456_HUMAN     ----EKQHVHNVYESTAPYFSDLQS-------KAWPRVRQFLQEQKPGSLIADIGCGTGKYLKVNSQV--
K1456_BOVIN     ----EKQHVHDVYESTAPYFSDLQS-------KAWPRVRQFLQEQKPGSLIADIGCGTGKYLKVNSQV--
UBIG_SHESW      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_SHEPC      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_SALPC      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALG2      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALEP      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALCH      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_BURPP      ---------------------------------KWIDAHAHLA----GKTVLDIGCGGG---ILSESMAG
UBIG_BURP8      ---------------------------------KWIDSHAHLT----GKRVLDIGCGGG---ILSESMAT
PRMA_CLOBM      -----------VIKPIWENYDKKQEEIIVELDPGMHETTRMCINIKEDRTVFDIGCGSGILSIAAAKLGA
PRMA_CLOBL      -----------VIKPIWENYDKKQEEIIVELDPGMHETTRMCINIKEDRTVFDIGCGSGILSIAAAKLGA
PRMA_CLOBK      -----------VIKPIWENYDKKQEEIIVELDPGMHETTRMCINIKEDRTVFDIGCGSGILSIAAAKLGA
PRMA_CLOBJ      -----------VIKPIWENYDKKQEEIIVELDPGMHETTRMCINIKEDRTVFDIGCGSGILSIAAAKLGA
PRMA_CLOBH      -----------VIKPIWENYDKKQEEIIVELDPGMHETTRMCINIKEDRTVFDIGCGSGILSIAAAKLGA
PRMA_CLOB6      -------------------------------------------HIKEDRTVFDIGCGSGILSIAAAKLGA
PRMA_CLOB1      -----------VIKPIWENYDKKQEEIIVELDPGMHETTRMCINIKEDRTVFDIGCGSGILSIAAAKLGA
PIMT_CHICK      ----------------------------------------------EGAKALDVGSGSGILTACFSRMVG
YRHH_BACSU      ------------------------------------------IDIQENDRILEIGIGNGTVFKSITKKL-
UBIG_YERPY      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPS      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPP      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPN      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPG      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPE      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPB      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERPA      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_YERP3      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_XANAC      -----------------------------------------------GARVLDVGCGGGLLSESMARLGA
UBIG_SHISS      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SHIFL      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SHIF8      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SHIDS      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SHIBS      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SHIB3      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SERP5      ---------------------------------------------------LDVGCGGG----ILAESMA
UBIG_SALTY      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALTI      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALSV      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALNS      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALHS      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALDC      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALA4      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_RHOSK      ----------------------------------------------EGLRLLDIGCGGGLLSEPMARLGA
UBIG_RHOS1      ----------------------------------------------EGLRLLDIGCGGGLLSEPMARLGA
UBIG_ENT38      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOUT      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOSM      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOSE      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOLU      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOLI      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOLC      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOL6      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOL5      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOHS      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECODH      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECOBW      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO8A      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO81      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO5E      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO57      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO55      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO45      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ECO24      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
PIMT_BOVIN      --------------------------------------------LNEGAKALDVGSGSGILTACFARMVG
K1456_MOUSE     ----EKRHVHSVYENTAPYFTDLQS-------KAWPRVRQFLQDQKPGSLVADIGCGTGKYLKVNSQV--
UBIG_SALAR      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_ROSDO      ----------------------------------------------KGLRILDIGCGGG----LLAEPMA
UBIG_ENTS8      -----------------------------------------------GKKVLDVGCGGGILSESMAR---
UBIG_ECO27      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
TRM61_CRYNE     --------------------------------------TMRL-GVRVGGKVIEAGTGSGSMTHSLSRSVG
PIMT2_ARCFU     -----------------------------------------LLDLREGDKVLEVGTGCGYHAAVTAEIVG
CBIT_METTH      --------------------------------------------------AVDVGCGTGGVTLEL---AG
Y028_RICPR      ----------------------------------------------ETAKILDIGCGVGVNLLNFAETYP
UBIG_XANOR      -----------------------------------------------GARVLDVGCGGGLLSESMARLGA
UBIG_XANOP      -----------------------------------------------GARVLDVGCGGGLLSESMARLGA
UBIG_XANOM      -----------------------------------------------GARVLDVGCGGGLLSESMARLGA
UBIG_VIBSL      -----------------------------------------------GKKVLDVGCGGG---ILAESMAV
UBIG_SHESM      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_RHOS5      ----------------------------------------------QGLRLLDIGCGGGLLSEPMARLGA
UBIG_NITEU      ---------------------------------------------------IDVGCGGG---ILSESMAA
UBIG_NEIMA      -----------------------------------------------GKRVLDVGCGGG----ILAESMA
UBIG_ESCF3      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
PIMT_PONAB      ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
PIMT_META3      ------------------------------------------LDLKEGDKVLEIGTGSGYHAAVVAEIVG
PIMT_MACFA      ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
PIMT_HUMAN      ----------------------------------------------EGAKALDVGSGSGILTACFARMVG
CMOB_NAUPA      ----------------------------------------------ENKDVLDVGCNNGYYMFRMLEMNP
Y638_METJA      ----------------------------------------------------------------------
Y1498_MYCTU     ---------------------------------------------------LDVGCGSGRMALPLTGYLN
UBIG_SHEON      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_BORPA      -----------------------------------------------GKRVLDVGCGGGILSESMAVAGA
ERG6_CANAL      ------------------------------------------MNLNENMKVLDVGCGVGGPGREITRFT-
CMOA_ARCB4      -----DEEVASVFD------DMLNRSVPFYKEMQRLSINFACNFLSENDKVYDLGCSTASTLIELSKHCK
YL89_SCHPO      -------------------------------------------SVNETSTILELGAGSGKLTPRIIASQP
UBIG_SHESA      -----------------------------------------------GKKVLDVGCGGGILSESMARIGA
UBIG_SHEAM      -----------------------------------------------GKKVLDVGCGGGILSESMARLGA
UBIG_SALPK      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_SALPA      -----------------------------------------------GKKVLDVGCGGG----ILAESMA
UBIG_PASMU      -----------------------------------------------GKKVLDVGCGGGILSESMAK---
UBIG_NEIMB      -----------------------------------------------GKRVLDVGCGGG----ILAESMA
UBIG_NEIM0      -----------------------------------------------GKRVLDVGCGGG----ILAESMA
UBIG_ERWT9      -----------------------------------------------GKKVLDVGCGGGILSESMAR---
TAM_DEIRA       ------------------------------------------------AQVVDLGCGTGEQTAQLAQRFP
RUMA_EDWI9      -----------------QDFIQVNAAVNAQMV----GQALAWLDVRADERVLDLFCGMGNFTLPLARLAL
CBIT_SULTO      ----------------------------------------------DGAKFIDIGSGTGSVTVEAGLVVG
CBIT_SULAC      -----------------------------------------------GAKFLDVGSGTGSVSVEAGLIVG
ANM3_ORYSJ      ----------------------------------YRDALLGNPSLMNGATVLDVGCGTGILSLFAAKAG-
ANM3_ORYSI      ----------------------------------YRDALLGNPSLMNGATVLDVGCGTGILSLFAAKAG-
YDAC_BACSU      --------------------------------------TINQLGITRGDSILEVGFGPGYCMQQMLKRE-
UBIG_XYLFA      -----------------------------------------------GARVLDVGCGGGLLSEALAR---
UBIG_RHOFD      -----------------------------------------------GQQVLDVGCGGGILADSMARLGA
UBIG_NITMU      -----------------------------------------------GKDVLDVGCGGG----ILSESMA
RUMA_SHESH      ------------------NFIQVNAAINESMVKQAVDW----LSVKPNERVLDLFCGVGNFSLPLAKS--
Y3374_MYCBO     -------------------------------------------------RVLDLGAGTGKLTTRLVE---
Y3342_MYCTU     -------------------------------------------------RVLDLGAGTGKLTTRLVE---
UBIG_JANSC      -----------------------------------------------GLHILDIGCGGG----LLAEPMA
TAM_RHILW       -------------------------------------------------RAVDLGCGPGNSTELIIERYG
RLML_PSEAE      ----------------------------FLDHRPMR---LRIQKEAAGKRFLNLFCYTATATVHAARGGA
GTOMC_ARATH     ----------------------------------------------------------------------
ERG6_ASHGO      ----------------------------------------------------------------------
PIMT2_METAC     -----------------------------------------ILELSEGHKVLEIGTGSGYNAAVMAELVG
YGE9_SCHPO      ---------------------------------------------KSGMSILDFACGTG---LISQHLFP
Y906_METJA      -----------------KDPDIWDMILSSPYYSLCREIASDYLKIDKGDYILDVGCGSRSPKYFI-DMIY
Y1233_METJA     ------------------------------------------VKVKKGEKVLDTCMGLGYTAI---EAYR
UBIG_YERE8      -------------------------------------------------KVLDVGCGGG----ILAESMA
UBIG_XYLFT      -----------------------------------------------GARVLDVGCGGGLLSEALAR---
UBIG_XYLF2      -----------------------------------------------GARVLDVGCGGGLLSEALAR---
UBIG_RHIEC      ----------------------------------------------EGLRVLDIGCGGG----LLSEPVA
UBIG_RALEJ      -----------------------------------------------GKKVVDIGCGGGILSESMARLGA
RRMA_ECOLI      ------------------HYQPLRDAIVAQLRERLDDKATAV---------LDIGCGEGYYTHAFADALP
CMOA_WOLSU      -----DERVAGVFD------DMLSRSIPYYALALELSADFALANLKEGGWVYDLGCSTGSLLLEIERRAG
CBIT_PYRCJ      -----------------------------------RSVALSKLRLRRGGVLVDVGCGTGSVSVEAALIMG
ANM3_ARATH      --------------KVNENY--FGSYSSFGIHREYRDALLKNPTLLNGSVVMDVGCGTGILSLFAAKAG-
UBIG_XYLFM      -----------------------------------------------GARVLDVGCGGGLLSEALAR---
UBIG_RHILW      ----------------------------------------------EGLRVLDIGCGGG----LLSEPVA
UBIG_BURTA      -----------------------------------------------GKRVVDIGCGGG---ILSESMAS
UBIG_BURPS      -----------------------------------------------GKRVVDIGCGGG---ILSESMAS
UBIG_BURP1      -----------------------------------------------GKRVVDIGCGGG---ILSESMAS
UBIG_BURMA      -----------------------------------------------GKRVVDIGCGGG---ILSESMAS
TAM_RHIE6       ---------------------------SAQQYVKFEDERTRPARLQSLRRAVDLGCGPGNSTELIIERFG
RRMJ_DESAH      ----------------------------------------RFQVIKKGASVLDLGCAPGSWLIHAAELTG
CMOA_NITSB      -----DEEVASVFD------DMIARSVPFYKENMALVRDIVVKNVVQKDRVYDLGCSTGSLLIDIAKRSP
CMOA_CAMHC      -------------------------------------------SLKEKAKIIDLGCSTAEFLIALHHKR-


                         .         .         *         .         .         .         .:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
UBIE_BACSU      KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
UBIE_BACA2      KSGEIKGLDFSKNMLSIGEKKVKEGGYSQIELLHGNAMELPFADDSFDFVTIGFGLRNVPDYLTVLKEMR
UBIE_BACP2      DKGEVKGLDFSKNMLSVGETKVKSGGYNQIELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYLTVLKEMT
UBIE_BACLD      ETGEIKGLDFSKNMLSIAEQKTES--YSQIELIHGNAMELPFPDNTFDYVTIGFGLRNVPDYLTVLKEMA
UBIE_BACCN      PNGEVKGLDFSENMLAVGKEKVKALGLEQVELMHGNAMELPFEDHTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACC1      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACHK      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACCZ      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACCQ      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACC7      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACC3      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACC0      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACAN      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACAC      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACAA      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACWK      EDGKVYGLDFSENMLAVGKQKVEALELKQVELIHGNAMELPYEDNTFDYVTIGFGLRNVPDYMQVLKEMT
UBIE_BACCR      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACC4      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_BACC2      EQGKVVGLDFSENMLSVGKQKVEALQLKQVELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMT
UBIE_GEOSW      PSGEVYGLDFSKNMLQVGEQKVKERQLANVKLIHGNAMNIPFPDNTFDYVTIGFGLRNVPDYMTVLKEMY
UBIE_ANOFW      PSGEVYGLDFSRNMLKVGEEKVKERGFQHVTLVHGNAMSLPFPDNTFDYVTIGFGLRNVPDYMTVLKEMY
UBIE_LYSSC      ESGEVKGLDFSQNMLKVGEKKVQP--YPQIELIHGNAMELPFPDDTFDYVTIGFGLRNVPDYLQVLKEMH
UBIE_GEOKA      PEGEVYGLDFSENMLKVGEQKVKARGLGNVKLIHGNAMQLPFPDNSFDYVTIGFGLRNVPDYMTVLKEMH
UBIE_BACST      PEGKVYGLDFSENMLKVGEQKVKARGLHNVKLIHGNAMQLPFPDNSFDYVTIGFGLRNVPDYMTVLKEMH
UBIE_BACHD      PTGHVEGLDFSENMLSIGKKKIADERLDHVFLRHGNAMELPYADDTFDFVTIGFGLRNVPDYMQVLREMA
UBIE_LISMO      PEGHVTGLDFSENMLKVGREKVKEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMY
UBIE_LISMF      PEGHVTGLDFSENMLKVGREKVKEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMY
UBIE_LISMC      PEGHVTGLDFSENMLKVGREKVKEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMY
UBIE_LISIN      PEGHVTGLDFSENMLKVGREKVKEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMY
UBIE_LISW6      PEGHVTGLDFSENMLKVGREKVKEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMY
UBIE_LISMH      PEGHVTGLDFSENMLKVGREKVTEADLHNVELIHGNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMY
UBIE_OCEIH      QTGKVIGLDFSKNMLSIAXXXXXXXXXXXXXXVHGNAMELPYEENSFDYVTIGFGLRNVPDYMTVLEEMY
UBIE_STACT      PSGEVIGLDFSENMLKVGEEKTKN--MSNIQLVQGDAMDLPFDDNEFDYVTIGFGLRNIPDYVIALKEMN
UBIE_BACSK      EQGSVIGLDFSENMLAVGREKVAAAKRTNISLVHGNAMALPYDDNTFDYVTIGFGLRNVPDYMQVLQEMC
UBIE_STAAW      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAT      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAS      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAN      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAM      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAE      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAC      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAB      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFGDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAA9      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAA2      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAA1      PTGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAHJ      AHGEVTGLDFSENMLEVGKEKTKH--MNNIHLVHGDAMNLPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAAR      STGEVTGIDFSENMLEVGKEKT--ASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMN
UBIE_STAS1      HTGEVIGVDFSENMLEVGKRKTKD--MHNIQLVHGDAMNLPFEDNEFDYVTIGFGLRNVPDYLATLKELN
UBIE_STAES      SKGQVTGLDFSENMLEVGKQKT--ASLENIQLVHGDAMNLPFDDNSFDYVTIGFGLRNVPDYLSALKEMH
UBIE_STAEQ      SKGQVTGLDFSENMLEVGKQKT--ASLENIQLVHGDAMNLPFDDNSFDYVTIGFGLRNVPDYLSALKEMH
UBIE_MICLU      KNGHVIGLDFSENMLSVAQGKTNH--IQNIELIHGNAMELPFEDNIFDYTTIGFGLRNLPDYKKGLEEMY
UBIE_BACPF      HNGKVEGLDFSKNMLLIGXXXXXXXXXXXXSLRHGNAMELPYADETFDVVTIGFGLRNVPDYMQVLKEMH
UBIE_LACLA      PSGKVIGLDFSENMXXXXXXXXXXXXXXXXXFLQGNAMALPFEKGSFDVVTIGYGLRNTPDYLTVLKEIF
UBIE_LACPL      APGEVIGLDFSAPMLKLAQQKVTQQQVARVWLRRGNAMHLPFKDNTFDLVTIGFGLRNLPDKAQALTEIY
UBIE_DESHY      EQGQITGLDFSENMLKKAQENLAGSPYSIIELRQGDAMNLPFADNSFDGATVGWGLRNLPDLEKGVQEMI
UBIE_BURTA      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURPS      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURP6      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURP1      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURP0      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURMS      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURMA      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURM9      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_BURM7      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPDNYFDVVTVAFGLRNMTHKDSALAEMR
UBIE_LACJO      PSGNVIGLDFNQKMLDLADKKIRGQNLKEIQLKQGDAMHLPYTDQSFDIVTIGFGLRNVPDADQVLKEIY
UBIE_BURCH      PTGEVWHTDINESMLRVGRDRLLDKGIVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_BURCA      PTGEVWHTDINESMLRVGRDRLLDKGIVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_BURM1      PTGEVWHTDINESMLRVGRDRLLDKGIVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDVALAEMR
UBIE_BURCJ      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_BURCC      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_BURS3      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKIPFPDNYFDLVTVAFGLRNMTHKDAALAEMR
UBIE_BURCM      PTGEVWHTDINESMLRVGRDRLLDKGIVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_BURA4      PTGEVWHTDINESMLRVGRDRLLDKGIVTPSLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_BURVG      PTGEVWHTDINESMLRVGRDRLLDKGVVTPSLL-CDAEKLPFPNNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_TERTT      DEGQVVLADINDSMLKVGRDKLVDKGFGNVQYAQADAQFLPFPDNTFDCITIAFGLRNVTDKDMALAAMN
UBIE_IDILO      AEGEVVLADINDAMLKVGRDKLRDRGIGNVRYVQADAEELPFDDNTFDVITIAFGLRNVTDKDKALRSML
UBIE_ENTS8      ESGKVVLADINDSMLKMGREKLRNIGIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMF
UBIE_PROMH      ENGEVVLADINDSMLKMGREKLRDHGIGNVSYVQANAEELPFPDDYFDCITISFGLRNVTDKAKALRSMF
UBIE_BRUME      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_BRUMB      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_BRUAB      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_BRUA2      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_BRUA1      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_KLEP3      ETGRVMLADINDSMLKMGREKLRNIGIGNVEYVQANAEALPFADNTFDCITISFGLRNVTDKEKALRSMY
UBIE_BRUSU      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_BRUC2      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_YERPY      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPS      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPP      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPN      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPG      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPE      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPB      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_YERPA      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNFFDCITISFGLRNVTEKEKALRSMF
UBIE_YERP3      EQGEVILADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_SHEAM      DRGEVVLADINDSMLKVGRAKLRDGVVGNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMQ
UBIE_KLEP7      ETGRVMLADINDSMLKMGREKLRNIGIGNVEYVQANAEALPFADNTFDCITISFGLRNVTDKEKALRSMY
UBIE_SACD2      PTGQVVLADINESMLNVGRDKLIDSGVANVVYTQADAQYLPFPDNTFDCITIAFGLRNVTDKDLAIASML
UBIE_BRUSI      RQAHVTILDINGSMLGVGERAIKKGLIDNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAY
UBIE_RHOBA      SDVQVIGSDFCHAMLEIARVKESKSGRHTIPFLEADSMALPFDDDAFQCVTVAFGLRNIADTDQGLSEMA
UBIE_OCHA4      RQAHVTILDINGSMLGVGERAIKKGLADNLEFVEASAEELPFEDASFDAYTISFGIRNVPHIDKALSEAY
UBIE_FRAP2      SQGKVVLSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKAKALASMC
UBIE_YERE8      EQGEVVLADINESMLRMGREKLRDKGIGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMF
UBIE_SHEWM      DKGQVTLADINDSMLKVGREKLRDKGIGNVNYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAAIRSML
UBIE_SHEON      DKGEVVLADINDSMLKVGRTKLRDRGISNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHESW      DKGEVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHEPC      DKGEVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_LEGPC      NSGQVILADINAAMLHVGRDRLLDEGFKNIRYVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMY
UBIE_LEGPA      DSGQVVLADINAAMLHVGRDRLLDEGFKNIRYVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMY
UBIE_CELJU      SSGQVILADINASMLGVGRDRLIDRGIANIAFTQCDAQYLPFPDNTFDCITIAFGLRNVTDKDLALRAMQ
UBIE_SHEB9      DKGEVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHEB8      DKGEVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHEB5      DKGEVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHEB2      DKGEVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_LEGPL      DSGQVILADINAAMLHVGRDRLLDEGFKNIRYVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMY
UBIE_SHESR      EKGEVVLADINDSMLKVGRTKLRDRGIGNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHESM      EKGEVVLADINDSMLKVGRTKLRDRGIGNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_SHESA      EKGEVVLADINDSMLKVGRTKLRDRGIGNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMN
UBIE_BURPP      DTGEVWHTDINESMLRVGRDRLLDKGVITPALL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDVALAEMR
UBIE_LEGPH      DSGQVILADINAAMLHVGRDRLLDEGFKNIRYVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMY
UBIE_SERP5      EQGQVVLADINDSMLKMGREKLRDRGIGNVNYVQANAEALPFPDNYFDCITISFGLRNVTDKDKALRSMF
UBIE_ERWT9      ETGEVVLADINSSMLKVGREKLRNKGIGNVNYVQANAEALPFPDNYFDCITIAFGLRNVTEKENALASMF
UBIE_SHESH      DKGQVTLADINDSMLKVGREKLRDKGIGNVNYVQANAEALPFPDNHFDIITIAFGLRNVTDKDSAIRSML
UBIE_MARMS      SEGQVILADINDSMLKVGRDKLANQGIGNVKFVQANAEALPFPDDTFDCITIAFGLRNVTDKSKALASMY
UBIE_BURXL      ETGEVWHTDINESMLRVGRDRLLDKGVITPALL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDIALAEMR
UBIE_FRATN      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKEKALASMC
UBIE_ESCF3      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMY
UBIE_BURP8      ETGEVWHTDINESMLRVGRDRLIDKGVITPTLL-CDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMR
UBIE_SHISS      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_SHIFL      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_SHIF8      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_SHIDS      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_SHIBS      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_SHIB3      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_FRATM      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_ECOSM      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOSE      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOLU      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOLI      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOLC      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOHS      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECODH      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOBW      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO8A      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO7I      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO5E      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO57      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO55      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO27      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO24      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_SHEHH      DTGQVTLADINDSMLKVGREKLRDKGIGNVNYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAAIASML
UBIE_ENT38      DTGRVVLADINDSMLKMGREKLRNGVVGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMY
UBIE_ECOUT      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOL6      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOL5      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECOK1      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO81      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_ECO45      ETGKVVLADINESMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMY
UBIE_FRATW      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_FRATT      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_FRAT1      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_COXBU      DEGEVVIADINAAMLNVGRRRLLDQGFRNIQFIQADAEKLPFPNNFFDRIVIGFGLRNVTNQLAALQSMH
UBIE_COXBR      DEGEVVIADINAAMLNVGRRRLLDQGFRNIQFIQADAEKLPFPNNFFDRIVIGFGLRNVTNQLAALQSMH
UBIE_COXBN      DEGEVVIADINAAMLNVGRRRLLDQGFRNIQFIQADAEKLPFPNNFFDRIVIGFGLRNVTNQLAALQSMH
UBIE_COXB2      DEGEVVIADINAAMLNVGRRRLLDQGFRNIQFIQADAEKLPFPNNFFDRIVIGFGLRNVTNQLAALQSMH
UBIE_SHEPA      ETGQVTLADINDSMLKVGREKLRDKGIGNVNYVQANAEALPFPDNHFDIITIAFGLRNVTNKDAAIASML
UBIE_PSYIN      QTGQVTLADINDSMLKVGRSKLRDLGIGNVSYVQANAEELPFPDNHFDLITIAFGLRNVTDKDKALASMY
UBIE_PECCP      EGGEVILADINASMLKVGREKLRNKGIDNISYVQANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMY
UBIE_ERWCT      EGGEVILADINASMLKVGREKLRNKGIDNINYVQANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMY
UBIE_SHEFN      DRGQVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMQ
UBIE_SYMTH      PDGKVIGVDISEGMLEVGRRRVAASPYKDLITLQGNAMDLPFPDNTFDGVTMGWAMRNVASIPRTLSEIY
UBIE_PSEU5      PTGEVVLADINASMLKVGRDKLLDKGVANVRFVQADAEKLPFPDNYFDVVTIAFGLRNVTHKEDAIASML
UBIE_HAEDU      ETGQVVLADINSSMLEVGRDKLRNGVVGNINYVQANAEHLPFADNTFDCVVISFGLRNVTDKDKALKSMY
UBIE_SHEDO      ERGQVVLADINDSMLKVGRTKLRDKGINNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSML
UBIE_PHOLL      EKGEVVLADINESMLKVGREKLRDVGIGNVSYVQANAEALPFPDNYFNCITISFGLRNVTEKEKALRSMF
UBIE_FRATO      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_FRATH      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_FRATF      QQGKVILSDINSSMLEVGKEKLTNKGVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMC
UBIE_SHEPW      EKGQVTLADINDSMLKVGREKLRDKGIGNVNYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAAIASML
UBIE_SALTY      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALTI      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALSV      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALPK      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALPC      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALPB      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALPA      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALNS      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALHS      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALG2      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALEP      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALDC      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALCH      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_SALA4      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_EDWI9      EQGEVILADINDSMLKIGREKLRNMGIGNLNYVQANAEALPFPENYFDCITIAFGLRNVTDKDKALRSMF
UBIE_PSEHT      ETGQVILGDINSSMLKVGREKLHNLGLGNIDYVQMNAEALPFPDNSFDLITIAFGLRNVTDKDKALRSMY
UBIE_COXB1      DEGEVVIADINAAMLNVGRRRLLDQGFRNIQFIQADAEKLPFPNNFFDRIVIGFGLRNVTNQLAALQSMH
UBIE_CAUSK      AAQERRGIDYNAEMIGAGIEK---GGAPEITWTVGDAQRLPLPDAYADAYVISFGIRNVTDIDAALREAR
UBIE_PSEA7      PSGEVVLADINASMLKVGRDKLLDKGVSNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_AZOVD      ESGEVLLADINDSMLKVGRDRLLDRGVANVRFVQADAEKLPFPDNHFDVITIAFGLRNVTRKEDALRSML
UBIE_BART1      QKAHATVLDINGSMLSVGKQRAQKNGLAPIDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHIDQALREAF
UBIE_SALAR      ETGKVILADINDSMLKMGREKLRNGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMF
UBIE_CITK8      ETGNVILADINDSMLKMGREKLRNGVIGNVKYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMY
UBIE_BARBK      KKAHATVLDINHSMLNVGKKRAQINGLAPIDFVEANAEQLPFSDQSFDAYTIAFGIRNVPHIDKALSEAF
UBIE_PSEE4      PTGQVVLADINESMLKVGRDRLLDRGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PSEAE      PTGEVVLADINASMLKVGRDKLLDKGVSNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PSEAB      PTGEVVLADINASMLKVGRDKLLDKGVSNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PSEA8      PTGEVVLADINASMLKVGRDKLLDKGVSNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PSEPU      PTGQVVLADINESMLKVGRDRLLDRGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PSEPK      PTGQVVLADINDSMLKVGRDRLLDRGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDAAIRSML
UBIE_PSEP1      PTGQVVLADINDSMLKVGRDRLLDRGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDAAIRSML
UBIE_PSEMY      PTGEVVLADINDSMLKVGRDRLLDKGVANVQFVQADAEKLPFPDNHFDVVTIAFGLRNVTHKEDALRSML
UBIE_BARQU      KKAHATVLDINSSMLSVGKKRAQKNGLAPLDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHINQALREAF
UBIE_PSEPG      PTGQVVLADINDSMLKVGRDRLLDRGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PASMU      PSGEVILADINDSMLRVGREKLRNGVVGNVNYVQANAEALPFPDNTFDCVIISFGLRNVTDKDKALRSMF
UBIE_PSEPF      PTGQVVLADINESMLKVGRDRLLDVGVSNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSML
UBIE_SILST      H-GHSTVLDLTTPMLEEGRKRAEAEQMAELDWVTGDAMALPFKDNTFDVYTISFGIRNVTRPQEALNEAY
UBIE_PSEFS      PTGQVVLADINGSMLKVGRDRLLDKGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDAIRSML
UBIE_PSEPW      PTGQVVLADINDSMLKVGRDRLLDRGVANIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSML
UBIE_PSEU2      PTGQVVLADINASMLKVGRDRLLDLGVSNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSML
UBIE_PSE14      PTGQVVLADINASMLKVGRDRLLDLGVSNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSML
UBIE_XANOM      NEGAVVLGDINAGMLSVGRDRLTNRGLSGFDYVQCNAEALPFPDQSFDLVTISFGLRNVTDKDAALREMY
UBIE_RALEH      PTGEVWLTDINESMLRVGRDRLLNKGIVTPVCL-CDAERIPFPDNHFDLVTVAFGLRNMTHKDAALAEMR
UBIE_GEOUR      ASISIVGVDFSKEMVELGKEKVNCSPFARISMQVAPCEAIPFADGSFDSVTIAFGIRNVVDRAQGLKEMH
UBIE_RHILO      GNAHATVLDINGSMLGVGRDRAQKKGLSNTDFVEANAEELPFADATFDAYTIAFGIRNVPRIDVALSEAF
UBIE_RALEJ      PTGQVWLTDINESMLRVGRDRLLDKGVVTPVAL-CDAEHIPFPDNYFDLVTVAFGLRNMTHKDAALAEMR
UBIE_GEOSF      SSVSITGIDFSGEMVELGKQKVAASSYARINMQVAPCEDIPFADDSFDSITIAFGIRNVVDRSQGLKEMY
UBIE_WOLWR      PSAKVTVCDINQNMLSRGRDKAINSNQINFDWVCANAESLPFEDSEFDYCTIAFGIRNVSDRKKALNEAH
UBIE_PSESM      PTGQVVLADINASMLKVGRDRLLDLGVSNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSML
UBIE_CUPTR      PTGQVWLTDINESMLRVGRDRLLNKGIVTPVAL-CDAEKIPFPDNYFDLVTVAFGLRNMTHKEAALAEMR
UBIE_METNO      PETHVTVLDINDAMLAVGRERAGDRFAGRIDFVAGNAEALPLPDGSFDAYTIAFGIRNVPRIERALAEAY
UBIE_BARHE      QKAHATVLDINGSMLSVGKKRAEKNGLAPIDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHIDQALREAF
UBIE_XANCP      NEGAVVLGDINAGMLSVGRDRLTNRGLAGFDYVQCNAEALPFPDQSFDLVTISFGLRNVTDKDAALREMY
UBIE_GEOSM      ASVSIVGIDFTPEMIELGRVKVKDSRHSRITLEVAPCEEIPFDDGSFDAATISFGIRNVVDRIKGLTEMH
UBIE_XANAC      NEGAVVLGDINAGMLSVGRDRLTNRGLSGFDYVQCNAEALPFPDQSFDLLTISFGLRNVTDKDAALREMY
UBIE_GEOSL      PSVAIVGVDFSEGMVALGRDKVAGSPYARITMEIAPCEAIPFPDDTFDSVTIAFGIRNVVDRSQGLSEML
COQ5_XENLA      EEGSLMGCDINKEMLKVGLQKSLRLGYSELSWVAGDAEELPFGDDKFDVYTIAFGIRNVTHIEQALQEAY
UBIE_WOLPM      PSAKVTVCDINQNMLNRGRDKAINSNQINFDWVCASAESLPFEDSEFDYCTIAFGIRNVSDRKKALNEAH
UBIE_SHELP      NTGQVTLADINDSMLKVGREKLXXXXXXXXXXVQANAEALPFPDNHFDIITIAFGLRNVTDKDAAIRSML
UBIE_NEIM0      KEGEVWLTDINSSMLTVGRDCLLNEGMI-LPVSLADAEKLPFPDNYFNLVSVAFGLRNMTHKDTALKEMC
UBIE_DINSH      EA-EAVVLDLTESMLIAGRQRAEAEALARLNWLVGDAMALPFADNSFDVYTISFGIRNVTRIPDALAEAY
UBIE_BORA1      PSGEVWLTDINDSMLRVGRDRLTDGGLI-LPLAVCDAEKLPFPDQYFDRVSVAFGLRNMTHKDRALAEMR
UBIE_THICR      KTGRVVLADINESMVRVGRDRLTNEGIGNVDYTITNAEALTYPDNTFDLVTISFGLRNVTNKDKALEEIY
UBIE_RALME      PTGEVWLTDINESMLRVGRDRLLNKGVVTPVAL-CDAERIPFPDNYFDLVTVAFGLRNMTHKDAALAEMR
UBIE_NEIMF      KEGEVWLTDINSSMLTVGRDRLLNEGMI-LPVSLADAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMY
UBIE_NEIMB      KEGEVWLTDINSSMLTVGRDRLLNEGMI-LPVSLADAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMY
UBIE_CAUCR      PDATINIVDYNAEMIMAG---IERGGEPEITWTVGDAQRLPLPDAYADAYVISFGIRNVTDINAALREAR
UBIE_CAUCN      PDATINIVDYNAEMIMAG---IERGGEPEITWTVGDAQRLPLPDAYADAYVISFGIRNVTDINAALREAR
UBIE_VIBHB      DQGHVILADINNSMLNVGRDKLRDNGIGNVHYVQANAEELPFPDDYFDVITISFCLRNVTDKDKALRSMF
UBIE_STRM5      VEGSVVLGDINAGMLSVGRDRLTNRGLVLLDYVQCNAEALPFPDNSFDLVTIAFGLRNVTDKDAGLREMY
UBIE_NEIMA      KEGEVWLTDINSSMLTVGRDRLLNEGMI-LPVSLADAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMY
UBIE_LARHH      KTGEVWLTDINSSMLTVGRDRLLDEGMI-LPVAIADAEKLPFPDSHFDLVSVAFGLRNMTHKDQALKEMC
UBIE_GEOBB      ASVSIVGIDFTPEMIELGRVKVKDSRHGRITLQVAPCEEIPFDDGSFDAATISFGIRNVVDRIKGLAEMH
UBIE_ROSDO      Y-GHATVLDLTESMLVEGRKRAEAAAMAQLDWVTGDAMALPFADNTFDVYTISFGIRNVTRPQEALNEAF
UBIE_RALSO      PTGEVWLTDINESMLRVGRDRLLDAGVLTPTCL-CDAEHIPFPNAYFDVVTVAFGLRNMTHKDRALAEMR
UBIE_VIBPA      DQGHVVLADINNSMLNVGRDKLRDNGIGNVHYVQANAEELPFPDDYFDVITISFCLRNVTDKDKALRSMF
UBIE_RALPJ      PTGEVWLTDINESMLRVGRDRLLDAGVLTPTAL-CDAEHIPFPNAYFDVVTVAFGLRNMTHKDRALAEMR
COQ5_DANRE      SWKDIAGCDINKEMLKVGKQRAEDAGITTLSWVAGDAEELPFDDDQFDMYTIAFGIRNVTHIEQALQEAF
UBIE_XYLFM      AEGSIVLGDINASMLSVGRDRLIDRGVARLEYVQCNAEALPFQDKCFDLVTMSFGLRNVTDKDTALREMF
UBIE_XYLFA      AEGSIVLGDINASMLSVGRDRLIDRGVAHLDYVQCNAEALPFQDKCFDLVTMSFGLRNVTDKDTALCEMF
UBIE_NEIG2      KEGEVWLTDINSSMLTVGRDRLLNEGMI-LPVSLADAEKLPFPDNYFNLVSVAFGLRNMTYKDAALKEMY
UBIE_NEIG1      KEGEVWLTDINSSMLTVGRDRLLNEGMI-LPVSLADAEKLPFPDNYFNLVSVAFGLRNMTYKDAALKEMY
UBIE_STRMK      AEGSVVLGDINAGMLSVGRDRLTNRGLVLLDYVQCNAEALPFLDNSFDLVTIAFGLRNVTDKDAGLREMY
UBIE_XYLFT      AEGSIVLGDINASMLSVGRDRLIDRGVARLDYVQCNAEALPFQDKCFDLVTMSFGLRNVTDKDAALREMF
UBIE_XYLF2      AEGSIVLGDINASMLSVGRDRLIDRGVARLDYVQCNAEALPFQDKCFDLVTMSFGLRNVTDKDAALREMF
COQ5_RAT        KEDPLGGCDINREMLKVGKQKALARGHTALAWVLGDAEELPFDDDRFDVYTIAFGIRNVTHIDRALQEAH
COQ5_MOUSE      EEDSLGGCDINREMLKVGKQKALDQGHTALAWVLGDAEELPFDDDSFDVYTIAFGIRNVTHIDQALQEAH
UBIE_VIBVY      EKGHVILADINNSMLNVGRDKLRDSGIGNVHYVQANAEELPFPDDYFDIITISFCLRNVTDKDKALRSMF
UBIE_VIBVU      EKGHVILADINNSMLNVGRDKLRDSGIGNVHYVQANAEELPFPDDYFDIITISFCLRNVTDKDKALRSMF
UBIE_BORPE      PSGEVWLTDINESMLRVGRDRLTDSGL-LVPTAVCDAERLPFPSQYFDRVSVAFGLRNMTHKDRALAEMT
UBIE_BORPA      PSGEVWLTDINESMLRVGRDRLTDSGL-LVPTAVCDAERLPFPSQYFDRVSVAFGLRNMTHKDRALAEMT
UBIE_BORBR      PSGEVWLTDINESMLRVGRDRLTDSGL-LVPTAVCDAERLPFPSQYFDRVSVAFGLRNMTHKDRALAEMT
UBIE_BLOFL      KKGIVILLDNNDTMLRLGQKKLRNLGINNVHYIQANAEFLPFSENTFNCVAISFGLRNFTYKQKSLYEIY
COQ5_HUMAN      EEDSLGGCDINKEMLKVGKQKALAQGYAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAH
COQ5_BOVIN      EEDSLGGCDINKEMLKIGKQKARAQGYKALAWILGDAEELPFDDNKFDVYTIAFGIRNVTHIDQALQEAH
UBIE_VIBCM      EKGHVILADINNSMLNVGRDKLRDSGVGNVHYVQANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMF
UBIE_VIBCH      EKGHVILADINNSMLNVGRDKLRDSGVGNVHYVQANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMF
UBIE_VIBC3      EKGHVILADINNSMLNVGRDKLRDSGVGNVHYVQANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMF
COQ5_PONAB      EEDSLGGCDINKEMLKVGKQKALAQGYAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAH
UBIE_RHOP2      AGFQATVCDINTDMLEVGRQRAVERHLDQVEFVEGNAEALQFPDKSYDAYTIAFGIRNVPRIDLALKEAH
UBIE_NITHX      LGFRATVCDINPDMLAVGERAIKQHLDHQVSFVEGNAETLAFADRSFDAYTIAFGIRNVPRIDSALREAF
UBIE_BRAJA      PGFHATVCDINSDMLAVGERAAKRHLETQVDFVEGNAEALAFADRSFDAYTIAFGIRNVPQIDLALREAY
UBIE_RHOPT      AGFHSTVCDINTDMLEVGRQRAVERNLDKVDFVEGNAESLQFDDRSFDAYTIAFGIRNVPRIDLALKEAY
UBIE_RHOPA      AGFHSTVCDINTDMLEVGRQRAVERNLDKVDFVEGNAESLQFDDRSFDAYTIAFGIRNVPRIDLALKEAY
UBIE_NITEU      STGEVWLTDINNSMLSIGRDRMLNDGKS-VPVAQCDAEKLPFPDNYFDRVCVAFGLRNMTHKDAALREMW
UBIE_HAHCH      PSGKVVLADINASMLQVGRNQLLDHGYGDIEFVQANAEALPFPDNSFDCVSIAFGLRNVTDKDQALREMQ
UBIE_STRAW      Y---VVPCDFSLGMLRVGKKN-----HPWLPLTAGDATKLPFKDDTFDAVTISFGLRNVQDTDTALSELY
UBIE_CHRVO      KTGEVWLTDINSSMLTVGRDRLLDEGVI-LPVSLADAEKLPFPDNYFDAVSVAFGLRNMTHKDAALKEMC
UBIE_RHOPS      AGFQATVCDINTDMLEVGRQRAVQRHLDQVDFVEGNAEALQFPDRSYDAYTIAFGIRNVPRIDLALKEAY
UBIE_RHISN      RKAHATVLDINGSMLAVGAERAKKGLLGNLEFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALKEAY
UBIE_PHEZH      DDAKVFVIDYNAEMIAAGRER----GFEEICWTVGDAQRLPLPDACADAYVISFGIRNVTDIPAALREAR
UBIE_RHOS5      PGAHATVCDMTESMLVEGXXXXXXXXXXXLDWVVGDAMALPFASNTFDVYTISFGIRNVTRVQDALNEAF
UBIE_STRCO      Y---VVPCDFSQGMLQVGKER-----HSWLPFTAGDATRLPFKDDVFDAVTISFGLRNVQDTDAALREMY
UBIE_SINMW      RKAQATVLDINGSMLSVGAERARKKGIANLEFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALREAY
UBIE_ROSCS      PDGLAVGVDFTLPMMRAGLPKIAG---QRAVFVAGDALALPFDDESFDAITTGFTLRNVTDIAAAFREMW
COQ5_DICDI      GGGEVLKFDINQSMLNEGKKRGLNKGYTDIDWVQGNSEQLPFKDNTFNCYTVSFGIRNCTNIDQVLREAY
UBIE_RHIME      RKAHATVLDINGSMLSVGAERARKKGIANLDFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALKEAY
UBIE_PARDP      PGARVTVCDMTESMLVEGRKRAEAGKQARLAWVTGDAMALPFADDSFDRYTISFGIRNVTRIPDALAEAR
UBIE_RHOSK      PGAEATVCDMTESMLVEGXXXXXXXXXXXLDWVVGDAMALPFASNTFDVYTISFGIRNVTRVQDALNEAY
UBIE_RHOS4      PGAEATVCDMTESMLVEGXXXXXXXXXXXLDWVVGDAMALPFASNTFDVYTISFGIRNVTRVQDALNEAY
UBIE_RHOS1      PGAEATVCDMTESMLVEGXXXXXXXXXXXLDWVVGDAMALPFASNTFDVYTISFGIRNVTRVQDALNEAY
COQ5_CAEEL      PTAKVTVSDINQPMLDVGKEKERDIQPSRAEWVCANAEQMPFESNTYDLFTMSFGIRNCTHPEKVVREAF
UBIE_BACV8      PQ-ELIGTDISEGMMNVGREKVKAAGLSRISFAKEDCTALTFPDKRFDAITVAFGVRNFEDLDKGLREMH
UBIE_NOCFA      WC---VAADFSKGMLAAGS-------FREVPMVAGDAMALPFADESFDAVAISYGLRNVADPDLAMREML
UBIE_MYCMM      WC---VAADFSVGMLAAGHER-------KVCKVAGDATRLPFADDVFDAVTISFGLRNVVDFSAALREMA
UBIE_RHILW      RQAHATVLDINGSMLGVGAERAEKKKLSNLTFVEANAEELPFEPASFDAYTIAFGIRNVPRIDAALSEAY
UBIE_PORGI      SVKQVTGVDLSLEMMRIGEQKVRSENLNRITFMQKDCLDLPFADHSFDAVTVAFGLRNFQNIKLGLEEMY
UBIE_PORG3      SVKQVTGVDLSLEMMRIGEQKVRSENLNRITFMQKDCLDLPFADHSFDAVTVAFGLRNFQNIKLGLEEMY
UBIE_MYCSJ      WC---VAADFSVGMLSAGRQR-------DVPKVAGDATRLPFADESFDAVTISFGLRNVVDHVAGLEEMA
COQ5_ORYSJ      EETQIYVCDINPNMLNVGKKRASERGYKELSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAY
UBIE_ROSS1      PDGLAVGVDFTVPMMRAGLPKIRD---RRAVFVAGDALKLPFADESFDAITTGFTLRNVTDIAAAFREMW
UBIE_RICCK      DRGNNVSLDINEEMLRNAKKKAIDLNFQNLKFTLASAAALPFSDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_RHIEC      RQAHATVLDINGSMLGVGAERAEKKKLSNLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDKALSEAY
UBIE_CORGB      FC---VACDFSQGMLAAGKDR-------DVSKVVGDGMQLPFADNSFDAVTISYGLRNIHDFRAGLKEMA
UBIE_RICTY      ARGNNISLDINEEMLNNAKKKSIDLNFQNMKFIVANAEELPFLDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_RICAH      DRGNNIALDINEEMLKNAKKKTIDLNFQNLKFTVASAEELPYPDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_NITMU      SRGEVWLTDINNSMLTIGRDRLLDEG-TAVPVAQCDAEKLPFPTNYFDCVSVAFGLRNMTHKDVALKEML
UBIE_CORGL      FC---VACDFSQGMLAAGKDR-------DVSKVVGDGMQLPFADNSFDAVTISYGLRNIHDFRAGLKEMA
UBIE_RHIL3      RQAHATVLDINGSMLGVGAERAEKKKLSNLTFVEANAEELPFEAGSFDAYTIAFGIRNVPRIDAALSEAY
UBIE_MYCUA      WC---VAADFSVGMLAAGHER-------RVCKVAGDATRLPFADDVFDAVTISFGLRNVVDFSAALREMA
UBIE_MYCSS      WC---VAADFSVGMLSAGRQR-------DVPKVAGDATRLPFADESFDAVTISFGLRNVVDHVAGLEEMA
UBIE_MYCSK      WC---VAADFSVGMLSAGRQR-------DVPKVAGDATRLPFADESFDAVTISFGLRNVVDHVAGLEEMA
COQ5_CHICK      KSNQVVVCDINKEMLKAGKQKAQHLGYSELSWVLGNAEELHFDDDKFDVYTIAFGIRNVTRIDLALQEAY
UBIE_METCA      ARGFVVLSDINAEMLXXXXXXXXXXXLAEVAYAQIDAEKLPFPHDSFDCISIGFGLRNVTHKDKALNSMY
UBIE_BLOPB      NTGIVVLADINDSMLHIGQKKLRDLGINNVIYIQADAEALPFSENTFDCVAVSFGLRNFTNKEQALFSIH
UBIE_MYCS2      WC---VAADFSVGMLAAGASR-------QVPKVAGDATRLPFADEVFDAVTISFGLRNVVDHKAGLREMA
UBIE_RICFE      DRGNNIALDINEEMLKNAKKKAIDLNFQNLKFTVASAEELPFSDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_RHIE6      RQAHATVLDINGSMLGVGAERAEKKKLSNLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDVALAEAY
UBIE_MYCTU      WC---VAADFSVGMLAAGAAR-------KVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMA
UBIE_MYCTA      WC---VAADFSVGMLAAGAAR-------KVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMA
UBIE_MYCBT      WC---VAADFSVGMLAAGAAR-------KVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMA
UBIE_MYCBP      WC---VAADFSVGMLAAGAAR-------KVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMA
UBIE_MYCBO      WC---VAADFSVGMLAAGAAR-------KVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMA
UBIE_MYCA9      SGAWCVAADFSVGMLKAGARR-------DVPKVAGDATRLPFADHSFDAVTISFGLRNVVDHVEGLREMA
UBIE_AGRVS      RLAHATVLDINGSMLGVGQERAQKKGLSDLTFVEANAEALPFEANQFDAYTIAFGIRNVPRIDVALSEAY
COQ5_DROME      RPSHVTVSDINQHMLNVGEERAKRLGLTTDQLSNADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAY
UBIE_RICRS      DRVNNISLDINEEMLKQAKKKAIDLNFQNLKFTVASAEELPFPDDSFDYYTIAFGIRNVPDINKALKEAC
UBIE_RICRO      DRVNNISLDINEEMLKQAKKKAIDLNFQNLKFTVASAEELPFPDDSFDYYTIAFGIRNVPDINKALKEAC
UBIE_RICCN      DRVNNISLDINEEMLKQAKKKAIDLNFQNLKFTVASAEELPFPDDSFDYYTIAFGIRNVPDINKALKEAC
UBIE_RICAE      DRVNNISLDINEEMLKQAKKKAIDLNFQNLKFTVASAEELPFPDDSFDYYTIAFGIRNVPDINKALKEAC
UBIE_BEUC1      DGVDVVSCDFSTGMVAEGKRRRPDLAF-----VAGDATRLPFADGSFDAVTISFGLRNVSPAVAGLSEML
UBIE_AGRT5      RLAHATVLDINGSMLAVGEERAAKKKLSDLTFVEANAEELPFEANTFDAYTVAFGIRNVPRIDVALKEAY
UBIE_ACICJ      GGGPVLMTDINEAMLRVGRGRAEEQAIEGIGFAVADAEALPLRDSCVDRVSIAFGLRNCTDKDRVLAEAR
UBIE_ZYMMO      N---VTIADINPAMLEVGKKRAIARSIENLTWKEENAEALSFNDNVFDAYTIAFGIRNVTHIQKALDEAW
UBIE_SYNP6      SKGQVIGFDRSQALLSVGDRARQLASALVIDWQRGDALDLPFPDDHFDAATLGYGLRNVPDIPTVLRQLQ
UBIE_SYNE7      SKGQVIGFDRSQALLSVGDRARQLASALVIDWQRGDALDLPFPDDHFDAATLGYGLRNVPDIPTVLRQLQ
UBIE_RICM5      DRVNNISLDINEEMLKQAKKKAIDLNFQNLKFTVASAEELPFPDDSFDYYTIAFGIRNVPDINKALKEAC
UBIE_BRASB      AGFHATVCDINGDMLEVGRQRLKQYLEDKVSFVEGNAEKLAFPDRSFDAYTIAFGIRNVPQIELALAEAY
UBIE_RICPU      DRVNNISLDINEEMLKQAKKKAIDLNFQNLKFTVASAEELPFLDDSFDYYTIAFGIRNVPDINKALKEAC
UBIE_BRASO      AGFHATVCDINGDMLEVGRQRLKQYLDDRVSFVEGNAESLAFPDRSFDAYTIAFGIRNVPQIDLALAEAY
UBIE_BACTN      PD-ELIGTDISEGMMNVGREKVKKEGLSKISFAREDCTSLSFADNRFDAITVAFGIRNFEDLDKGLSEMC
UBIE_AGRRK      RLAHATVLDINGSMLGVGERAAKKKLTDNLTFVEANAEELPFEPNSFDAYTIAFGIRNVPRIDVALKEAY
UBIE_RICPR      DRGNNISLDINEEMLNNAKKKSIDLNFQNIKFIVANAEELPFSDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_RICB8      DRGSNISLDINEEMLRQAKKKSIDLNFQNLKFTVASAEELPFPDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_BACFR      QPEQLIGTDISEGMMNVGREKVKKEGLSEISFAREDCTSLSFADNRFDAITVAFGIRNFEDLDKGLSEMY
UBIE_BACFN      QPEQLIGTDISEGMMNVGREKVKKEGLSEISFAREDCTSLSFADNRFDAITVAFGIRNFEDLDKGLSEMY
COQ5_ARATH      EETQIYVCDINPNMLNVGKQRAAERGLRDNKSLEGDAEALSFDDNSMDGYTIAFGIRNVTHIEKALAEAY
UBIE_CORK4      L---VVGCDFSLGMLKAGRHR-------NVPLVAGDGLNLPFADNTFDAATISFGLRNFGDTAAGLREIA
UBIE_RICBR      DRGSNISLDINEEMLRQAKKKSIDLNFQNLKFTVASAEELPFPDNSFDYYTIAFGIRNVPDINKALKEAY
UBIE_THET2      PGAEVVGADFAPPMLAIARRKAEARGL-EVRFLEADALALPFPDGAFDAVTIAFGFRNFADYEKALGELY
UBIE_MYCGI      WC---VAADFSVGMLAAGASR-------RVPKVAGDATRLPFDDGVFDAVTISFGLRNVVDFSAGLREMA
UBIE_RENSM      ---DVVALDFSLGMLKVGKRRRPD-----IDFIAGDATALPFADNSFDAVTISFGLRNVNEPKKALAEML
UBIE_MYCVP      SGAWCVAADFSVGMLAAGAAR-------DVPKVAGDATRLPFADGVFDAVTISFGLRNVVDHSAGLREMA
UBIE_COREF      WC---VACDFSQGMLAAGKHR-------NVPMVVGDGMTLPFADNSFDAVTISYGLRNIHDFRAGLREMA
UBIE_ANAVT      STGQVYGVDFSANLLETAKQRAQ-AQYPQISWVEANVLDLPFEDNQFDAATMGYGLRNVTDIPRSLQELR
UBIE_RHOGE      R--RVTVVDPSAEMMAVGQAR----GHAHVDWQVGSAEQLPLADASVDTLTISFGIRNATRIDVALREIH
UBIE_MYCPA      WC---VAADFSVGMLAAGAAR-------RVPKVAGDATRLPFADDVFDAVTISFGLRNVVDTQAALREMA
UBIE_CORA7      WC---VACDFSLGMLAAGAER-------DVPKVAGDGMRLPFADNTFDAVTISYGLRNIHDFELGLREMA
UBIE_ARTAT      ---DVVACDFSLGMLKVGKRRRPD-----IDFIAGDATNLPFADNSFDASTISFGLRNVVEPRKALEEML
UBIE_WIGBR      KKGFIVSLDINRKMLKICRKKIRNSGIRNIFYIQANSEYLPFKKNIFDSVIVSFGFRNFTEKKKQLSSIF
UBIE_ANASP      STGQVSGVDFSANLLETAKQRAQSQPQPNISWVEANVLDLPFKDNQFDAATMGYGLRNVTDIPRSLQELH
UBIE_STRGG      Y---VVPCDFSLGMLKVGKERHPWMPFTA-----GDGMRLPFKDETFDTVTISFGLRNIQDTEVALRELY
UBIE_NOSP7      ATGYVYGVDFSCNLLETAERSQKQYPQPAIAWVEADVLNLPFDDNQFDAATMGYGLRNVKDIPRSLQELH
UBIE_NOCSJ      RGASVVPCDFSLGMLRVGKSALPHLPFTA-----GDGTRLPFADATFDAVTISFGLRNIVDPLSGLRELH
UBIE_THEEB      XXXXXXXXDFAAAPLAIARQR--SDHYPQIEWLQGDALAVPFAPQTFQGITIGYGLRNVVDIPQALREMF
UBIE_MYCLE      WC---VAADFSVRMLATG-------GARKVPKVAADATQLPFSDGVFDAVTISFGLRNIADYQAALREMA
UBIE_DESPS      PRAQVTGGDFSRNMLEEAKKRFAGQG---IDWQVCDANKLPFADNTFEAVTFGYLLRNVDDASSVLAEVY
UBIE_CORU7      YC---VAADFSLGMLRAGSHR-------DVPMICADGLNLPFADNTFDAVTISYGLRNLVDFRAGLREMA
UBIE_CLAMS      XXXXX---DFSEGMLEVGRRRL--AGDDRVEFVHADATDLPFDDDSFDAVTISFGLRNVVEPRKGLDELL
UBIE_CHLTE      --AKVTGYDLSPEMLAIARKK-----YPNIEFLEGFAEKMPFDDRSFHVVSAGFGVRNFEDLAQGMKEFH
UBIE_PELCD      PRAEVVGVDLSMNMLRAAVPKLLPAE-GRITLLQASCESLPLAAETCDAAIIAFGIRNVLQRQVALQEFS
UBIE_BDEBA      XXXXXXX-DFCAEMLIPAPGKAKERGLD-ITFEQADVTQLQYADNSFDVCSISFGIRNVGDPVKA