[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB15681.1

[Show Plain Result]


## Summary of Sequence Search
    1::569
    1::569       0.0 100%  569 aa  URE1_BACSU RecName: Full=Urease subunit alpha;       
    1::569       0.0  94%  569 aa  URE1_BACA2 RecName: Full=Urease subunit alpha;       
    1::571       0.0  70%  571 aa  URE1_BACHD RecName: Full=Urease subunit alpha;       
    5::569       0.0  70%  569 aa  URE1_GEOKA RecName: Full=Urease subunit alpha;       
    5::569       0.0  68%  569 aa  URE1_BACSB RecName: Full=Urease subunit alpha;       
    4::567       0.0  67%  567 aa  URE1_ALCBS RecName: Full=Urease subunit alpha;       
    1::566       0.0  68%  566 aa  URE1_PSEF5 RecName: Full=Urease subunit alpha;       
    1::566       0.0  68%  566 aa  URE1_PSE14 RecName: Full=Urease subunit alpha;       
    1::566       0.0  68%  566 aa  URE1_PSESM RecName: Full=Urease subunit alpha;       
    1::566       0.0  68%  566 aa  URE12_PSEU2 RecName: Full=Urease subunit alpha 2;       
    4::570       0.0  64%  570 aa  URE1_BACC1 RecName: Full=Urease subunit alpha;       
    1::566       0.0  68%  566 aa  URE1_PSEAE RecName: Full=Urease subunit alpha;       
    4::569       0.0  67%  569 aa  URE1_SYNY3 RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURA4 RecName: Full=Urease subunit alpha;       
    1::566       0.0  67%  566 aa  URE1_PSEPF RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURM1 RecName: Full=Urease subunit alpha;       
    3::572       0.0  66%  572 aa  URE1_SYNJB RecName: Full=Urease subunit alpha;       
    4::576       0.0  65%  576 aa  URE1_ARTS2 RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURCM RecName: Full=Urease subunit alpha;       
    5::570       0.0  64%  570 aa  URE1_METSB RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURS3 RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURCJ RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURCH RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURCC RecName: Full=Urease subunit alpha;       
    3::568       0.0  66%  568 aa  URE1_BURCA RecName: Full=Urease subunit alpha;       
    3::568       0.0  65%  568 aa  URE1_BURVG RecName: Full=Urease subunit alpha;       
    4::567       0.0  63%  567 aa  URE1_VIBF1 RecName: Full=Urease subunit alpha;       
    4::568       0.0  67%  568 aa  URE1_MARMS RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_AGRVS RecName: Full=Urease subunit alpha;       
    4::567       0.0  67%  567 aa  URE1_TOLAT RecName: Full=Urease subunit alpha;       
    4::567       0.0  63%  567 aa  URE1_VIBFM RecName: Full=Urease subunit alpha;       
    4::576       0.0  62%  576 aa  URE1_ARTAT RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_RHILW RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_RHIME RecName: Full=Urease subunit alpha;       
    4::567       0.0  62%  567 aa  URE1_PROVU RecName: Full=Urease subunit alpha;       
    5::569       0.0  68%  569 aa  URE1_CYAP4 RecName: Full=Urease subunit alpha;       
    4::572       0.0  62%  572 aa  URE1_BRAJA RecName: Full=Urease subunit alpha;       
    4::567       0.0  62%  567 aa  URE1_PROMH RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_RHIEC RecName: Full=Urease subunit alpha;       
    1::566       0.0  67%  566 aa  URE1_ACIAD RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_SINMW RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_RHIL3 RecName: Full=Urease subunit alpha;       
    4::570       0.0  62%  570 aa  URE1_RHIE6 RecName: Full=Urease subunit alpha;       
    3::567       0.0  65%  567 aa  URE1_TERTT RecName: Full=Urease subunit alpha;       
    5::569       0.0  62%  569 aa  URE1_MAGSM RecName: Full=Urease subunit alpha;       
    3::567       0.0  66%  567 aa  URE1_POLSQ RecName: Full=Urease subunit alpha;       
    4::568       0.0  67%  569 aa  URE1_SYNR3 RecName: Full=Urease subunit alpha;       
    5::570       0.0  65%  570 aa  URE1_BEII9 RecName: Full=Urease subunit alpha;       
    1::566       0.0  65%  566 aa  URE1_NITOC RecName: Full=Urease subunit alpha;       
    4::570       0.0  64%  570 aa  URE1_MESSB RecName: Full=Urease subunit alpha;       
    3::572       0.0  63%  572 aa  URE1_CLOTH RecName: Full=Urease subunit alpha;       
    5::568       0.0  63%  568 aa  URE1_RHOS5 RecName: Full=Urease subunit alpha;       
    4::569       0.0  61%  569 aa  URE1_ROSDO RecName: Full=Urease subunit alpha;       
    4::585       0.0  62%  585 aa  URE1_ARTCA RecName: Full=Urease subunit alpha;       
    5::569       0.0  67%  569 aa  URE1_DECAR RecName: Full=Urease subunit alpha;       
    5::568       0.0  63%  568 aa  URE1_RHOS4 RecName: Full=Urease subunit alpha;       
    5::568       0.0  63%  568 aa  URE1_RHOS1 RecName: Full=Urease subunit alpha;       
    5::568       0.0  63%  568 aa  URE1_RHOSK RecName: Full=Urease subunit alpha;       
    4::570       0.0  61%  570 aa  URE1_RHISN RecName: Full=Urease subunit alpha;       
    4::569       0.0  67%  569 aa  URE1_MICAN RecName: Full=Urease subunit alpha;       
    3::567       0.0  65%  567 aa  URE1_ENT38 RecName: Full=Urease subunit alpha;       
    4::567       0.0  65%  567 aa  URE1_ECO5E RecName: Full=Urease subunit alpha;       
    5::568       0.0  65%  568 aa  URE1_ECO57 RecName: Full=Urease subunit alpha;       
    3::570       0.0  61%  570 aa  URE1_RHOP5 RecName: Full=Urease subunit alpha;       
    4::567       0.0  65%  567 aa  URE1_DELAS RecName: Full=Urease subunit alpha;       
    4::569       0.0  61%  569 aa  URE1_JANSC RecName: Full=Urease subunit alpha;       
    3::570       0.0  60%  570 aa  URE1_RHOPB RecName: Full=Urease subunit alpha;       
    1::569       0.0  64%  569 aa  URE1_SYNJA RecName: Full=Urease subunit alpha;       
    4::568       0.0  64%  569 aa  URE1_PROMS RecName: Full=Urease subunit alpha;       
    1::567       0.0  65%  567 aa  URE1_MARAV RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_SACD2 RecName: Full=Urease subunit alpha;       
    3::567       0.0  65%  567 aa  URE1_CITK8 RecName: Full=Urease subunit alpha;       
   16::611       0.0  63%  611 aa  URE12_PSYCK RecName: Full=Urease subunit alpha 2;       
    4::571       0.0  62%  571 aa  URE1_STAAW RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAT RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAS RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAN RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAM RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAE RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAC RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAA8 RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAA3 RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAA1 RecName: Full=Urease subunit alpha;       
    4::568       0.0  64%  569 aa  URE1_PROM0 RecName: Full=Urease subunit alpha;       
    7::569       0.0  65%  569 aa  URE1_HERA2 RecName: Full=Urease subunit alpha;       
    4::569       0.0  62%  569 aa  URE1_AGRT5 RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAA9 RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAA2 RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_KOCRD RecName: Full=Urease subunit alpha;       
    4::568       0.0  66%  568 aa  URE1_ANAVT RecName: Full=Urease subunit alpha;       
    4::568       0.0  65%  569 aa  URE1_SYNS3 RecName: Full=Urease subunit alpha;       
    3::570       0.0  61%  570 aa  URE1_RHOPS RecName: Full=Urease subunit alpha;       
    4::570       0.0  61%  570 aa  URE1_RHOPA RecName: Full=Urease subunit alpha;       
    7::570       0.0  63%  570 aa  URE1_SILST RecName: Full=Urease subunit alpha;       
    4::570       0.0  61%  570 aa  URE1_RHOPT RecName: Full=Urease subunit alpha;       
    3::570       0.0  61%  570 aa  URE1_RHILO RecName: Full=Urease subunit alpha;       
    3::571       0.0  65%  571 aa  URE1_RALEH RecName: Full=Urease subunit alpha;       
    3::567       0.0  65%  567 aa  URE1_PSEE4 RecName: Full=Urease subunit alpha;       
    4::568       0.0  63%  569 aa  URE1_PROM9 RecName: Full=Urease subunit alpha;       
    4::568       0.0  65%  569 aa  URE1_SYNSC RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAR RecName: Full=Urease subunit alpha;       
    4::571       0.0  62%  571 aa  URE1_STAAB RecName: Full=Urease subunit alpha;       
    3::567       0.0  64%  567 aa  URE1_METFK RecName: Full=Urease subunit alpha;       
    1::569       0.0  60%  569 aa  URE1_BACPA RecName: Full=Urease subunit alpha;       
    4::568       0.0  65%  569 aa  URE1_SYNPV RecName: Full=Urease subunit alpha;       
    4::567       0.0  65%  567 aa  URE1_KLEP3 RecName: Full=Urease subunit alpha;       
    2::571       0.0  66%  571 aa  URE1_RALEJ RecName: Full=Urease subunit alpha;       
    3::567       0.0  64%  567 aa  URE1_PSEPW RecName: Full=Urease subunit alpha;       
    4::568       0.0  63%  569 aa  URE1_PROM2 RecName: Full=Urease subunit alpha;       
    4::567       0.0  66%  567 aa  URE1_KLEP7 RecName: Full=Urease subunit alpha;       
    4::567       0.0  66%  567 aa  URE1_KLEAE RecName: Full=Urease subunit alpha;       
    4::568       0.0  66%  568 aa  URE1_ANASP RecName: Full=Urease subunit alpha;       
    4::570       0.0  60%  570 aa  URE1_RHOP2 RecName: Full=Urease subunit alpha;       
    4::572       0.0  66%  572 aa  URE1_THEEB RecName: Full=Urease subunit alpha;       
    4::568       0.0  64%  569 aa  URE1_SYNS9 RecName: Full=Urease subunit alpha;       
    4::568       0.0  64%  569 aa  URE1_SYNPX RecName: Full=Urease subunit alpha;       
    4::571       0.0  60%  571 aa  URE1_MICLC RecName: Full=Urease subunit alpha;       
    4::567       0.0  64%  567 aa  URE1_PSYIN RecName: Full=Urease subunit alpha;       
    4::571       0.0  63%  571 aa  URE1_ANADF RecName: Full=Urease subunit alpha;       
    1::568       0.0  63%  568 aa  URE1_DEIRA RecName: Full=Urease subunit alpha;       
    5::571       0.0  63%  571 aa  URE1_ANASK RecName: Full=Urease subunit alpha;       
    4::573       0.0  65%  574 aa  URE1_PROM3 RecName: Full=Urease subunit alpha;       
    3::573       0.0  59%  573 aa  URE1_FLAJ1 RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURP0 RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURMS RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURMA RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURM9 RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURM7 RecName: Full=Urease subunit alpha;       
    3::588       0.0  65%  588 aa  URE1_OPITP RecName: Full=Urease subunit alpha;       
    4::571       0.0  66%  571 aa  URE1_NOSP7 RecName: Full=Urease subunit alpha;       
    4::573       0.0  64%  574 aa  URE1_PROMM RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURPS RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_BURP6 RecName: Full=Urease subunit alpha;       
    5::569       0.0  61%  569 aa  URE1_DINSH RecName: Full=Urease subunit alpha;       
    1::564       0.0  64%  564 aa  URE1_BURP1 RecName: Full=Urease subunit alpha;       
    1::564       0.0  64%  564 aa  URE1_BURTA RecName: Full=Urease subunit alpha;       
    4::567       0.0  63%  567 aa  URE1_BLOFL RecName: Full=Urease subunit alpha;       
    1::567       0.0  63%  567 aa  URE1_BLOPB RecName: Full=Urease subunit alpha;       
    3::567       0.0  64%  567 aa  URE1_PSEPG RecName: Full=Urease subunit alpha;       
    3::567       0.0  63%  567 aa  URE1_PSEP1 RecName: Full=Urease subunit alpha;       
    4::571       0.0  59%  571 aa  URE1_STACT RecName: Full=Urease subunit alpha;       
    4::567       0.0  64%  567 aa  URE1_PSEPK RecName: Full=Urease subunit alpha;       
    4::568       0.0  63%  568 aa  URE1_NITMU RecName: Full=Urease subunit alpha;       
    5::586       0.0  65%  586 aa  URE1_CYAP7 RecName: Full=Urease subunit alpha;       
    4::569       0.0  61%  569 aa  URE1_AGRRK RecName: Full=Urease subunit alpha;       
    4::572       0.0  64%  572 aa  URE1_POLSJ RecName: Full=Urease subunit alpha;       
    4::571       0.0  60%  571 aa  URE1_STAXY RecName: Full=Urease subunit alpha;       
    4::571       0.0  60%  571 aa  URE1_STAS1 RecName: Full=Urease subunit alpha;       
    5::569       0.0  61%  569 aa  URE1_SILPO RecName: Full=Urease subunit alpha;       
    3::572       0.0  58%  572 aa  URE1_HAEIE RecName: Full=Urease subunit alpha;       
    3::572       0.0  58%  572 aa  URE1_HAEI8 RecName: Full=Urease subunit alpha;       
    1::567       0.0  58%  567 aa  URE11_PSYCK RecName: Full=Urease subunit alpha 1;       
    5::562       0.0  64%  562 aa  URE1_PARDP RecName: Full=Urease subunit alpha;       
    4::570       0.0  59%  570 aa  URE1_CORGL RecName: Full=Urease subunit alpha;       
    4::590       0.0  63%  590 aa  URE1_VEREI RecName: Full=Urease subunit alpha;       
    3::567       0.0  62%  567 aa  URE1_HAHCH RecName: Full=Urease subunit alpha;       
    3::572       0.0  58%  572 aa  URE1_HAEIN RecName: Full=Urease subunit alpha;       
    4::570       0.0  58%  570 aa  URE11_BRUSU RecName: Full=Urease subunit alpha 1;       
    3::573       0.0  60%  573 aa  URE1_RHOSR RecName: Full=Urease subunit alpha;       
    1::567       0.0  58%  567 aa  URE1_PSEHT RecName: Full=Urease subunit alpha;       
    4::570       0.0  58%  570 aa  URE11_BRUAB RecName: Full=Urease subunit alpha 1;       
    4::570       0.0  58%  570 aa  URE11_BRUA2 RecName: Full=Urease subunit alpha 1;       
    5::570       0.0  59%  570 aa  URE1_CLOPH RecName: Full=Urease subunit alpha;       
    3::568       0.0  64%  568 aa  URE1_AZOSB RecName: Full=Urease subunit alpha;       
    3::572       0.0  58%  572 aa  URE1_HAEIG RecName: Full=Urease subunit alpha;       
    5::570       0.0  63%  570 aa  URE1_CYTH3 RecName: Full=Urease subunit alpha;       
    4::567       0.0  58%  567 aa  URE1_ALTMD RecName: Full=Urease subunit alpha;       
    3::567       0.0  62%  567 aa  URE1_SHEHH RecName: Full=Urease subunit alpha;       
    4::573       0.0  60%  573 aa  URE1_RHOOB RecName: Full=Urease subunit alpha;       
    4::577       0.0  60%  577 aa  URE1_MYCS2 RecName: Full=Urease subunit alpha;       
    4::570       0.0  58%  570 aa  URE11_BRUME RecName: Full=Urease subunit alpha 1;       
    4::572       0.0  62%  572 aa  URE1_VARPS RecName: Full=Urease subunit alpha;       
    1::566       0.0  61%  566 aa  URE1_ARCB4 RecName: Full=Urease subunit beta;       
    4::571       0.0  60%  571 aa  URE1_STAES RecName: Full=Urease subunit alpha;       
    4::571       0.0  60%  571 aa  URE1_STAEQ RecName: Full=Urease subunit alpha;       
    4::572       0.0  63%  572 aa  URE1_ACIAC RecName: Full=Urease subunit alpha;       
  274::838       0.0  58%  838 aa  UREA_ASPFU RecName: Full=Urease;         EC=3.5.1.5;AltName:
    3::572       0.0  63%  572 aa  URE1_RALSO RecName: Full=Urease subunit alpha;       
    3::575       0.0  60%  575 aa  URE1_FRAAA RecName: Full=Urease subunit alpha;       
    4::568       0.0  62%  569 aa  URE1_PROMT RecName: Full=Urease subunit alpha;       
    3::577       0.0  58%  577 aa  URE1_MYCMM RecName: Full=Urease subunit alpha;       
    6::575       0.0  63%  575 aa  URE1_LEPCP RecName: Full=Urease subunit alpha;       
    4::570       0.0  63%  570 aa  URE1_TRIEI RecName: Full=Urease subunit alpha;       
    3::573       0.0  57%  573 aa  URE12_STRAW RecName: Full=Urease subunit alpha 2;       
    4::571       0.0  59%  571 aa  URE1_COREF RecName: Full=Urease subunit alpha;       
    4::568       0.0  62%  569 aa  URE1_PROM1 RecName: Full=Urease subunit alpha;       
    3::572       0.0  57%  572 aa  URE1_ACTP7 RecName: Full=Urease subunit alpha;       
    3::575       0.0  60%  575 aa  URE1_FRASC RecName: Full=Urease subunit alpha;       
    7::572       0.0  57%  572 aa  URE1_ACTPJ RecName: Full=Urease subunit alpha;       
    3::572       0.0  57%  572 aa  URE1_ACTP2 RecName: Full=Urease subunit alpha;       
  273::835       0.0  59%  835 aa  UREA_SCHPO RecName: Full=Urease;         EC=3.5.1.5;AltName:
    4::581       0.0  63%  581 aa  URE1_RHOFD RecName: Full=Urease subunit alpha;       
    3::577       0.0  58%  577 aa  URE1_MYCUA RecName: Full=Urease subunit alpha;       
    4::573       0.0  60%  573 aa  URE1_MYCSS RecName: Full=Urease subunit alpha;       
    4::573       0.0  60%  573 aa  URE1_MYCSK RecName: Full=Urease subunit alpha;       
    4::573       0.0  60%  573 aa  URE1_MYCSJ RecName: Full=Urease subunit alpha;       
    2::564       0.0  57%  565 aa  URE1_CAMLA RecName: Full=Urease subunit beta;       
    3::573       0.0  59%  573 aa  URE1_MYCVP RecName: Full=Urease subunit alpha;       
    3::566       0.0  62%  566 aa  URE1_JANMA RecName: Full=Urease subunit alpha;       
    3::572       0.0  57%  572 aa  URE1_ACTPL RecName: Full=Urease subunit alpha;       
    4::571       0.0  56%  571 aa  URE1_CORU7 RecName: Full=Urease subunit alpha;       
    4::572       0.0  62%  572 aa  URE1_POLNA RecName: Full=Urease subunit alpha;       
    3::571       0.0  62%  571 aa  URE1_BORPE RecName: Full=Urease subunit alpha;       
    3::571       0.0  62%  571 aa  URE1_BORBR RecName: Full=Urease subunit alpha;       
    4::568       0.0  61%  569 aa  URE1_PROS9 RecName: Full=Urease subunit alpha;       
    4::568       0.0  61%  569 aa  URE1_PROMP RecName: Full=Urease subunit alpha;       
    3::573       0.0  59%  573 aa  URE1_NOCFA RecName: Full=Urease subunit alpha;       
    4::570       0.0  59%  572 aa  URE1_LARHH RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YEREN RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERE8 RecName: Full=Urease subunit alpha;       
    3::571       0.0  61%  571 aa  URE1_BORPA RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPY RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPS RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPP RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPN RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPG RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPE RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPB RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERPA RecName: Full=Urease subunit alpha;       
    3::570       0.0  58%  572 aa  URE1_YERP3 RecName: Full=Urease subunit alpha;       
    5::570       0.0  58%  570 aa  URE1_CALS8 RecName: Full=Urease subunit alpha;       
    3::575       0.0  59%  575 aa  URE1_FRASN RecName: Full=Urease subunit alpha;       
    3::568       0.0  60%  568 aa  URE1_AZOPC RecName: Full=Urease subunit alpha;       
    4::569       0.0  58%  587 aa  URE1_CLOPE RecName: Full=Urease subunit alpha;       
    5::571       0.0  60%  571 aa  URE1_SORC5 RecName: Full=Urease subunit alpha;       
    3::569       0.0  56%  569 aa  URE1_HELPS RecName: Full=Urease subunit beta;       
    4::575       0.0  61%  575 aa  URE1_METPP RecName: Full=Urease subunit alpha;       
    3::568       0.0  58%  568 aa  URE1_HELHE RecName: Full=Urease subunit beta;       
    3::569       0.0  56%  569 aa  URE1_HELPY RecName: Full=Urease subunit beta;       
    3::569       0.0  56%  569 aa  URE1_HELPJ RecName: Full=Urease subunit beta;       
    3::569       0.0  55%  569 aa  URE1_HELPG RecName: Full=Urease subunit beta;       
    3::569       0.0  55%  569 aa  URE1_HELP2 RecName: Full=Urease subunit beta;       
    3::569       0.0  55%  569 aa  URE1_HELPH RecName: Full=Urease subunit beta;       
    2::569       0.0  59%  569 aa  URE1_HELHP RecName: Full=Urease subunit beta;       
    3::573       0.0  54%  573 aa  URE11_STRCO RecName: Full=Urease subunit alpha 1;       
    4::572       0.0  54%  572 aa  URE1_STRSL RecName: Full=Urease subunit alpha;       
    3::571       0.0  56%  573 aa  URE12_BRUSU RecName: Full=Urease subunit alpha 2;       
    5::568       0.0  60%  568 aa  URE1_HALMA RecName: Full=Urease subunit alpha;       
    3::571       0.0  56%  573 aa  URE12_BRUME RecName: Full=Urease subunit alpha 2;       
    3::571       0.0  56%  573 aa  URE12_BRUAB RecName: Full=Urease subunit alpha 2;       
    3::571       0.0  56%  573 aa  URE12_BRUA2 RecName: Full=Urease subunit alpha 2;       
    3::598       0.0  58%  598 aa  URE1_UREUR RecName: Full=Urease subunit alpha;       
    3::598       0.0  58%  598 aa  URE1_UREU1 RecName: Full=Urease subunit alpha;       
    4::570       0.0  58%  570 aa  URE1_HALWD RecName: Full=Urease subunit alpha;       
    3::569       0.0  55%  569 aa  URE1_HELFE RecName: Full=Urease subunit beta;       
  276::840     e-180  59%  840 aa  UREA_CANEN RecName: Full=Urease;         EC=3.5.1.5;AltName:
    4::569     e-180  59%  571 aa  URE1_PHOLL RecName: Full=Urease subunit alpha;       
  266::833     e-178  56%  833 aa  UREA_CRYNE RecName: Full=Urease;         EC=3.5.1.5;AltName:
    3::577     e-178  56%  577 aa  URE1_MYCA9 RecName: Full=Urease subunit alpha;       
    4::572     e-178  52%  572 aa  URE1_STRTD RecName: Full=Urease subunit alpha;       
    4::572     e-178  52%  572 aa  URE1_STRT2 RecName: Full=Urease subunit alpha;       
    4::572     e-178  52%  572 aa  URE1_STRT1 RecName: Full=Urease subunit alpha;       
    3::577     e-178  58%  577 aa  URE1_MYCTU RecName: Full=Urease subunit alpha;       
    3::577     e-178  58%  577 aa  URE1_MYCTA RecName: Full=Urease subunit alpha;       
    3::577     e-178  58%  577 aa  URE1_MYCBT RecName: Full=Urease subunit alpha;       
    3::577     e-178  58%  577 aa  URE1_MYCBP RecName: Full=Urease subunit alpha;       
    3::577     e-178  58%  577 aa  URE1_MYCBO RecName: Full=Urease subunit alpha;       
    4::570     e-176  53%  572 aa  URE1_EDWI9 RecName: Full=Urease subunit alpha;       
    5::570     e-175  58%  570 aa  URE1_NATPD RecName: Full=Urease subunit alpha;       
  266::832     e-171  55%  832 aa  UREA_CRYNV RecName: Full=Urease;         EC=3.5.1.5;AltName:
    5::573     e-169  51%  573 aa  URE1_LACFE RecName: Full=Urease subunit alpha;       
    3::598     e-169  55%  598 aa  URE1_UREPA RecName: Full=Urease subunit alpha;       
    3::598     e-169  55%  598 aa  URE1_UREP2 RecName: Full=Urease subunit alpha;       
    4::569     e-162  52%  570 aa  URE11_PSEU2 RecName: Full=Urease subunit alpha 1;       
    1::557     e-158  52%  557 aa  URE1_SULTO RecName: Full=Urease subunit alpha;       
    1::556     e-123  41%  556 aa  URE11_STRAW RecName: Full=Urease subunit alpha 1;       
    8::558     e-121  41%  558 aa  URE12_STRCO RecName: Full=Urease subunit alpha 2;       
    2::307     4e-87  56%  308 aa  URE1_HELMU RecName: Full=Urease subunit beta;       
    1::154     6e-46  57%  154 aa  URE1_LISDA RecName: Full=Urease subunit alpha;       
    1::125     1e-45  69%  129 aa  UREA_SOYBN RecName: Full=Urease;         EC=3.5.1.5;AltName:
    5::64      1e-06  37%  542 aa  DPYS_SACKL RecName: Full=Dihydropyrimidinase;         Short=DHPase;
    1::59      3e-06  36%  457 aa  HYDA_BURPI RecName: Full=D-hydantoinase;         EC=3.5.2.-;
    2::276     5e-06  25%  446 aa  ALLB_BACSU RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::30      6e-06  59%   30 aa  URE1_ECOLX RecName: Full=Urease subunit alpha;       
   39::85      8e-06  51%  421 aa  HUTI_STRGC RecName: Full=Imidazolonepropionase;       
   39::85      1e-05  49%  421 aa  HUTI_STRSV RecName: Full=Imidazolonepropionase;       
    5::148     1e-05  38%  449 aa  ALLB_DESHY RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    5::148     1e-05  36%  449 aa  ALLB_DESHD RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    1::59      1e-05  36%  457 aa  HYDA_RHIRD RecName: Full=D-hydantoinase;         EC=3.5.2.-;
    4::65      1e-05  32%  454 aa  ALLB_BACLD RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    5::72      2e-05  40%  489 aa  DHP1_CAEEL RecName: Full=Dihydropyrimidinase 1;       
    1::70      2e-05  36%  520 aa  DHP2_CAEEL RecName: Full=Dihydropyrimidinase 2;       
   21::94      3e-05  45%  605 aa  ADEC_STAMF RecName: Full=Adenine deaminase;         Short=Adenase; 
   50::93      4e-05  43%  597 aa  ADEC_PARDP RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::64      7e-05  40%  458 aa  HYDL_ARTAU RecName: Full=L-hydantoinase;       
    5::72      7e-05  38%  489 aa  DHP1_CAEBR RecName: Full=Dihydropyrimidinase 1;         EC=3.5.2.2;
  315::409     7e-05  33%  594 aa  ADEC1_DESPS RecName: Full=Adenine deaminase 1;       
    1::64      9e-05  39%  398 aa  PYRC_CLOBA RecName: Full=Dihydroorotase;         Short=DHOase;     
    1::70      9e-05  36%  518 aa  DHP2_CAEBR RecName: Full=Dihydropyrimidinase 2;         EC=3.5.2.2;
    4::64      9e-05  41%  454 aa  ALLB_ENTFA RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    2::70      9e-05  33%  454 aa  ALLB_BACA2 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   19::79      1e-04  38%  570 aa  DPYL3_RAT RecName: Full=Dihydropyrimidinase-related protein 3;     
   19::79      1e-04  38%  570 aa  DPYL3_MOUSE RecName: Full=Dihydropyrimidinase-related protein 3;   
   19::79      1e-04  38%  570 aa  DPYL3_HUMAN RecName: Full=Dihydropyrimidinase-related protein 3;   
   39::414     1e-04  45%  422 aa  HUTI_ALKOO RecName: Full=Imidazolonepropionase;       
  351::391     2e-04  49%  403 aa  HUTI_SPHAL RecName: Full=Imidazolonepropionase;       
   20::88      2e-04  40%  596 aa  ADEC_MOOTA RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::231     2e-04  27%  577 aa  ADEC_BACA2 RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::64      2e-04  41%  427 aa  MTAD_METTH RecName:
   35::84      2e-04  42%  421 aa  HUTI_MYXXD RecName: Full=Imidazolonepropionase;       
   13::79      2e-04  34%  581 aa  ADEC_CLOBA RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::69      3e-04  32%  448 aa  ALLB_BACSK RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   89::184     4e-04  32%  671 aa  Y484_TREPA RecName: Full=Uncharacterized protein TP_0484;
  356::396     4e-04  41%  474 aa  TRIA_ACIAI RecName: Full=Melamine deaminase;         EC=3.5.4.n3;
  329::368     4e-04  42%  410 aa  HUTI_THEAC RecName: Full=Probable imidazolonepropionase;       
  358::390     4e-04  55%  424 aa  HUTI_GEOSW RecName: Full=Imidazolonepropionase;       
  356::396     4e-04  41%  474 aa  ATZA_PSESD RecName: Full=Atrazine chlorohydrolase;       
   19::79      6e-04  36%  571 aa  DPYL3_XENTR RecName: Full=Dihydropyrimidinase-related protein 3;   
   19::79      6e-04  38%  567 aa  DPYL3_DANRE RecName: Full=Dihydropyrimidinase-related protein 3;   
   19::79      6e-04  36%  571 aa  DPY3B_XENLA RecName: Full=Dihydropyrimidinase-related protein 3-B; 
   19::79      6e-04  36%  571 aa  DPY3A_XENLA RecName: Full=Dihydropyrimidinase-related protein 3-A; 
    4::64      7e-04  34%  471 aa  HYDA_BACST RecName: Full=D-hydantoinase;         EC=3.5.2.-;
   39::85      7e-04  45%  421 aa  HUTI_STRP1 RecName: Full=Imidazolonepropionase;       
   10::72      7e-04  35%  503 aa  DPYS_DICDI RecName: Full=Dihydropyrimidinase;         Short=DHPase;
   19::81      7e-04  33%  572 aa  DPYL2_CHICK RecName: Full=Dihydropyrimidinase-related protein 2;   
    3::63      7e-04  41%  454 aa  ALLB_RUBXD RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    5::73      7e-04  33%  438 aa  ALLB_BACHD RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   13::79      7e-04  32%  581 aa  ADEC_CLOBB RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::65      0.001  42%  431 aa  PYRC_THETN RecName: Full=Dihydroorotase;         Short=DHOase;     
   39::85      0.001  45%  421 aa  HUTI_STRPZ RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRPM RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRPG RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRPD RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRPC RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRPB RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRP8 RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRP6 RecName: Full=Imidazolonepropionase;       
   39::85      0.001  45%  421 aa  HUTI_STRP3 RecName: Full=Imidazolonepropionase;       
   39::86      0.001  40%  422 aa  HUTI_ALKMQ RecName: Full=Imidazolonepropionase;       
   28::91      0.001  44%  599 aa  ADEC_CLOBL RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::569

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
URE1_BACSU      MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
URE1_BACA2      MKMSREQYAELFGPTTGDKVRLGDTDLWIEVEKDFTNYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
URE1_BACHD      MKLTRAQHASLYGPTVGDKVRLADTDLLLEIEKDYTVYGDECKFGGGKVLRDGMGQSAVYTRDEGVLDLI
URE1_GEOKA      --MSRRQYADMFGPTTGDCIRLADTDLWIEIEHDYTVYGDEVKFGGGKVIRDGMGQHPLAT-RDEAVDLV
URE1_BACSB      --MSRKQYADMFGPTVGDAIRLADSELFIEIEKDYTTYGDEVKFGGGKVIRDGMGQHPLATS-DECVDLV
URE1_ALCBS      --MSRQAYADMFGPTTGDRVRLADTDLWIQVEKDFTVYGDEVKFGGGKVIRDGMGQSQLPSAK--VMDLV
URE1_PSEF5      MKISREAYADMFGPTVGDKVRLADTELWIEVEKDFTTYGEEVKFGGGKVIRDGMGQSQLLAAE--VVDTL
URE1_PSE14      MKISRQAYADMFGPTVGDKVRLADTELWIEVEKDFTTYGEEVKFGGGKVIRDGMGQ-GQLMAAD-VVDTL
URE1_PSESM      MKISRQAYADMFGPTVGDKVRLADTELWIEVEKDFTTYGEEVKFGGGKVIRDGMGQ-GQLLAAD-VVDTL
URE12_PSEU2     MKISRQAYADMFGPTVGDKVRLADTELWIEVEKDFTTYGEEVKFGGGKVIRDGMGQGQLLAAE--VVDTL
URE1_BACC1      -KMSRKQYADLYGPTTGDSIRLADTQLFAHIERNATVYGDEAVFGGGKSIRDGMGQNSQLTREQGVVDVV
URE1_PSEAE      MKISRQAYADMFGPTVGDRVRLADTDLWIEVERDFTVYGEEVKFGGGKVIRDGMGQSQ--LGAAQVVDTV
URE1_SYNY3      -RMDRHSYAHTFGPTVGDKVRLADTELFIEVEQDYATYGDEVKFGGGKVIRDGMGQSP-LSRAEGAVDVV
URE1_BURA4      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDYTIYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTI
URE1_PSEPF      MKISRQAYADMFGPTVGDKVRLADTELWIEVEQDFTTYGEEVKFGGGKVIRDGQGQSQLLAAE--VVDTV
URE1_BURM1      LRLSRRAYAEMFGPTTGDRVRLADTDLLIEIERDFTIYGEEVKFGGGKVIRDGMGQSQRVAAE--VPDTV
URE1_SYNJB      LEIPRRQYVSNYGPTVGDRVRLADTELIIEVEEDFTTYGEEIKFGGGKTIRDGMGQSPTATRANGALDLV
URE1_ARTS2      -ELTRRQYADLYGPTTGDSIRLADTELFLEIEKDLTVYGEEVVFGGGKVIRDGMGQNGQVTRDEDVPDTV
URE1_BURCM      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDYTIYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTI
URE1_METSB      --MSRRAYAGMFGPTTGDKIRLADTELLIEVERDFTIYGEEVKFGGGKVIRDGMGQSQR-SRAEGAVDTL
URE1_BURS3      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDFTTYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTI
URE1_BURCJ      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDFTTYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTV
URE1_BURCH      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDFTTYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTV
URE1_BURCC      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDFTTYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTV
URE1_BURCA      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDFTTYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTV
URE1_BURVG      LRLSRRAYAEMFGPTTGDRVRLADTELLIEIERDYTIYGEEVKFGGGKVIRDGMGQSQRVAAD--VPDTI
URE1_VIBF1      --ISRTAYANMFGPTTGDRLRLADTELFLEVEKDFTTYGEEVKFGGGKVIRDGMGQSQVVNSE--CVDVV
URE1_MARMS      --MDRQSYAQMFGPTTGDRVRLGDTDIWIQVEKDFTVYGDEVKFGGGKVIRDGMGQS-QVTNEI-AVDLV
URE1_AGRVS      -KMSRAAYASMFGPTTGDKVRLADTELFIEVEKDFTHYGDEVKFGGGKVIRDGMGQS-QATRVDGAVDTV
URE1_TOLAT      --ISRQAYADMFGPTTGDRVRLADTELWLEVEKDFTIYGDEVKFGGGKVIRDGQGQ-GQALSRD-CLDLV
URE1_VIBFM      --ISRTAYANMFGPTTGDRLRLADTELFLEVEKDFTTYGEEVKFGGGKVIRDGMGQSQVVNSE--CVDVV
URE1_ARTAT      -EIPRKQYAQLYGPTTGDSIRLADTELFLEIEKDYTVYGEEVVFGGGKVIRDGMGQNGQLTRAEDIPDTV
URE1_RHILW      -KISRAAYAGMFGPTTGDKVRLADTELFIEIEKDFTTYGEEVKFGGGKVIRDGMGQS-QVTRADGAVDTV
URE1_RHIME      -RMSRAAYANMFGPTVGDKVRLADTELFIEVEKDFTTHGEEVKFGGGKVIRDGMGQS-QVTREGGAVDTV
URE1_PROVU      --ISRQAYADMFGPTTGDRLRLADTELFLEIEQDFTTYGEEVKFGGGKVIRDGMGQSQVVSAE--CVDVL
URE1_CYAP4      --MNRRAYAETYGPTVGDRVRLADTNLIIEVERDYTTYGDEVKFGGGKVIRDGMGQSP-ITNKDGAVDLV
URE1_BRAJA      VKIKRSVYADMFGPTTGDKVRLADTDLIIEVEKDFTVYGEEVKFGGGKVIRDGMGQS-QVTNKQGAADTV
URE1_PROMH      --ISRQAYADMFGPTTGDRLRLADTELFLEIEKDFTTYGEEVKFGGGKVIRDGMGQSQVVSAE--CVDVL
URE1_RHIEC      -KISRAAYAGMFGPTTGDKVRLADTELFIEIEKDFTTYGEEVKFGGGKVIRDGMGQS-QVTRADGAVDTV
URE1_ACIAD      MKMSRRAYAEMFGPTVGDRVRLADTELFIEVEQDLTTYGEEVKFGGGKVIRDGMGQSQLLA--DEVADTV
URE1_SINMW      -KMSRAAYANMFGPTVGDKVRLADTELFIEVERDFTTHGEEVKFGGGKVIRDGMGQS-QVTREGGAVDTV
URE1_RHIL3      -KISRAAYAGMFGPTTGDKVRLADTELFIEIEKDFTTYGEEVKFGGGKVIRDGMGQS-QVTRADGAVDTV
URE1_RHIE6      -KISRAAYAGMFGPTTGDKVRLADTELFIEIEKDFTTYGEEVKFGGGKVIRDGMGQS-QVTRADGAVDTV
URE1_TERTT      -KIDRKAYADMFGPTVGDRVRLADTELWIEVEKDFTIYGEEVKFGGGKVIRDGMGQSQASCADTP--DTV
URE1_MAGSM      --LDRGSYAAMFGPTVGDRVRLADTELIIEVEQDYTTYGEEVKFGGGKVIRDGMGQSQH-SRQEGAVDTV
URE1_POLSQ      -KVSRQAYAEMFGPTTGDRLRLADTGLMIEVEKDFTVYGEEVKFGGGKVIRDGMGQSQR-ESKDCA-DTV
URE1_SYNR3      -RIDRRTYAETYGPTTGDRVRLADTELILEVEKDYTVYGDEVKFGGGKVIRDGMGQ-GQTSRAAGAVDTV
URE1_BEII9      --LPRPAYAGMFGPTTGDKVRLADTELFIEIERDFTLYGEEVKFGGGKVIRDGMGQ-GQASKAEGAADTI
URE1_NITOC      MKISRHAYADTYGPTTGDRVRLADTDLWIKVERDLTTYGDEVKFGGGKVIRDGMGQSQ--LSRDQVMDLV
URE1_MESSB      -KISRAAYADMYGPTTGDKVRLADTELFIEVEKDFTTYGEEVKFGGGKVIRDGMGQS-QVSRADGAVDTV
URE1_CLOTH      VKISGKDYAGMYGPTKGDRVRLADTDLIIEIEEDYTVYGDECKFGGGKSIRDGMGQSPSAARDDKVLDLV
URE1_RHOS5      --ISRSTYAAMFGPTTGDRLRLGDTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQSQR-TRADGAMDTV
URE1_ROSDO      -KIPRTNYAAMFGPTTGDKVRLADTDLIIEVERDHTIYGEEVKFGGGKVIRDGMGQS-QVTRAQGAMDTV
URE1_ARTCA      -EIPRRQYADLYGPTTGDKIRLADTELFLEIEKDLTVYGEEVVFGGGKVIRDGMGQNGQATRDEDIPDTV
URE1_DECAR      -KITRQAYAEMFGPTTGDRMRLADTELIIEVEKDYTIYGEEVKFGGGKVIRDGMGQGQRLSAE--TVDTV
URE1_RHOS4      --ISRSTYASMFGPTTGDRLRLGDTELVIEVERDLTTYGEEVKFGGGKVIRDGMGQSQR-TRAEGAMDTV
URE1_RHOS1      --ISRSTYASMFGPTTGDRLRLGDTELVIEVERDLTTYGEEVKFGGGKVIRDGMGQSQR-TRAEGAMDTV
URE1_RHOSK      --ISRSTYASMFGPTTGDRLRLGDTELVIEVERDLTTYGEEVKFGGGKVIRDGMGQSQR-TRAEGAMDTV
URE1_RHISN      -KMSRAAYANMFGPTVGDKVRLADTELFIEVEKDFTTYGEEVKFGGGKVIRDGMGQS-QVSREGGAVDTV
URE1_MICAN      -RIDRRTYAETYGPTVGDKVRLADTELFIEVEKDFTTYGDEVKFGGGKVIRDGMGQSP-ISREDGAVDLV
URE1_ENT38      -EISRQAYADMFGPTTGDKVRLADTDLWIEVENDLTIYGEEVKFGGGKVIRDGMGQ-GQMTAQD-CVDLV
URE1_ECO5E      --ISRQAYADMFGPTTGDKIRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQMLSA--GCADLV
URE1_ECO57      --ISRQAYADMFGPTTGDKIRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQMLSA--GCADLV
URE1_RHOP5      IKISRSLYADMFGPTTGDRVRLADTDLIIEVEKDFTVYGEEVKFGGGKVIRDGMGQS-QVTNAEGAVDTV
URE1_DELAS      --ITRQAYAEMFGPTVGDRLRLADTALVIEIEKDHTIYGEEVKFGGGKVIRDGMGQSQRMAAD--CADTV
URE1_JANSC      -KIPRNDYAAMYGPTTGDRVRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQS-QVTRAQCAVDTV
URE1_RHOPB      VKIPRSVYADMFGPTTGDRVRLADTDLIIEVEKDFTIYGEEVKFGGGKVIRDGMGQS-QVTNAQGAADTV
URE1_SYNJA      MRLSREARARLYGPTVGDRIRLADTNLILEVEEDWTLPGEEAVFGGGKTVRDGMAQSQR-SRSEGAPDLV
URE1_PROMS      -KIDRKTYAQTYGPTTGDRVRLADTELFIEVEKDLTTYGDEVKFGGGKVIRDGMGQS-QVRRADGAVDTV
URE1_MARAV      MKISRQAYADMYGPTVGDRVRLGDTELWIEVEEDHTHYGDEVKFGGGKVIRDGMGQSQRCD--DAVMDTV
URE1_SACD2      -KISRRAYADMYGPTVGDKVRLADTALWIQVEKDFTIYGEEVKFGGGKVIRDGMGQSQATSDKTP--DTV
URE1_CITK8      -EISRQAYADMFGPTTGDRVRLADTELWIEVENDLTAYGEEVKFGGGKVIRDGMGQ-GQMRAR-ACVDLV
URE12_PSYCK     -RIDRRIYAEHFGPTTGDKVRLADTNLWLEVEYDLTSHGEEVKFGGGKVIRDGMGQS-QLLGEQVA-DTI
URE1_STAAW      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAT      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAS      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAN      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAM      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAE      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAC      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAA8      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAA3      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAA1      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_PROM0      -KIDRNTYAQTFGPTTGDRVRLADTELFIEVEKDLTTYGDEVKFGGGKVIRDGMGQS-QVRRADGAVDTV
URE1_HERA2      ----RQTYADLYGPTKGDRLRLADTELIIEIEHDFAHYGDEITFGGGKVIRDGMGQS---SSAHDVLDLV
URE1_AGRT5      -KISRAAYAGMFGPTVGDKVRLADTELFIEIEKDHTTYGEEVKFGGGKVIRDGMGQS-QATRAEGAVDTV
URE1_STAA9      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAA2      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_KOCRD      -EMSREQYASLYGPTTGDAIRLADTELFARIEKDLTAPGEEAVFGGGKVVRDGMGQNGRLGRDEDVPDLV
URE1_ANAVT      -RMSRQAYAETYGPTVGDRIRLADTELFIQVEQDFTTYGDEVKFGGGKVIRDGMGQSP-IANADGAVDLV
URE1_SYNS3      -RISRQAYAETYGPTTGDRIRLADTELILEVEKDFTTYGDEVKFGGGKVIRDGMGQS-QTSRAGGAVDTV
URE1_RHOPS      VKISRSVYADMFGPTTGDRVRLADTDLIIEVEKDFTTYGEEVKFGGGKVIRDGMGQS-QVTNKDGAADTV
URE1_RHOPA      -RISRSVYADMFGPTTGDRVRLADTDLIIEVEKDLTTYGEEVKFGGGKVIRDGMGQS-QVTNKDGAADTV
URE1_SILST      ----RSDYAAMYGPTTGDRVRLADTDLIIEVERDLTPYGEEVKFGGGKVIRDGMGQ-AQTTRAGGAVDTV
URE1_RHOPT      -RISRSVYADMFGPTTGDRVRLADTDLIIEVEKDLTTYGEEVKFGGGKVIRDGMGQS-QVTNKDGAADTV
URE1_RHILO      -RISRAAYAQMYGPTVGDKVRLADTELFIEVEKDLTIHGEEVKFGGGKVIRDGMGQS-QVSRAQGAVDTV
URE1_RALEH      -KISRQAYAEMFGPTTGDRLRLADTGLIIEIEKDFTIYGEEVKFGGGKVIRDGMGQSQRMASD--CVDTV
URE1_PSEE4      -RISRQAYADMFGPTVGDRVRLADTALWVEVEKDFTVYGEEVKFGGGKVIRDGMGQGQMLAAE--AMDLV
URE1_PROM9      -KIDRNTYAQTYGPTTGDRVRLADTELFIEVEKDLTTYGDEVKFGGGKVIRDGMGQS-QVTREDGAVDTV
URE1_SYNSC      -RISRQAYAETYGPTTGDRIRLADTDLILEVEKDYTVYGDEVKFGGGKVIRDGMGQS-QTPRAEGAVDTV
URE1_STAAR      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_STAAB      -KMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNPRVTRDDNVADLV
URE1_METFK      VKIDKRAYAEMFGPTVGDRMRLADTELWLEVEKDYTIYGEEVKFGGGKVIRDGMGQGQGVASE--VADTV
URE1_BACPA      MKINRQQYAESYGPTVGDRVRLADTDLG-EVEKDYYYLGDEVNFGGGKVLREGMGENGTYTRTENVXXXX
URE1_SYNPV      -RISRQAYAETYGPTTGDRLRLADTELILEVEKDFTVYGDEVKFGGGKVIRDGMGQS-QTPRAGGAVDTV
URE1_KLEP3      --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
URE1_RALEJ      VKISRQAYAEMFGPTTGDRVRLADTGLVIEVEKDFTIYGEEVKFGGGKVIRDGMGQSQRMA-KD-CVDTV
URE1_PSEPW      -RISRRAYADMFGPTVGDRVRLADTALWVEVEKDFTVYGEEVKFGGGKVIRDGMGQGQMLAAQ--AMDLV
URE1_PROM2      -KIDRKTYAQTYGPTAGDRVRLADTELFIEVEKDLTTYGDEVKFGGGKVIRDGMGQS-QVRRADGAVDTV
URE1_KLEP7      --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
URE1_KLEAE      --ISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQ-GQMLAAD-CVDLV
URE1_ANASP      -RMSRQAYAETYGPTVGDRIRLADTELFIQVEQDFTTYGDEVKFGGGKVIRDGMGQSP-IANADGAVDLV
URE1_RHOP2      -RISRSVYADMFGPTTGDRVRLADTDLIIEVEKDYTTYGEEVKFGGGKVIRDGMGQS-QVTNKDGAADTV
URE1_THEEB      -RIDRQTYAETYGPTVGDRLRLADTDLIIEIEHDYTHYGDEVKFGGGKVIRDGMGQSP-IANAEGAVDVV
URE1_SYNS9      -RISRQAYAETYGPTTGDRIRLADTELILEVEKDYTVYGDEVKFGGGKVIRDGMGQ-AQTPRSEGAVDTV
URE1_SYNPX      -RISRQAYAETYGPTTGDRVRLADTDLILEVEKDYTVYGDEVKFGGGKVIRDGMGQS-QTPRTEGAVDTV
URE1_MICLC      -EISREQYASLYGPTTGDAIRLADTELFAVVEEDLTTPGEEAVFGGGKVIRDGMGQNSQLVRDVGVPDLV
URE1_PSYIN      --IDKHSYAHMFGPTVGDRVRLADTDLWLEVEKDYTQYGEEVKFGGGKVIRDGMGQSQ--ASCFDTVDLV
URE1_ANADF      -RMDRRQYAQVYGPTTGDRVRLGDTALVLEVDRDLTVYGDECVFGGGKVLRDGMGQAAGAPPEE-VLDLV
URE1_DEIRA      MKVSRQQYADLYGPTVGDRVRLGDTELLIEVERDLTTYGEEVKFGGGKVIRDGLGQSSAATRDDANVDLV
URE1_ANASK      --LDRRQYAQIYGPTTGDRLRLGDTALVLEVERDLTTYGDECVFGGGKVLRDGMXXXXXXXXXX-VLDLV
URE1_PROM3      -RMDRQAYAETYGPTTGDRMRLADTELILEVERDFTTYGEEVKFGGGKVIRDGMGQSQQ-SRANGAVDTV
URE1_FLAJ1      LKINKLKYASMYGPTKGDKIRLADTDIIVEIEKDFTVYGDENKFGGGKTIRDGMAQSSTATRDQGVLDLV
URE1_BURP0      LRLSRRAYAEMFGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_BURMS      LRLSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_BURMA      LRLSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_BURM9      LRLSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_BURM7      LRLSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_OPITP      LKLTRRQYAEMFGPTVGDRVRLADTDLLVEVERDLIAYGNEIKFGGGKVIRDGMGQSPTARDAD-SLDLI
URE1_NOSP7      -RMDRRAYAETYGPTVGDRIRLADTELFIEVEQDFTSYGDEVKFGGGKVIRDGMGQSP-IANADGAVDLV
URE1_PROMM      -RIDRQAYAETYGPTTGDRIRLADTELILEVERDFTTYGEEVKFGGGKVIRDGMGQSQQ-SRANGAVDTV
URE1_BURPS      LRLSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_BURP6      LRLSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_DINSH      --ISRAAYADMYGPTTGDKVRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQS-QATRAEGAVDTV
URE1_BURP1      --MSRRAYAEMYGPTTGDRIRLADTELLIEVERDHTLYGEEVKFGGGKVIRDGMGQS-QLPAADVA-DTV
URE1_BURTA      --MSRRAYAEMYGPTTGDRIRLADTELLIEVERDYTIYGEEVKFGGGKVIRDGMGQS-QLSAADVA-DTV
URE1_BLOFL      --LNKKIYAEMYGPTVGDSVRLADTDLWVKIEKDFTIYGEEVKFGGGKVIRDGMGQ-GQMNNKE-CVDLV
URE1_BLOPB      MLLSKHDYASLFGPTIGDSVRLADTELWIRIEKDFTVYGEEVKFGGGKVIRDGMGQ-GQMSSKD-CVDLV
URE1_PSEPG      -RISRQAYADMFGPTVGDRVRLADTALWVEVEKDFTVYGEEVKFGGGKVIRDGMGQGQMLAAE--AMDLV
URE1_PSEP1      -RISRQAYADMFGPTVGDRVRLADTALWVEVEKDFTIYGEEVKFGGGKVIRDGMGQGQMLAAE--AMDLV
URE1_STACT      -KMTQSQYTSLYGPTIGDAIRLGDTNLFATIEKDFANYGDEATFGGGKSVRDGMAQNPNVTRDDRYVDTV
URE1_PSEPK      --ISRQAYADMFGPTVGDRVRLADTALWVEVEKDFTIYGEEVKFGGGKVIRDGMGQGQMLAAE--AMDLV
URE1_NITMU      -KVSRQTYAELMGPTTGDRIRLADTELMIEIEKDFTTYGEEVKFGGGKVIRDGMGQSQH--NHDQVMDTV
URE1_CYAP7      --INRQDYAAMFGPTVGDKIRLADTELLIEVEKDFTTYGEEVKFGGGKVIRDGMGQSPIINGDDDAVDTV
URE1_AGRRK      -KISRAAYANMFGPTTGDKVRLADTELFIEVEKDFTTYGEEVKFGGGKVIRDGMGQS-QVTRANGAVDTV
URE1_POLSJ      --IGRRAYAEMFGPTAGDRLRLADTDLVVEVEADYTLYGEEVKFGGGKTIRDGMAQSQK-TRAEGAMDTV
URE1_STAXY      -KMTQSQYTSLYGPTVGDSVRLGDTNLFARVEKDYATYGDEAAFGGGKSIRDGMAQNPNVTRDDKQVDLV
URE1_STAS1      -KMTQSQYTSLYGPTVGDSVRLGDTNLFARVERDYATYGDEAAFGGGKSIRDGMAQNPNVTRDDKQVDLV
URE1_SILPO      --ISRADYAAMFGPTTGDRLRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQ-AQTTRAEGAVDTV
URE1_HAEIE      LTISRAQYVATYGPTVGDKVRLGDTNLWATIEQDLLTKGDECKFGGGKSVRDGMAQSGTATRDNNVLDFV
URE1_HAEI8      LTISRAQYVATYGPTVGDKVRLGDTNLWATIEQDLLTKGDECKFGGGKSVRDGMAQSGTATRDNNVLDFV
URE11_PSYCK     MKISRDAYANMYGPTVGDRIRLGDTELWIEIEKDHTHYGEEVVFGGGKVIRDGMGQSQLCS--DSVMDTV
URE1_PARDP      --LSRADYAALYGPTTGDRIRLADTELLIEVERDLTIPGEEVRFGGGKVVRDGMGQS-QVTREAGAMDTV
URE1_CORGL      -EISRKQYTDLYGPTVGDSVRLADTELFLCVEKDYAAIGEEVAFGGGKVIRDGMGQNGTLVRDVDIPDTV
URE1_VEREI      --IGRRAYAEMFGPTVGDRLRLADTGLILEVEADYTLYGEEVKFGGGKTIRDGMAQ-AQHSRAQGAVDTV
URE1_HAHCH      -KISRAAYADMFGPTVGDRVRLGDTELWIEVEKDYATYGHEVKFGGGKVIRDGMGQSQRPNTE--AVDTV
URE1_HAEIN      LTISRAQYVATYGPTVGDKVRLGDTNLWATIEQDLLTKGDECKFGGGKSVRDGMAQSGTATRDNNVLDFV
URE11_BRUSU     -RISRATYAQMFGPTVGDKVRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQS-QLSRAEGAMDTV
URE1_RHOSR      -ELSRARYAELFGPTTGDRIRLADTDLLIEITEDRSLAGDEAVFGGGKVLRESMGQ-GRATRAEGAPDTV
URE1_PSEHT      MKISRQAYADMYGPTTGDRIRLGDTELWVEIEHDHTHYGEEVKFGGGKVIRDGMGQSQRCD--DAVMDTV
URE11_BRUAB     -RISRATYAQMFGPTVGDKVRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQS-QLSRAEGAMDTV
URE11_BRUA2     -RISRATYAQMFGPTVGDKVRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQS-QLSRAEGAMDTV
URE1_CLOPH      --MTRELYTAKYGPTVGDAVRLGDTDLFIEIEKDYTSYGDEVIFGGGKVIRDGMGQDPLISRAEGAMDLV
URE1_AZOSB      -KITRRAYAEMFGPTTGDKLRLADTELIIEVEKDYTIYGEEVKFGGGKVIRDGMGQGQQLAAE--IADTI
URE1_HAEIG      LTISRAQYVATYGPTVGDKVRLGDTNLWATIEQDLLTKGDECKFGGGKSVRDGMAQSGTATRDNNVLDFV
URE1_CYTH3      --LSRKSYADMFGVTTGDKITLGDTNLLVRVEKDLTVYGEECKFGGGKVLRDGMGQASGYKSDD-VLDLL
URE1_ALTMD      --IDKHSYAHMFGPTIGDRVRLGDTDLWLEVEKDFTEYGEEVKFGGGKVIRDGMGQSQ--ASCFDTPDLV
URE1_SHEHH      -KISRQAYADMFGPTVGDRVRLADTALMLEVEQDLTTYGEEVKFGGGKVIRDGMGQSQALS-KD-CVDAV
URE1_RHOOB      --LSRARYAELFGPTTGDRIRLADTDLLIEITEDRGLAGDEAVFGGGKVLRESMGQ-GRATRAEGAPDTV
URE1_MYCS2      --LSRSNYAALFGPTTGDRIRLADTDLLIEITEDRSLAGDEAVFGGGKVLRESMGQ-GRATRADGAPDTV
URE11_BRUME     -RISRATYAQMFGPTVGDKVRLADTDLIIEVERDLTTYGEEVKFGGGKVIRDGMGQS-QLSRAEGAMDTV
URE1_VARPS      --IGRRAYAEIFGPTVGDRVRLADTDLLIEVEADYTLRAXXXXXXXXXTIRDGMAQSQR-TRAQGAVDTV
URE1_ARCB4      MKISKEKYASMYGPTTGDRFRLADTTLIAKIEKDYTIYGEESKFGGGKTVRDGMAQSP--TAVDVA-DLI
URE1_STAES      -KMTQSQYTSLYGPTVGDSVRLGDTNLFAQVEKDYANYGDEATFGGGKSIRDGMAQNPNVTRDDNVADLV
URE1_STAEQ      -KMTQSQYTSLYGPTVGDSVRLGDTNLFAQVEKDYANYGDEATFGGGKSIRDGMAQNPNVTRDDNVADLV
URE1_ACIAC      --VSRRAYAEMFGPTVGDRVRLADTGLVAEVEQDFTLRAXXXXXXXXXTIRDGMAQSQR-TRAEGAMDTV
UREA_ASPFU      --MDREAYARMFGPTTGDLVRLGLTNLWVRVEKDCTVYGDECAFGGGKTLREGMGQSSERSATE-CLDTV
URE1_RALSO      LKITRRAYAEMFGPTTGDRVRLADTDLIVEVERDYTIYGEEVKFGGGKVIRDGMGQSQR-ESKDCA-DTV
URE1_FRAAA      -RLDRSRYASLYGPTVGDRIRLADTDLFIEVTEDLAGSGDEAVFGGGKVIRESMGQS-RATRAQGAPDLV
URE1_PROMT      -KISRQAYAETYGPTKGDRIRLADTDLILEVEQDHTHYGDEVKFGGGKVIRDGMGQSQQ-SRDNGVVDTV
URE1_MYCMM      -RLSRERYAQLYGPTTGDRIRLADTDLLVEITEDRCLAGDEAVFGGGKVLRESMGQ-GRVTRAEGAPDTV
URE1_LEPCP      ----RRAYAEMFGPTIGDRLRLADTELILEVEDDLTLRAXXXXXXXXXTIRDGMGQGQRVNGPGAAVDCV
URE1_TRIEI      -RMNRRTYAETFGPTVGDRVRLADTELFIQVEKDYTTYGDEVKFGGGKVIRDGMGQSP-ISREGGAVDLV
URE12_STRAW     -EISRPAYADLFGPTTGDRIRLADTDLLIEIEEDRSLAGDEAVFGGGKVIRESMGQ-ARATRADGTPDTV
URE1_COREF      --MSRKQHASMYGPTTGDRLRLADTGLFAEIEEDLTIAGEEAVFGGGKVVRVGMGQNGHRTREEDPPDTV
URE1_PROM1      -KISRQAYAETYGPTKGDRIRLADTDLILEVEQDHTHYGDEVKFGGGKVIRDGMGQSQQ-SRDNGVVDTV
URE1_ACTP7      LTIPRSQYVATYGPTVGDKVRLGDTDLWATIEQDFLTKGDECKFGGGKSVRDGMAQSSTATRDNNVLDFA
URE1_FRASC      -RLDRSRYAALYGPTVGDRIRLADTDLFIEVTEDRTGTGDEAVFGGGKVIRESMGQS-LATRAEGAPDLV
URE1_ACTPJ      ----RSQYVATYGPTVGDKVRLGDTDLWATIEQDFLTKGDECKFGGGKSVRDGMAQSSTATRDNNVLDFA
URE1_ACTP2      LTIPRSQYVATYGPTVGDKVRLGDTDLWATIEQDFLTKGDECKFGGGKSVRDGMAQSSTSTRDNNVLDFA
UREA_SCHPO      ----RKLYAVMYGPTTNDKIRLGDTNLIVRVEKDFTEYGNESVFGGGKVIRDGTGQSSS-KSMDECLDTV
URE1_RHOFD      --IGRRAYAEMFGPTVGDRVRLADTNLIIEVEDDYTLRAXXXXXXXXXTIRDGMAQSQR-SRAEGAVDTV
URE1_MYCUA      -RLSRERYAQLYGPTTGDRIRLADTDLLVEITEDRCLAGDEAVFGGGKVLRESMGQ-GRVTRAEGAPDTV
URE1_MYCSS      --LSRERYAALYGPTTGDRIRLADTDLVIEITEDRSLAGDEAVFGGGKVLRESMGQS-RATRADGAPDTV
URE1_MYCSK      --LSRERYAALYGPTTGDRIRLADTDLVIEITEDRSLAGDEAVFGGGKVLRESMGQS-RATRADGAPDTV
URE1_MYCSJ      --LSRERYAALYGPTTGDRIRLADTDLVIEITEDRSLAGDEAVFGGGKVLRESMGQS-RATRADGAPDTV
URE1_CAMLA      IKISKKDYVNMYGPTTNDRVRLADTDLILRVEKDYTLYGEEVKFGGGKNIRDGMAQS---VSEGDFPDLV
URE1_MYCVP      -QLSRERYAALYGPTTGDRIRLADTDLLIEITEDRSLAGDEAVFGGGKVLRESMGQS-RVTRADGAPDTV
URE1_JANMA      -KISRQAYAEIFGPTTGDRLRLADTELFIEIEKDFTTYGEEVKFGGGKVIRDGMGQSQR-NYKD-VMDTV
URE1_ACTPL      LTIPRSQYVATYGPTVGDKVRLGDTDLWATIEQDFLTKGDECKFGGGKSVRDGMAQSSTATRDNNVLDFA
URE1_CORU7      -EISRQQYGELYGPTTGDGIRLADTDLVLRIEKDLTAKGDEVGFGGGKVIREGMGMNARMTRDEGVVDTV
URE1_POLNA      --IGRRAYAEMFGPTVGDRLRLADTDLMVEVEADYTLRAXXXXXXXXXTIRDGMAQSQR-TNAEGAMDTV
URE1_BORPE      -RISRSAYAEIYGPTVGDRVRLADTLLLAEVEKDHTIFGEEVKFGGGKVIRDGMGQSQRLA--TDCVDTV
URE1_BORBR      -RISRSAYAEIYGPTVGDRVRLADTLLLAEVEKDHTIFGEEVKFGGGKVIRDGMGQSQRLA--TDCVDTV
URE1_PROS9      -KINRKTYAQTYGPTKGDRVRLADTELIIEVEKDFTTYGDEVKFGGGKVIRDGMGQS-QVTREDGAVDTV
URE1_PROMP      -KINRKTYAQTYGPTKGDRVRLADTELIIEVEKDFTTYGDEVKFGGGKVIRDGMGQS-QVTREDGAVDTV
URE1_NOCFA      -ELSRARYAELFGPTTGDRIRLADTDLLIEITEDRSLAGDEAVFGGGKVLRESMGQS-RATRADGAPDTV
URE1_LARHH      --ISRQQYADLFGPTTGDKIRLGDTSLFVSIEKDLRTYGDEAVYGGGKTLRDGMGMDNELTSIGGAPDLL
URE1_YEREN      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNHLTRDNGVLDLV
URE1_YERE8      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNHLTRDNGVLDLV
URE1_BORPA      -RISRSAYAEIYGPTVGDRVRLADTLLLAEVEKDHTIFGEEVKFGGGKVIRDGMGQSQRLA--TDCVDTV
URE1_YERPY      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPS      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPP      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPN      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPG      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPE      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPB      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERPA      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_YERP3      -QISRQEYAGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGEESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_CALS8      --IKREDYVKIYGPTVGDKIRLADTDLIIEIEKDYTVYGEECKFGAGKNIRDGMSQN-QFACNNSALDIV
URE1_FRASN      -ELERSRYATLYGPTVGDRIRLADTDLFIEVTDDLTATGDEAVFGGGKVIRESMGQ-ARATRAQGAPDLV
URE1_AZOPC      -QINRKLYSSMYGITTGDIVTLGDTNLKIQVEKDYTTYGEECVFGGGKVIRDGMGQASGFCDEE-VLDMV
URE1_CLOPE      -EISREQYAGMFGPTTGDSIRLGDTNLFAKIEKDMTVYGDESKFGGGKCLRDGMGQSATELRRDNVVDLI
URE1_SORC5      --MQRRHYVDIYGPTVGDRVRLGDTGLIAEVERDHTSYGDECKFGGGKVLRDRMGQMPGASN-DEALDCV
URE1_HELPS      -KISRKEYASMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
URE1_METPP      --IGRRAYAEMYGPTVGDRVRLADTELVIEVEADYTLRAXXXXXXXXXXIRDGMGQSQRPNGPGDAVDCV
URE1_HELHE      -KISRKEYVSMYGPTTGDKVRLGDTDLILEVEHDCTTYGEEIKFGGGKTIRDGMGQTNSPSSHE--LDLV
URE1_HELPY      -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
URE1_HELPJ      -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
URE1_HELPG      -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
URE1_HELP2      -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
URE1_HELPH      -KISRKEYASMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE--LDLI
URE1_HELHP      IKISRKQYASMYGPTTGDKVRLGDTNLFAEIEKDYTLYGEEIKFGGGKTIRDGMAQSASTYTNE--LDAV
URE11_STRCO     -ELSRTAYADLFGPTTGDRVRLADTDLFVEIEEDRSGSGDEAVFGGGKVLRESMGQ-GRTTRAQGAPDTV
URE1_STRSL      -KMDREEYAQHYGPTVGDSVRLGDTNLFAAIEKDFTVYGQESKFGGGKVLRDGMGVSATETRDNSVVDTI
URE12_BRUSU     -QISRQQYADLYGPTIGDKIRLGDSDLYVEIEKDLATYGDELQYGGGKTLRDGMGSENFLTQEAGCLDLV
URE1_HALMA      --IDRENYAELYGPTTGDKVRLGDTELFAKVEEDLRTHGDEAVFGGGKTLRDGLGMAPGVTQAEGALDWV
URE12_BRUME     -QISRQQYADLYGPTIGDKIRLGDSDLYVEIEKDLATYGDELQYGGGKTLRDGMGSENFLTQEAGCLDLV
URE12_BRUAB     -QISRQQYADLYGPTIGDKIRLGDSDLYVEIEKDLATYGDELQYGGGKTLRDGMGSENFLTQEAGCLDLV
URE12_BRUA2     -QISRQQYADLYGPTIGDKIRLGDSDLYVEIEKDLATYGDELQYGGGKTLRDGMGSENFLTQEAGCLDLV
URE1_UREUR      -KISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTTYGEESVFGGGKTLREGMGMNSTMKGNAEVMDLV
URE1_UREU1      -KISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTTYGEESVFGGGKTLREGMGMNSTMKGNAEVMDLV
URE1_HALWD      -KLSREAYTDLFGATEGDRLRLGDTNLLAKIEKDHGTYGDEAVFGGGKTMRDGMGMQSGTTQAEGALDWV
URE1_HELFE      -KISRKEYVSMYGPTTGDRVRLGDTDLILEVEHDCTTYGEEIKFGGGKTIRDGMSQTNSPSSYE--LDLV
UREA_CANEN      ----RKEYANKYGPTTGDKIRLGDTNLLAEIEKDYALYGDECVFGGGKVIRDGMGQS---CGHPPALDTV
URE1_PHOLL      --ISRQEYVGLFGPTTGDKIRLGDTNLFIEIEKDLRGYGDESVYGGGKSLRDGMGADNRMTSEN-ILDLV
UREA_CRYNE      -EMNREVYASMFGPTTGDKIKLADMDLWIEVEKDYTVYGEECKFGGGKVLRDGGGQSGR--HEHEVLDLV
URE1_MYCA9      -RLTREHYAKLYGPTTGDRIRLADTDLIIEITEDRCLAGEEAVFGGGKVLRESMGQS-RLTRAGGAPDTV
URE1_STRTD      -KMDREEYAQHYGPTVGDSVRLGDTNLFATIEKDFTVYGQESKFGGGKVLRDGMGVSATETRDNSVVDTI
URE1_STRT2      -KMDREEYAQHYGPTVGDSVRLGDTNLFAAIEKDFTVYGQESKFGGGKVLRDGMGVSATETRDNSVVDTI
URE1_STRT1      -KMDREEYAQHYGPTVGDSVRLGDTNLFAAIEKDFTVYGQESKFGGGKVLRDGMGVSATETRDNSVVDTI
URE1_MYCTU      -RLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCLAGDEAVFGGGKVLRESMGQ-GRASRADGAPDTV
URE1_MYCTA      -RLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCLAGDEAVFGGGKVLRESMGQ-GRASRADGAPDTV
URE1_MYCBT      -RLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCLAGDEAVFGGGKVLRESMGQ-GRASRADGAPDTV
URE1_MYCBP      -RLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCLAGDEAVFGGGKVLRESMGQ-GRASRADGAPDTV
URE1_MYCBO      -RLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCLAGDEAVFGGGKVLRESMGQ-GRASRADGAPDTV
URE1_EDWI9      --VSRKEYSSLFGPTVGDKIRLGNTELFIEIEKDLRGYGDESVYGGGKSLRDGMGANNNLTRDNGVLDLV
URE1_NATPD      --LPREEYTDLFGATVGDRIRLGDTSLLAEIEHDHATYGDEAVFGGGKTMRDGMGMQSGTTQADGALDWV
UREA_CRYNV      -EMNREVYASMFGPTTGDKIKLADMDLWIEVEKDYTVYGDECKFGGGKVIRDGGGQSGRHDHE--VLDLV
URE1_LACFE      --MDHEQFASFYGPTTGDSVRLGDTDLFAKIEKDLTVHGQESLFGGGKVLRDGMGVSATETRAENPMXXX
URE1_UREPA      -KISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTTYGEESVFGGGKTLREGMGMNSTMKGNAEVMDLV
URE1_UREP2      -KISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTTYGEESVFGGGKTLREGMGMNSTMKGNAEVMDLV
URE11_PSEU2     --MTRKEYAAMYGPTTGDAVRLGDTSLLAEVEFDHSVPGDECLHGGGKTLRDGMGLMPGHDSVDGALDML
URE1_SULTO      MRISRERYFELYGPTEGDKIRLGDTNLYITIEKDLIAKGDELVFGAGKTARDGLGLLPNVREEE-VMDLI
URE11_STRAW     --MNPYAYAATHGPRAGDRVRLGDSGLTIRVESDAQQYGDEFLAGFGKTARDGL--HLKAAAVRDTCDVV
URE12_STRCO     -------YAAAHGPRAGDRLRLGDSGLVIRVESDAQHYGDEFLAGFGKTARDGLHLKAAAV-RDTCXXXX
URE1_HELMU      IKISRKEYVSMYGPTTGDKVRLGDTELIAEIEKDYTVYGEEIKFGGGKTIRDGMSQS--VSPDVNELDAV
URE1_LISDA      ----------------------------------------------------------------------
UREA_SOYBN      ----------------------------------------------------------------------
DPYS_SACKL      -------------------------------------------------------------------DLI
HYDA_BURPI      ------------------------------------------------------------------MDII
ALLB_BACSU      -----------------------------------------------------------------AYDMV
URE1_ECOLX      --ISRQAYADMFGPTTGDRLRLADTELFL-----------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
ALLB_DESHY      -------------------------------------------------------------------DLI
ALLB_DESHD      -------------------------------------------------------------------DLI
HYDA_RHIRD      ------------------------------------------------------------------MDII
ALLB_BACLD      -------------------------------------------------------------------DSI
DHP1_CAEEL      --------------------------------------------------------------------LV
DHP2_CAEEL      ------------------------------------------------------------------MSLL
ADEC_STAMF      -----------------------------------------------------------ITGKKPA-DIV
ADEC_PARDP      ----------------------------------------------------------------------
HYDL_ARTAU      -------------------------------------------------------------------DVI
DHP1_CAEBR      --------------------------------------------------------------------LV
ADEC1_DESPS     ----------------------------------------------------------------------
PYRC_CLOBA      ------------------------------------------------------------------MELL
DHP2_CAEBR      ------------------------------------------------------------------MSLL
ALLB_ENTFA      -------------------------------------------------------------------ELV
ALLB_BACA2      -----------------------------------------------------------------AYDVI
DPYL3_RAT       ----------------------------------------------------------------------
DPYL3_MOUSE     ----------------------------------------------------------------------
DPYL3_HUMAN     ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
HUTI_SPHAL      ----------------------------------------------------------------------
ADEC_MOOTA      ------------------------------------------------------------TGKLPADTVI
ADEC_BACA2      ----------------------------------------------------------------------
MTAD_METTH      --------------------------------------------------------------------IL
HUTI_MYXXD      ----------------------------------------------------------------------
ADEC_CLOBA      ----------------------------------------------------------KVANKEVKADTV
ALLB_BACSK      ------------------------------------------------------------------LDLC
Y484_TREPA      --------------------------LWLKLKDGVPVYHRDVL-------RTTTGSEAVIVFTDNSLDIA
TRIA_ACIAI      ----------------------------------------------------------------------
HUTI_THEAC      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
ATZA_PSESD      ----------------------------------------------------------------------
DPYL3_XENTR     ----------------------------------------------------------------------
DPYL3_DANRE     ----------------------------------------------------------------------
DPY3B_XENLA     ----------------------------------------------------------------------
DPY3A_XENLA     ----------------------------------------------------------------------
HYDA_BACST      ---------------------------------------------------------------------L
HUTI_STRP1      ----------------------------------------------------------------------
DPYS_DICDI      --------------------------------------------------------------------IL
DPYL2_CHICK     ----------------------------------------------------------------------
ALLB_RUBXD      -----------------------------------------------------------------AFDLI
ALLB_BACHD      -------------------------------------------------------------------DLI
ADEC_CLOBB      ----------------------------------------------------------KVANKEVKADTV
PYRC_THETN      --------------------------------------------------------------------IV
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ADEC_CLOBL      -------------------------------------------------------------------DMV


                         .         .         *         .         .         .         .:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
URE1_BACSU      ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
URE1_BACA2      ITNAVILDYTGIVKADIGVKDGRIVGVGKSGNPDIMDGVDPYMIIGAGTEVISGEGKIVTAGGVDTHIHF
URE1_BACHD      ITNATIIDYTGIVKADIGIKDGHIVGIGKGGNPDIMDGVESHMIVGASTEAIAGEGLIVTAGGIDAHIHF
URE1_GEOKA      LTNAVIVDYTGIYKADIGIKDGNIAAIGKAGNPLLMDGVN--IVIGASTEVIAAEGKIVTAGGVDAHIHF
URE1_BACSB      LTNAIIVDYTGIYKADIGIKDGMIASIGKAGNPLLMDGVD--MVIGAATEVIAAEGMIVTAGGIDAHIHF
URE1_ALCBS      ITNALILDYWGIVKADIGIKNGRIAAIGKAGNPDVQPNVD--IIVGPGTDVIAGEGSIITAGGIDSHIHF
URE1_PSEF5      ITNALIIDHWGIVKADVGLKDGRIAAIGKAGNPDIQP--DVNIAIGASTEVIAGEGMILTAGGIDTHIHF
URE1_PSE14      ITNALIIDHWGIVKADVGIKNGRIAAIGKAGNPDIQPDVT--IAVGAATEVIAGEGMILTAGGVDTHIHF
URE1_PSESM      ITNALIIDHWGIVKADVGIKNGRIAAIGKAGNPDIQPDVT--IAVGAATEVIAGEGMILTAGGVDTHIHF
URE12_PSEU2     ITNALIIDHWGIVKADVGIKNGRIAAIGKAGNPDIQPDVT--IAVGAATEVIAGEGMILTAGGVDTHIHF
URE1_BACC1      ITNAIIIDYTGIYKADIGIKDGKISAIGKSGNPSVMDNID--IIIGTSTEVISGERKIVTAGGIDTHVHF
URE1_PSEAE      ITNALILDHWGVVKADVGLKDGRIQAIGKAGNPDIQPGVN--IAIGAGTEVIAGEGMILTAGGIDTHIHF
URE1_SYNY3      ITNALILDWWGIVKADVGIKNGRIYAIGKAGNPHIQDNVS--IIIGPSTEAIAGEGMILTAGGIDAHVHF
URE1_BURA4      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_PSEPF      ITNALIIDHWGIVKADVGLKDGRIAAIGKAGNPDVQPGVT--IAIGASSEVIAGEGMILTAGGIDTHIHF
URE1_BURM1      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IPIGAGTEVIAGEGLIVTAGGIDTHIHF
URE1_SYNJB      ITNALILDWWGIVKADVGIRDGYIVGIGKAGNPNIQAGVTPGMVVGPSTEVIAGENLILTAGGIDAHVHF
URE1_ARTS2      ITNAVILDYTGIYKADVAIRDGHIIKIGKAGNPQITDGVD--IVIGASTEIIAGERKILTAGGVDTHIHF
URE1_BURCM      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_METSB      ITNVVILDHTGVVKADVGLKDGRIAAIGKGGNPDIQPGVT--ITIGPGTEIIAGEGKILTAGGVDTHIHF
URE1_BURS3      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_BURCJ      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_BURCH      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_BURCC      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_BURCA      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_BURVG      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPGVT--IAIGAATEVIAGEGLIVTAGGIDTHIHF
URE1_VIBF1      ITNALILDHWGIVKADIGIKDGRIFGIGKAGNPDVQPNVD--IVVGPATEVVAGEGKIITAGGVDTHIHF
URE1_MARMS      ITNALVLDHWGIVKGDVGIKDGRIFKVGKAGNPDVQDNVD--IVVGPGTEVIAGEGSILTAGGIDAHIHF
URE1_AGRVS      ITNALIVDHWGIVKADIGLKDGRIVAIGKAGNPDTQPGVN--IIVGPGTEAIAGEGKIVTAGGMDSHIHF
URE1_TOLAT      ITNALIIDHWGIVKADIGVKNGRIAGIGKAGNPDVQPGVT--LVIGPGTEVIAGEGSIVTAGGIDSHIHF
URE1_VIBFM      ITNALILDHWGIVKADIGIKDGRIFGIGKAGNPDVQPNVD--IVVGPATEVVAGEGKIITAGGVDTHIHF
URE1_ARTAT      ITNVIVLDYTGIYKADIALKDGHIFKIGKAGNPQITDGVD--IVIGASTEIIAGERKILTAGGIDTHIHF
URE1_RHILW      ITNAVIVDHSGVYKADIGLKDGRIVAIGKAGNPDMQPGVN--IIVGPGTEAIAAEGKIVTAGGMDSHIHF
URE1_RHIME      ITNALILDHWGIVKADIGLKDGRIAAIGKAGNPDMQPGVT--IIVGPGTEVIAGEGKIVTAGGMDSHIHF
URE1_PROVU      ITNAIIIDHWGIVKADIGIKDGRITGIGKAGNPDVQPNVD--IVIGPGTEVVAGEGKIITAGGVDTHIHF
URE1_CYAP4      ITNALILDWWGIVKADVGIKEGRIERIGKAGNPYIQDNVD--IIIGPGTEVLAGEGMILTAGGIDTHIHF
URE1_BRAJA      ITNALIVDHWGIVKADVAIKDGMISAIGKAGNPDIQPGVT--IIIGPGTDVIAGEGKILTAGGFDSHIHF
URE1_PROMH      ITNAIILDYWGIVKADIGIKDGRIVGIGKAGNPDVQPNVD--IVIGPGTEVVAGEGKIVTAGGIDTHIHF
URE1_RHIEC      ITNAVIVDHSGIYKADIGLKNGRIAAIGKAGNPDMQPGVN--IIVGPGTEAIAGEGKIVTAGGMDSHIHF
URE1_ACIAD      ITNALIVDWWGIVKADVGLKNGRIWKIGKAGNPDIQPDIT--IPLGAATEVIAGEGQILTAGGIDTHIHW
URE1_SINMW      ITNALIVDHWGIVKADIGLKDGRISAIGKAGNPDTQAGVT--IIVGPGTEVIAGEGKIVTAGGMDSHIHF
URE1_RHIL3      ITNAVIVDHSGIYKADIGLKDGRIVAIGKAGNPDMQPGVN--IIVGPGTEAIAAEGKIVTAGGMDSHIHF
URE1_RHIE6      ITNAVIVDHSGIYKADIGLKNGRIAAIGKAGNPDMQPGVN--IIVGPGTEAIAGEGKIVTAGGMDSHIHF
URE1_TERTT      ITNALILDHWGIVKADVAIKNGRIATIGKAGNPDIQPGVT--IEVGPGTEVIAGEGQILTAGGIDAHIHF
URE1_MAGSM      ITNALIVDHWGIVKADVGIKDGRICAIGKAGNPDVQPNVD--IIIGPGTEAIAGEGRILTAGGIDAHIHW
URE1_POLSQ      ITNAVIIDHWGIVKADISIKNGRISNIGKAGNPDIQPGITS--VIGPGTEIIAGEGMIVTAGGIDTHIHF
URE1_SYNR3      ITNALILDWWGIVKADVGLKDGRICAIGKAGNPDISDGVT--IPIGPGTEAIAGEGHILTAGGIDTHIHF
URE1_BEII9      ITNAVIIDHWGIVKADVGLRDGRIIGIGKAGNPDVQPGID--LIIGPGTEIIAGEGRILTAGGFDSHIHF
URE1_NITOC      ITNALIVDHWGIIKADVGIKDGRIAAIGKAGNPDTQPNVDIN--IGAATEVIAGEGKILTAGGIDSHVHF
URE1_MESSB      ITNALVIDVTGIYKADIGLRDGRIAAIGKAGNPDTQPGVN--IIVGPGTEAIAGEGKILTAGGFDAHIHF
URE1_CLOTH      ITNAIIFDTWXXXXXXXXXXXXXXXXXXXXXNPKVMSGVSEDLIIGASTEVITGEGLIVTPGGIDTHIHF
URE1_RHOS5      ITNALILDWSGIYKADVGLRDGRIAKIGKAGNPDTQPGVD--IVIGPGTEIIAGEGRILTAGGMDAHIHF
URE1_ROSDO      ITNALIVDHTGIYKADVGLRDGRIARIGKAGNPDTQPGVD--IIIGPSTEAIAGEGKILTAGGFDSHIHF
URE1_ARTCA      ITNAVILDHSGIYKADVALRDGHIFRIGKAGNPQITDGVD--IVIGASTEIIAGERKILTAGGIDTHIHF
URE1_DECAR      ITNALIVDVTGIVKADIGLKEGRIAAIGKAGNPDIQPGVT--IVIGPGTEVIAGEGMIVTAGGIDSHIHF
URE1_RHOS4      ITNALIVDWTGIYKADVGLRDGRIAKIGKAGNPDTQPGVD--IVIGPGTEIIAGEGRILTAGGMDAHIHF
URE1_RHOS1      ITNALIVDWTGIYKADVGLRDGRIAKIGKAGNPDTQPGVD--IVIGPGTEIIAGEGRILTAGGMDAHIHF
URE1_RHOSK      ITNALIVDWTGIYKADVGLRDGRIAKIGKAGNPDTQPGVD--IVIGPGTEIIAGEGRILTAGGMDAHIHF
URE1_RHISN      ITNALIVDHWGIVKADIGLKDGRIAAIGKAGNPDTQPGVN--IIVGPGTEAIAGEGKIVTAGGMDSHIHF
URE1_MICAN      ITNALILDWWGIVKADVXXXXXXXXXXXXXXNPHIQDNVD--IIIGPATEALAGEGMILTAGGIDAHIHF
URE1_ENT38      LTNALIVDHWGIVKADIGVKDGRIFAVGKAGNPDIQPGVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
URE1_ECO5E      LTNALIIDYWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGVSTEIIAAEGRIVTAGGVDTHIHW
URE1_ECO57      LTNALIIDYWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGVSTEIIAAEGRIVTAGGVDTHIHW
URE1_RHOP5      ITNALIVDHWGIVKADVAIKDGLIHAIGKAGNPDIQPGVT--IIIGPGTDVIAGEGKILTAGGFDSHIHF
URE1_DELAS      ITNAVIIDHWGIVKADIAIKNGLIAGIGKAGNPDMQPGVT--IVIGPGTEIIAGEGMIVTAGGIDTHIHF
URE1_JANSC      ITNALIVDHSGIYKADVGLKDGRIHKIGKAGNPDTQPNVD--IIIGPGTEAIAGEGRILTAGGFDAHIHF
URE1_RHOPB      ITNALIVDHWGIVKADVALKDGYIAAIGKAGNPDIQPGVT--IIIGPGTDIIAGEGKILTAGGFDSHIHF
URE1_SYNJA      ITNAVVLDWWGVVKADVGVRDGRIVALGKAGNPDIMDGVTPGLEIGPGTEVISGQGRILTPGGIDVHIHF
URE1_PROMS      ITNALIVDWWGIIKADVGIKDGMIFEIGKAGNPDIQDNVD--IVIGASTEVIAGEGHILTAGSIDTHIHF
URE1_MARAV      ITNALILDWWGIVKADVGIQKGRIAAIGKAGNPDTQPDVT--IVIGPGTEIIAGEGKILTAGGIDPHIHF
URE1_SACD2      ITNALILDHWGIVKADVAIKNGRISAIGKAGNPDIQPGVT--IIVGPCTEVIAGEGQILTAGAIDSHIHF
URE1_CITK8      ITNALIVDHWGIVKADIGIKDGRIFAIGKAGNPDIQPNVT--IPIGVGTEAIAGEGKIVTAGGVDTHIHW
URE12_PSYCK     ITNALIVDYSGIYKADIAIKEGRISGIGKAGNPDIQPNVT--LPIGAATEIIAGEGKILTAGGIDSHIHF
URE1_STAAW      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAT      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAS      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAN      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAM      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAE      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAC      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAA8      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAA3      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAA1      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_PROM0      ITNALIVDWWGIIKADVGIKDGMIFEIGKAGNPDIQDNVD--IVIGASTEVIAGEGHILTAGSIDTHIHF
URE1_HERA2      ITNAIIIDHWGIVKGDIGIKQGRIVKVGKAGNPDTMAGVDPELVVGANTEVIAGEHMIVTAGGIDSHIHF
URE1_AGRT5      ITNAVIVDHSGIYKADVGLKNGRIHAIGKAGNPDTQPGVT--IIVGPSTEAIAGEGKILTAGGMDAHIHY
URE1_STAA9      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAA2      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_KOCRD      ITNVVVIDWTGICKADVAVRDGHIMRIGKAGNPHVMDGVD--IVIGVATDVIAGEGKILTAGGIDSHIHF
URE1_ANAVT      ITNALILDWWXXXXXXXXXXXXXXXXXXXXXNPYIQDHVD--IIIGPGTEALAGEGMILTAGGIDTHIHF
URE1_SYNS3      ITNALILDWWGIVKADIGLKDGRIVGIGKAGNPDIQEGVT--IVIGPGTEAIAGEGHILTAGGIDTHIHF
URE1_RHOPS      ITNALIVDHWGIVKADVAIKAGMISAIGKAGNPDIQPGVD--IIIGPGTDVIAGEGKILTAGGFDSHIHF
URE1_RHOPA      ITNALIVDHWGIVKADVAITAGVITAIGKAGNPDVQPNVD--IIIGPGTDVIAGEGKILTAGGFDSHIHF
URE1_SILST      ITNALILDWTGIYKADVGLKDGRIHAIGKAGNPDTQPNVT--IIVGPGTEVIAGEGRILTAGGFDSHIHY
URE1_RHOPT      ITNALIVDHWGIVKADVAITAGVITAIGKAGNPDVQPNVD--IIIGPGTDVIAGEGKILTAGGFDSHIHF
URE1_RHILO      ITNALVVDAAGIFKADIGLKDGRIAAIGKAGNPDTQDGVT--IIIGPGTEIIAGEGKILTAGGFDAHIHF
URE1_RALEH      ITNALIVDHWGIVKADXXXXXXXXXXXXXXXNPDIQPGVT--IVVGPGTEVIAGEGMIVTAGGIDSHIHF
URE1_PSEE4      LTNALIIDHWGIVKADIGVKHGRIAAIGKAGNPDVQXXXXXXXXXX--TEVIAAEGKIVTAGGIDSHIHF
URE1_PROM9      ITNALIMDWWGIIKADVGIKDGKIFEIGKAGNPDIQDNVD--IVIGASTEVIAGEGHILTAGAIDTHIHF
URE1_SYNSC      ITNALILDWWGIVKADVGLKDGRIVGIGKAGNPDTQEGVT--IVVGPGTEAIAGEGHILTAGGIDTHIHF
URE1_STAAR      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_STAAB      ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHF
URE1_METFK      ITNALIVDHWGIVKADIGIKGGYISAIGKAGNPDIQPGVE--IAIGAGTEVIAGEGMIVTAGGIDTHIHF
URE1_BACPA      XXXXXXXDYTGIYKADIGVKDGYIVGIGKGGNPDIMDGVTPNMIVGTATEVIAAEGKIVTAGGIDTHVHF
URE1_SYNPV      ITNALILDWWGIVKADVGLKDGRIVGIGKAGNPDTQAGVT--IVVGPGTEAIAGEGHILTAGGIDTHIHF
URE1_KLEP3      LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
URE1_RALEJ      ITNALIVDHWGIVKADXXXXXXXXXXXXXXXNPDIQPGVT--IVVGPGTEVIAGEGMIVTAGGIDTHIHF
URE1_PSEPW      LTNALIIDHWGIVKADIGVKHGRIAAIGKAGNPDVQXXXXXXXXXXX--EVIAAEGKIVTAGGIDSHIHF
URE1_PROM2      ITNALIVDWWGIIKADVGIKDGMIFEIGKAGNPDIQDNVD--IVIGASTEVIAGEGHILTAGSIDTHIHF
URE1_KLEP7      LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
URE1_KLEAE      LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
URE1_ANASP      ITNALILDWWXXXXXXXXXXXXXXXXXXXXXNPYIQDHVD--IIIGPGTEALAGEGMILTAGGIDTHIHF
URE1_RHOP2      ITNAVVVDHWGIVKADVAIKAGMIHAIGKAGNPDIQPNVD--IIIGPGTDIIAGEGKILTAGGFDSHIHF
URE1_THEEB      ITNAVILDWWGVVKADVXXXXXXXXXXXXXXNPYTQEGVD--IIIGPGTEAIAGEGMILTAGGIDAHIHF
URE1_SYNS9      ITNALILDWWGIVKADVGLRDGRIVAIGKAGNPDTQEGVT--IVVGPGTEAIAGEGQILTAGGIDSHIHF
URE1_SYNPX      ITNALILDWWGIVKADVGLKDGRIVGIGKAGNPDTQQGVT--IVVGPGTEAIAGEGHILTAGGIDTHIHF
URE1_MICLC      ITNVVVIDWTGIYKADIAVRDAHIVAIGKAGNPHTMDGVD--IVIGVATDVISGEGKILTAGGIDTHVHF
URE1_PSYIN      ITNALIVDHWGIIKADVGIKEGRIAIIGKAGNPDIQDNID--IEIGPGTEVIAGEGKILTAGGIDAHIHF
URE1_ANADF      ITNALVLDQGGVTKADVGIRGGRIAALGKAGNPDAMAGVTPGMTIGPGTECIAGEGLILTAGGVDSHIHF
URE1_DEIRA      ITNALILDYWGVIKADVGVKNGRISAIGKAGNPGTQDGVTPGLTIAASTEIVAGEGLVLTAGGVDTHIHF
URE1_ANASK      ITNALVVDHAGIFKADVGVRAGRIAALGKAGNPGVMAGVTPGMIVGPGTEVIAGEGLILTAGGIDTHIHF
URE1_PROM3      ITNALILDWWGIVKADIGLRDGRIVAIGKAGNPDITDGID--IVIGPGTEAIAGEGHIVTAGAIDSHIHF
URE1_FLAJ1      ITNATIIDHWXXXXXXXXXXXXXXXXXXXXXNPDTMDGVEPHMIIGASTEAHGGENLIVTAGGIDTHIHF
URE1_BURP0      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BURMS      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BURMA      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BURM9      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BURM7      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_OPITP      ITNALILDSRGVIKADLGIKHGLIVGIGHGGNPGIQSGVDPRMIVGAATEVIAGEGCIVTAGGIDTHIHF
URE1_NOSP7      ITNALILDWWXXXXXXXXXXXXXXXXXXXXXNPYIQDNVD--IIIGPGTEALAGEGMILTAGGIDAHIHF
URE1_PROMM      ITNALILDWWGIVKADIGLRDGRIVAIGKAGNPDITDGID--IVIGPGTEAIAGEGHIVTAGAIDSHIHF
URE1_BURPS      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BURP6      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_DINSH      ITNALIVDHTGIYKADVGLRDGVIAAIGKAGNPDTQTGVD--IIIGPGTEAIAGEGRILTAGGFDSHIHF
URE1_BURP1      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BURTA      ITNAVILDHWGIVKADIAIKHGRIAAIGKAGNPDIQPXXXXXXXXXXXXXXXXX--LIVTAGGIDTHIHF
URE1_BLOFL      LTNAIIIDYWGVIKADXXXXXXXXXXXXKSGNPDIQPGVT--IYIGPGTEVISAEGKIVTAGGIDVHVHF
URE1_BLOPB      LTNAVILDYWGIIKADXXXXXXXXXXXXKAGNPDVQPNVT--ISIGPGTEIIAAEGKIVTAGGIDAHVHF
URE1_PSEPG      LTNALIIDHWGIVKADIGIKHGRIAVIGKAXXXXXXXXXXXXXXXX--TEVIAAEGKIVTAGGVDSHIHF
URE1_PSEP1      LTNALIIDHWGIVKADIGIKHGRIAVIGKAXXXXXXXXXXXXXXXX--TEVIAAEGKIVTAGGVDSHIHF
URE1_STACT      ITNAVIIDYDKVYKADLGIKNGYIMKYGKAGNPDIMDDVD--IIIGASTDIISGEGKIVTAGGIDTHVHF
URE1_PSEPK      LTNALIIDHWGIVKADIGIKHGRIAVIGKAXXXXXXXXXXXXXXXX--TEVIAAEGKIVTAGGVDSHIHF
URE1_NITMU      ITNAVIIDHWGIVKADVGLKNGRIAEIGKAGNPDIQPNVT--MSIGAATEIIAGENMILTAGGIDSHIHF
URE1_CYAP7      ITNALILDWWGIVKADXXXXXXXXXXXXXXXNPYTQDNID--IIIGPGTEVIAGEGRIVTAGAIDTHIHF
URE1_AGRRK      ITNALIVDTWGIVKADVGLKNGRIAAIGKAGNXXXXXXXXXXXXXXXXXXXX--EGKILTAGGMDAHIHF
URE1_POLSJ      MTNALIMDHWGIVKADIGLKGGRIAVIGKAGNPDTQPGVD--MIIGPGTEIISCEGMIVTAGGIDSHIHF
URE1_STAXY      ITNALILDYDKIVKADIGVKNGYIMKIGKAGNPDIMDNVD--IIIGATTDIISAEGKIVTAGGIDTHVHF
URE1_STAS1      ITNAMIIDYDKIVKADIGVKNGYIMKIGKAGNPDIMDNVD--IIIGATTDIISAEGKIVTAGGIDTHVHF
URE1_SILPO      ITNALIVDHSGIYKADVGLKNGRIAKIGKAGNPDTQPGVD--IIVGPGTEAIAGEGRILTAGGFDSHIHF
URE1_HAEIE      ITNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHF
URE1_HAEI8      ITNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHF
URE11_PSYCK     ITNVIIIDWWGIVKADVGLKDGRIVAIGKAGNPDTQPDVDXXXXXXXXXXXXXNQ--ILTAGAVDTHVHY
URE1_PARDP      ITGAVVFDHQGITKADVGLRDGRIAGIGKAGNPDTQPGVT--LIIGPGTEIIAGEGRILTPGGMDCHIHF
URE1_CORGL      ITNVIVLDYTGVYKADVALRDGKIFRIGKAGNPNVMENVD--IVIGVATDIIAGEGKILTAGGIDTHVHF
URE1_VEREI      LTNALIMDAAGIVKADIGLRDGRIAAIGKAGNPDTQAGVD--IIIGPGTEVISCEGQIVTAGGIDSHIHF
URE1_HAHCH      ITNALILDHWGVVKADIGLKQGRIAAIGKAXXXXXXXXXXXXXXXX--TEVIAGEGMIATAGGIDAHIHF
URE1_HAEIN      ITNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHF
URE11_BRUSU     ITNALILDHSGIYKADIGLLDGRIALIGKAGNPDTQXXXXXXXXXXXXXXXXXX--KIVTAGGIDTHVHF
URE1_RHOSR      ITGVVVVDHWGIIKADVGIRDGRIVALGKAGNPDTMSGVHPDLVVGPSTEIIAGNGKILTAGGIDCHVHF
URE1_PSEHT      ITNAVIIDWWGIIKADVGLKNGRIAAIGKSGNPDTQXXXXXXXXXXXXXXXXXXQ--ILTAGGVDTHVHY
URE11_BRUAB     ITNALILDHSGIYKADIGLLDGRIALIGKAGNPDTQXXXXXXXXXXXXXXXXXX--KIVTAGGIDTHVHF
URE11_BRUA2     ITNALILDHSGIYKADIGLLDGRIALIGKAGNPDTQXXXXXXXXXXXXXXXXXX--KIVTAGGIDTHVHF
URE1_CLOPH      ITNAVILDYSGIYXXXXXXXXXXXXXXXXSGNPRIMKNVD--IIIGASTEIIAGEGLIVTAGGIDTHIHF
URE1_AZOSB      ITNALIVDVAGIVKADVGLKDGRIWKIGKGGNPDIQPGVT--IPVGAGTEVIAGEGMILTAGGIDSHIHW
URE1_HAEIG      ITNVMIIDARGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGVHLIATAGGIDTHIHF
URE1_CYTH3      ITNALIIDYTGIYKADIGIKNGHIKAIGKSGNPHIMPGVHPDMIAGTVTEVIAGEGMIITAGGIDNHIHY
URE1_ALTMD      ITNVVILDHWXXXXXXXXXXXXXXAIIGKAGNPDVQDNID--IEIGPGTEIIAGEGQIVTAGGIDAHIHF
URE1_SHEHH      ITNALILDHWGIVKADIGIKHGRIVGIGKAGNPDVQPNVD--IVXXXXXXXXXXXXXXXTAGAIDTHVHF
URE1_RHOOB      ITGVVVVDHWGIIKADVGIRGGRIVALGKAGNPDTMSGVHPDLVVGPSTEIIAGNGKILTAGGIDCHVHF
URE1_MYCS2      ITGAVILDHWGIIKADIGIRDGRIVAIGKAGNPDIMSGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHL
URE11_BRUME     ITNALILDHSGIYKADIGLLDGRIALIGKAGNPDTQXXXXXXXXXXXXXXXXXX--KIVTAGGIDTHVHF
URE1_VARPS      LTNALILDHWGIVKADIGLKDGRIAAIGKAGNPDVQPGVD--IVIGPGTEIISCEGNIVTAGGIDSHIHF
URE1_ARCB4      ITNAIIIDYTGIYKADIGIKDGKILAIGKSGNPNLCDGITEGLEIGANTEILSAEGKIITAGGIDTHIHF
URE1_STAES      LTNALIIDYDKIVKADIGIKNGYIFKIGKAGNPDIMDNVXXXXXXXXXXXXX--EGKIVTAGGIDTHVHF
URE1_STAEQ      LTNALIIDYDKIVKADIGIKNGYIFKIGKAGNPDIMDNVXXXXXXXXXXXXX--EGKIVTAGGIDTHVHF
URE1_ACIAC      LTNALVIDHWGIVKADIGLKDGRVAAIGKAGNPDTQPGVD--IVIGPGTEIISCEGNIVTAGGIDSHIHF
UREA_ASPFU      ITNALIIDWSGIYKADIGIKNGLISAIGKAGNPDMMDGVHPDMIVGSSTDVIAGENKIVTAGGFDTHIHF
URE1_RALSO      ITNALIIDHWGIVKADIGLKHGRIAAIGKAGNPDIQPGVT--IVIGPGTEIIAGEGMIVTAGGVDTHIHF
URE1_FRAAA      ITGAVVLDHWGVIKADVGIRDGRIVALGKAGNPDTMDGVHPDLVIGPGTEIIAGNGKILTAGAVDCHVHL
URE1_PROMT      ITNALILDWWXXXXXXXXXXXXXXXXXXXXXNPDTQEGVN--IIVGASTEAIAGEGSIITAGAIDSHIHF
URE1_MYCMM      ITGAVIIDYWGIIKADIGIRDGRIVAIGKAGNPNIMSGIHPDLVVGPSTEIIGGNGRIVTAGAIDCHVHL
URE1_LEPCP      ITNALIVDHWGIVKADIGLRGNRIAAIGKAGNPDIQPGVD--IVIGPGTEVIAAEGLIVTAGGIDSHIHW
URE1_TRIEI      ITNALILDWWGVVXXXXXXXXXXXXXXXXXXNPYIQDRVD--IIIGPSTEIIAGEGHIITAGGIDSHIHF
URE12_STRAW     ITGVVIVDHWGIVKADVGMRDGRITGIGKAGNPDTMDGVHPDLVIGPETEIIAGNGRILTAGAIDAHVHL
URE1_COREF      ITNVIVLDWSGIYKAXXXXXXXXXXXXXHAGNPDTMDGGT--IPIGVSTDIIAGEGKVLTAGGIDTHIHF
URE1_PROM1      ITNALILDWWXXXXXXXXXXXXXXXXXXXXXNPDTQEGVN--IIVGASTEAIAGEGSIITAGAIDSHIHF
URE1_ACTP7      LTNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHW
URE1_FRASC      ITGAVVLDHWGVVKADVGIRDGRIVALGKAGNPDTMDGVHPELVMGPGTEIIAGNGKILTAGAVDCHVHL
URE1_ACTPJ      LTNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHW
URE1_ACTP2      LTNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHW
UREA_SCHPO      ITNAVIIDHTGIYKADIGIKNGYIVGIGKAGNPDTMDNIGENMVIGSSTDVISAENKIVTYGGMDSHVHF
URE1_RHOFD      MTNALIIDHWGIVKADIGLKDSRIVAIGKAGNPDTQPGVD--IIIGPGTEVISCEGSIVTAGGFDSHIHF
URE1_MYCUA      ITGAVIIDYWGIIKANIGIRDGRIVAIGKAGNPNIMSGIHPDLVVGPSTEIIGGNGRIVTAGAIDCHVHL
URE1_MYCSS      ITGAVILDHWGIIKADIGIRDGRIVAIGKAGNPDIMDGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHL
URE1_MYCSK      ITGAVILDHWGIIKADIGIRDGRIVAIGKAGNPDIMDGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHL
URE1_MYCSJ      ITGAVILDHWGIIKADIGIRDGRIVAIGKAGNPDIMDGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHL
URE1_CAMLA      LTNALIVDYTGIYKADIGIKNGYIVGIGKAGNPDIQDGVDPSLIIGTNTDIIGAEGLIVTAGGIDTHIHF
URE1_MYCVP      ITGAVILDYWGIIKADIGIRDGRITAIGKAGNPDIMTGVHPGLVVGPSTEIIAGNGRIVTAGAIDCHVHL
URE1_JANMA      ITNAVIVEHWGIVXXXXXXXXXXXXXXXXXXNPDIQP--DVXXXXXXXXXXXXXXXXXVTAGGVDTHIHF
URE1_ACTPL      LTNVMIIDAKGIIKAXXXXXXXXXXXXXQAGNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHW
URE1_CORU7      ITNAIIVDHTGIYKADIGIRDGLIEGIGRAGNPDVQDDID--IPVGVNTEAYAGEHTIVTAGAIDTHIHF
URE1_POLNA      MTNALILDHWGIVKADXXXXXXXXXXXXXXXNPDVQPGVD--IIIGPGTEIISCEGMIVTAGGIDSHIHF
URE1_BORPE      ITNALIIDVTGIVKADIGIKDGLISGIGKAGNPDTQPGVT--IIIGASTEVVAGEGLIVTAGAIDTHIHF
URE1_BORBR      ITNALIIDVTGIVKADIGIKDGLISGIGKAGNPDTQPGVT--IIIGASTEVVAGEGLIVTAGAIDTHIHF
URE1_PROS9      ITNALIVDWWGIVKADVGLKDGKIYEIGKAGNPXXXXXXXXXX--GSSTEVIAGEGHILTAGSIDTHIHF
URE1_PROMP      ITNALIVDWWGIVKADVGLKDGKIYEIGKAGNPXXXXXXXXXX--GSSTEVIAGEGHILTAGSIDTHIHF
URE1_NOCFA      ITGAVIVDHWGIVKAXXXXXXXXXXXXXKAGNPDTMSGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHF
URE1_LARHH      ITNVTIIDAVGVIKADVGIKDGRICGIGKAGNPSTMPGVTPSLAVGPATDAISGEHLILTAGGIDAHVHM
URE1_YEREN      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTPGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERE8      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTPGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_BORPA      ITNALIIDVTGIVKADIGIKDGLISGIGKAGNPDTQPGVT--IIIGASTEVVAGEGLIVTAGAIDTHIHF
URE1_YERPY      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPS      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPP      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPN      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPG      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPE      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPB      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERPA      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_YERP3      ITNVTIVDARGVIKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHL
URE1_CALS8      ITNVVXXXXXXXXXXXXXXXXXXXXXXXXAGNPNVMDGVTPNMVIGPSTDVISGEGLIATAGAIDTHVHF
URE1_FRASN      ITGAVVLDHWGVVKADVGIRDGRISALGKAGNPDTMDGVHPDLVIGPGTEIIAGNGKILTAGAVDTHVHF
URE1_AZOPC      ITNALIIDYKGIYKADXXXXXXXXXXXXXAGNPHIQPGVSPTLIIGTITEVVSGEGRILTAGAIDTHVHY
URE1_CLOPE      ITSAVILDYTGIYKADIGIRDGKIVAIGNGGNPSIMDNVD--FIVGSSTEALSGEGLIVTAGGIDTHVHF
URE1_SORC5      ITNALIVDWTGVYKXXXXXXXXXXXXXXXXXNPRVMAGVTPGMIVGVTTEVIAGEGHIVTAGGVDAHIHF
URE1_HELPS      ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
URE1_METPP      VTNALILDHWGIVKADIGLRGQRIAAIGKAGNPDVQPGID--IVIGPGTEVIAGEGLIVTAGGIDCHIHF
URE1_HELHE      ITNALIVDYTGIYKADXXXXXXXXXXXXXXXXXDLQDGVCNRLCVGPATEALAAEGLIVTAGGIDTHIHF
URE1_HELPY      ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
URE1_HELPJ      ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
URE1_HELPG      ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
URE1_HELP2      ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
URE1_HELPH      ITNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
URE1_HELHP      ITNAMIIDYTXXXXXXXXXXXXXXXXXXXXXNPDTQDSVNEAMVVGAATEVIAGEGQIITAGGIDTHIHF
URE11_STRCO     ITGALIIDHWGIVKAXXXXXXXXXXXXXKAGNPDTMDGVHPDLVIGPETEIVAGNGKIVTAGGIDTHVHF
URE1_STRSL      ITGATIIDYTGIIKADIGIRDGKIVAIGRGGNPDTMDNVD--FVVGASTEAIAAEGLIVTAGGIDLHVHY
URE12_BRUSU     ITNVTVIDIQGVVKADVGIRNGRIVGLGKAGNPSTMDGVTRGLVTGASTDAISGEHLILTAGGMDTHVHY
URE1_HALMA      LTNATIIDILGIVAADIGIRNGEIAGIGKAGNPDTMDGVD--MVVGPSTDVYPAEGKIATAGGLDIHIHF
URE12_BRUME     ITNVTVIDIQGVVKADVGIRNGRIVGLGKAGNPSTMDGVTRGLVTGASTDAISGEHLILTAGGMDTHVHY
URE12_BRUAB     ITNVTVIDIQGVVKADVGIRNGRIVGLGKAGNPSTKDGVTRGLVTGASTDAISGEHLILTAGGMDTHVHY
URE12_BRUA2     ITNVTVIDIQGVVKADVGIRNGRIVGLGKAGNPSTKDGVTRGLVTGASTDAISGEHLILTAGGMDTHVHY
URE1_UREUR      ITNALILDYTGIYKADIGIKNGKIASIGKSGNPHLTDGVD--MVVGISTEVSAGEGKIYTAGGLDTHVHW
URE1_UREU1      ITNALILDYTGIYKADIGIKNGKIASIGKSGNPHLTDGVD--MVVGISTEVSAGEGKIYTAGGLDTHVHW
URE1_HALWD      FSNAVIIDILGIQKGDIGVRDGKIAGIGKAGNPDTMDGVDDELVIGPSTDTAPADGLIATPGGLDIHIHF
URE1_HELFE      LTNALIVDYTXXXXXXXXXXXXXXXXXXXXXXXXMQDGVDNNLCVGPATEALAAEGLIVTAGGIDTHIHF
UREA_CANEN      ITNAVIIDYTXXXXXXXXXXXXXXASIGKAGNPDIMNGVFSNMIIGANTEVIAGEGLIVTAGAIDCHVHY
URE1_PHOLL      ITSVTILDARGVIKADXXXXXXXXXXXXXXXNPNMMNGVTPGMVVGVSTDAISGEHLILTAAGIDTHIHF
UREA_CRYNE      ITNALIVDWNGIYKADXXXXXXXXXXXXXXXXPDMMDGVTDGMIVGSSTEVIAGEKLIITAGALDVHVHY
URE1_MYCA9      ITGAIIIDHWGIIKAXXXXXXXXXXXXXKAGNPDIMDGVDPALIVGPSTEIIAGNNRIVTAGGIDCHVHF
URE1_STRTD      ITGATIIDYTGIIKADIGIRDGKIVAIGRGGNPDTMDNVD--FVVGASTEAIAAEGLIVTAGGIDLHVHY
URE1_STRT2      ITGATIIDYTGIIKADIGIRDGKIVAIGRGGNPDTMDNVD--FVVGASTEAIAAEGLIVTAGGIDLHVHY
URE1_STRT1      ITGATIIDYTGIIKADIGIRDGKIVAIGRGGNPDTMDNVD--FVVGASTEAIAAEGLIVTAGGIDLHVHY
URE1_MYCTU      ITGAVIIDYWGIIKAXXXXXXXXXXXXXKAGNPDIMTGVHRDLVVGPSTEIISGNRRIVTAGTVDCHVHL
URE1_MYCTA      ITGAVIIDYWGIIKAXXXXXXXXXXXXXKAGNPDIMTGVHRDLVVGPSTEIISGNRRIVTAGTVDCHVHL
URE1_MYCBT      ITGAVIIDYWGIIKAXXXXXXXXXXXXXKAGNPDIMTGVHRDLVVGPSTEIISGNRRIVTAGTVDCHVHL
URE1_MYCBP      ITGAVIIDYWGIIKAXXXXXXXXXXXXXKAGNPDIMTGVHRDLVVGPSTEIISGNRRIVTAGTVDCHVHL
URE1_MYCBO      ITGAVIIDYWGIIKAXXXXXXXXXXXXXKAGNPDIMTGVHRDLVVGPSTEIISGNRRIVTAGTVDCHVHL
URE1_EDWI9      ITNVTIIDACGVIKADVXXXXXXXXXXXXXXNPNTMDGVTPTMVVGASTDAISGEHLILTAAGIDTHIHL
URE1_NATPD      FSNVVVVDVLGIRKXXXXXXXXXXXXXXKAGNPDTMDGVDDELVVGPSTDTVPADGLIATPGGLDIHVHF
UREA_CRYNV      ITNALIVDWTGIYKADXXXXXXXXXXXXXXXXPDMMDGVTDGMIVGSSTEVISGEKLITTAGRLDVHVHY
URE1_LACFE      XXXXXXXXXXXXYKADIGIRDGKILAIGKGGNPDVMDNVD--FIVGASTEAISGEGMIVTAGGIDLHVHY
URE1_UREPA      ITNALIVDYTGIYXXXXXXXXXXXXXXXXXXNPHLTDNVD--MIVGISTEISAGEGKIYTAGGLDTHVHW
URE1_UREP2      ITNALIVDYTGIYXXXXXXXXXXXXXXXXXXNPHLTDNVD--MIVGISTEISAGEGKIYTAGGLDTHVHW
URE11_PSEU2     ICNALXXXXXXXXXXXXXXXXXXXXXXXXXXNPQIMDGVHPQLICGVATTVRDAEGLIVTPGGIDVHVHF
URE1_SULTO      ITNVVILDLLGVIKADIGIKDGLIVGIGHGGNPFTMDGVN--FVLGSSTEIISGEGLIATPGFIDTHIHW
URE11_STRAW     ISNVVVIDAAGIRKVSIGIREGRICSIGRAGNPDTL--AXXXXXXXXXXXXXXXXXLIATAGAVDTHVHL
URE12_STRCO     XXXXXXXXXQGIRKVSIGIREGRVHAIGRAGNPXXXXXXXXXXXXXXS--IVSGEGLIATAGAVDTHVHL
URE1_HELMU      ITNAMIIDYTXXXXXXXXXXXXXXXXXXXXXNRDTQDGVGMDLVVGASTEAIAGEGLIVTAGGIDTHIHF
URE1_LISDA      ----------------------RISGIGKAGNPDVQPNVD--IVIGPGTEVVAGEGKIVTAGGIDTHIHF
UREA_SOYBN      ----------------------------------------------------------------------
DPYS_SACKL      IKNGIICTASDIYAAEIAVNNGKVQLIAASIDPSL------------GSEVIDAEGAFITPGGIDAHVH-
HYDA_BURPI      IKNGTIVTADGISRADLGIKDGKITQIGGA--------------LGPAERTIDAAGRYVFPGGIDVHTH-
ALLB_BACSU      IKGAKAVTPDGVIEADIVVQNGVIAEIGSD-------------IEASGTEIIQADGKYVFPGVIDCHVHF
URE1_ECOLX      ----------------------------------------------------------------------
HUTI_STRGC      ----------------IAVKDGKILAVG-SGEPDAS-------LIGPDTKIQSYEGKIATPGLIDCHTHL
HUTI_STRSV      ----------------IAVKDGKILAVG-SGEPDAS-------LVGPDTKIQSYEGKIATPGLIDCHTHL
ALLB_DESHY      LRNGNVVCPDGVRKADIAVSDGKIVLIAEE-------------IPGDAKEVIDAAGKHVFPGITDGHVHF
ALLB_DESHD      LRNGNVVCPDGVRKADIAVSDGKIVLIAEE-------------IPGDAKEIIDAAGKHIFPGITDGHVHF
HYDA_RHIRD      IKNGTIVTADGISPADLGIKDGKIAQIGGT--------------FGPAGRTIDASGRYVFPGGIDVHTH-
ALLB_BACLD      IKNGLVILENGEQEVEVGIKDGKIAAIGQD--------------LGTSAKIIDAKGSIVSPGMIDAHVHI
DHP1_CAEEL      IKNGTVVNEDGMFKADVLVRNGIIVEVS------------PNITALPDTEVIDATDRLVIPGGIDPHTHM
DHP2_CAEEL      IKNGTIVNDDAIFKSDVLVLDGRIVEIAPSIQPT------------PGLEVVDATDRLVIPGGIDPHTHM
ADEC_STAMF      ISNVLVLTPTGEINASIIISGKRIAGAGKYS--------ELHRFIGKNTLVIDGENNYAMPGFIDPHIH-
ADEC_PARDP      ---------------DVAVADGRVAYVGPDAGPSV----------GPGTQVIEADGRFMVPGLIDAHMH-
HYDL_ARTAU      VKNCRLVSSDGITEADILVKDGKVAAI----SADTSD-VEASRTIDAG-------GKFVMPGVVDEHVHI
DHP1_CAEBR      IKNGTVVNEDGMFKADVLVKNGIIVEVS------------PKIIALPEMEIIDATDRLVIPGGIDPHTHM
ADEC1_DESPS     ----------------------------------------------------------------------
PYRC_CLOBA      IKNARIIDAIQDFKGDIYIKDGVINEIAKEINKD-------------NVEVLNCEEKILMPAFIDTHAHF
DHP2_CAEBR      IKNGTIVNDDAMFKSDVLVHDGKIV--------EIAPSIDP----TPGLEVVDATDRFVIPGGIDPHTHM
ALLB_ENTFA      IKNGLVILETGEVITDVAVQGGKIVAIGQ----DL-----------SGERVIDATGLVVSPGMVDAHVHI
ALLB_BACA2      VKGAKAVRKGGTERADIAVKDGKIALIG--------PGIDEN-----AEQVVQADGMYVFPGAVDCHVHF
DPYL3_RAT       ------------------IKGGRIVNDDQSFYADIYDGIGDNLIVPGGVKTIEANGKMVMPGGIDVHTHF
DPYL3_MOUSE     ------------------IKGGRIVNDDQSFYADIYDGIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHF
DPYL3_HUMAN     ------------------IKGGRIVNDDQSFYADIYDGIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHF
HUTI_ALKOO      ----------------IAVAGDRIVGIG-SGE------ISADFQVGENTVIISGEGKTVTPGLIDPHTHL
HUTI_SPHAL      ----------------------------------------------------------------------
ADEC_MOOTA      KGGKVVNVFTGILPWDIAIKNGRIASVG-----------DVSAAVGPETEVIDASGYYLCPGFMDGHVH-
ADEC_BACA2      ----------GRQKADTVIKNGKIMDVFNSADIAITGGVIVGLGEYEGEEVIDAEGQMIVPGFIDGHVHI
MTAD_METTH      ITGPEILDAGGIRRGSVLIEDNRIADVSNTLSP------------GDADTVIDGTGKLLIPGLVNTHTH-
HUTI_MYXXD      --------------AVVGVREGRIAYVGPEAGL-------PTGAVGPGTEVVDAQGGFVGPGFVDPHTHL
ADEC_CLOBA      VKNGKILNFTGITRGDIAIVDGFIAGIGKYD----------------GEQIIDAQDKVIVPGFIDGHMH-
ALLB_BACSK      ITGGRVVLPSGVEETDVGIQAGKIARIGPINKKEARC-------------IMNANGQYVFPGAVDTHVHF
Y484_TREPA      ENTMVRISHTGMKKKDVRLVTGAIRYARAAGNP------AAHTVVGKTTISLSGDGQVNVRGG-------
TRIA_ACIAI      ----------------------------------------------------------------------
HUTI_THEAC      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
ATZA_PSESD      ----------------------------------------------------------------------
DPYL3_XENTR     ------------------IKGGRIVNDDQSFYADIYDGIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHL
DPYL3_DANRE     ------------------IKGGRIVNDDQSFYADIYDGVGDNLIVPGGVKTIEANGKMVIPGGIDIHTHL
DPY3B_XENLA     ------------------IKGGRIVNDDQSFYADIYDGIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHL
DPY3A_XENLA     ------------------IKGGRIVNDDQSFYADIYDGIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHL
HYDA_BACST      IKNGTIVTATDIYEADLLIQDGKIAVIGRNLDE-------------SGAEVIDATGCYVFPGGIDPHTHL
HUTI_STRP1      ----------------IAIKDGLIVALG-SGEPDAE-------LVGTQTIMRSYKGKIATPGIIDCHTHL
DPYS_DICDI      IKNGTVVNDDRYFKSDVLVENGIIKEISKNIEPK------------EGIKVVDATDKLLLPGGIDTHTHF
DPYL2_CHICK     ------------------IKGGKIVNDDQSFYADIYDGIGENLIVPGGVKTIEAHGRMVIPGGIDVHTRF
ALLB_RUBXD      VRGGTVVR-GGCEVADVGVADGVISAVG----PDLE---------GGAREEIDARGLLVLPGAIDAHVHF
ALLB_BACHD      IRSSTVVTETTTYRADVAIRNGIVSAITEPGSISSDDG-----------PAIDGTGLHLFPGMVDVHVHF
ADEC_CLOBB      VKNGKILNFTGIMRGDIAIVDGFIAGIGQY----------------EGEQIIYAQNKVIVPGFIDGHMH-
PYRC_THETN      IKNGIVIDFGGEEKADILINYGIIKGIDK--NIDVSDAI-----------VIDAEGKYVLPGFVDMHTHL
HUTI_STRPZ      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRPM      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRPG      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRPD      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRPC      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRPB      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRP8      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRP6      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_STRP3      ----------------IAIKDGLIVALG-SGEPDAE-------LVGPQTIMRSYKGKIATPGIIDCHTHL
HUTI_ALKMQ      ----------------IAIKGDKIVAVGSGL-------MEENLKIGKNTMVIDGKGKTVTPGLVDPHTHL
ADEC_CLOBL      IINSRLINVCTIENTDVAVSCGRIALVG-----------DAKHCIGENTEVIDAKGQYIAPGFLDGHIH-


                         +         .         .         .         .         *         .:210
query           ICPQQMEVXXXXXXXXXXXXXXXXXXXXXXXXCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
URE1_BACSU      ICPQQMEVXXXXXXXXXXXXXXXXXXXXXXXXCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
URE1_BACA2      ICPQQMEVXXXXXXXXXXXXXXXXXXXXXXXXCTSGAWYMSRMLEAAEEFPINVGFLGKGNASDKAPLIE
URE1_BACHD      ISPQQIDVAIASGITTMLXXXXXXXXXXXXXXXXXXXWNIERMLEAADAFPVNLGFLGKGNASTPAPLRE
URE1_GEOKA      ICPQQIETALSSXXXXXXXXXXXXXXXXXXXXXXXXEWNIYRMLEAAEAFPMNIGFLGKGNASAKEPIAE
URE1_BACSB      ICPQQIETALASGVXXXXXXXXXXXXXXXXXXXXXXXWNIHRMLQAAEEFPINLGFLGKGNCSDEAPLKE
URE1_ALCBS      ICPQQIDEALASXXXXXXXXXXXXXXXXXXXXXXXXXWNMARMLEAADCFPMNLGFLGKGNASLPESLSE
URE1_PSEF5      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXPWHMARMLQAADAFAMNIGFTGKGNASLPEPLIE
URE1_PSE14      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWHMARMLQASDSFPMNIGFTGKGNVSLPGPLIE
URE1_PSESM      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWHMARMLQASDSFPMNIGFTGKGNVSLPGPLIE
URE12_PSEU2     ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWHMARMLQASDSFPMNIGFTGKGNVSLPGPLIE
URE1_BACC1      ISPQQIDTALASXXXXXXXXXXXPAEGTKATTITPGSWNLRKMLEAAEAFPINLGFLGKGNSSSLPALEE
URE1_PSEAE      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXSGPWHMARMLQAADAFPMNIGFTGKGNASLPLPLEE
URE1_SYNY3      ICPQQIETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXWNIHRMLQAADGFPINLGFLGKGNGSQPAALAE
URE1_BURA4      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_PSEPF      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXPWHLARMLQAADAFPMNIGLTGKGNASLPEPLIE
URE1_BURM1      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASRPEPLLE
URE1_SYNJB      ICPQLCEFAIAXXXXXXXXXXXXXXXXXXXXXCTPGAWNLGKMLQAAEGFPVNLGFFGKGNAAFPAALRE
URE1_ARTS2      ISPDQVPTALXXXXXXXXXXXXXPAEGTKATTVTPGKWHIQRMLQATEGMPINIGLFGKGHASAVEPLAE
URE1_BURCM      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_METSB      IAPQQIEEALCSGVTTMLGGGSGPAEGTKATTCTSGPWHMMRMMQAAESLPMNIGFFGKGNASKPAALIE
URE1_BURS3      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_BURCJ      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_BURCH      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_BURCC      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_BURCA      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNASLPQPLVE
URE1_BURVG      ISPQQIDEALASGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAADGWPINLGFLGKGNVSVPQPLVE
URE1_VIBF1      ICPQQAEEGLTSGVTTFIGGGTGPVAGTNATTVTPGIWNMHRMLEAVDDLPINVGLFGKGCVSKPEALRE
URE1_MARMS      ICPQQVEEALTSGVXXXXXXXXXXXXXXXXXXXXXXPWYLGKMLQATDSMPMNLGFLGKGNASLPEALEE
URE1_AGRVS      ICPQQIEEALMSGLTCMLGGGTGPAHGTLATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASLPGALEE
URE1_TOLAT      ICPQQIDEALCSGVXXXXXXXXXXXXXXXXXXXXXXXWYMARMLEAAESLPMNLGFLGKGNASLPDALHE
URE1_VIBFM      ICPQQAEEGLTSGVTTFIGGGTGPVAGTNATTVTPGIWNIHRMLEAVDDLPINVGLFGKGCVSKPEALRE
URE1_ARTAT      ISPEQVPAALCNGITTMVGGGTGPAEGTKATTITPGAWHISRMLQAAEGLPVNIGLFGKGHASAVEPLAE
URE1_RHILW      IAPQQIEEALMSGMTCMLGGGTGPAHGTLATTCTPGPWHLARMIEAADAFPMNLAFAGKGNASLPGALTE
URE1_RHIME      ICPQQIEEALMSGLTCMLGGGTGPAHGTLATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASLPGALVE
URE1_PROVU      ICPQQAEEGLISGVTTFIGGGTGPVAGTNATTVTPGIWNMHRMLEAVDELPINVGLFGKGCVSQPEAIRE
URE1_CYAP4      ICPQQIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWNLYRMLQAADAFPMNLGFLGKGNASQPEALVE
URE1_BRAJA      ICPQQIEHALMSGVTSMLGGGTGPSHGTFATTCTPGPWHMGRMIQSFDAFPVNLGISGKGNASRPAPLVE
URE1_PROMH      ICPQQAQEGLVSGVTTFIGGGTGPVAGTNATTVTPGIWNMYRMLEAVDELPINVGLFGKGCVSQPEAIRE
URE1_RHIEC      IAPQQIEEALMSGMTCMLGGGTGPAHGTLATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASLPGALTE
URE1_ACIAD      ICPQQVETALXXXXXXXXXXXXXXXXXXXXXXXXXXXWHIGTMLQAIDDLPMNIGLLGKGNLSLPDPIRE
URE1_SINMW      ICPQQIDEALMSGITCMLGGGTGPAHGTLATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASLPGALVE
URE1_RHIL3      IAPQQIEEALMSGMTCMLGGGTGPAHGTLATTCTPGPWHLARMIEAADAFPMNLAFAGKGNASLPGALTE
URE1_RHIE6      IAPQQIEEALMSGMTCMLGGGTGPAHGTLATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASLPGALTE
URE1_TERTT      ICPQQIEEALTSGVXXXXXXXXXXXXXXXXXXXXXXXWHIQKMLQAGEAFPMNLGFLAKGNASLPTALNE
URE1_MAGSM      ICPQQIEDALHSGITTMLGGGTGPAEGTNATTCTPGPWHIARMLQAAEGLPMNMGFFGKGNASRPQGLEE
URE1_POLSQ      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWHIQRMLQSIDAYPMNIGLLGKGNASLPGGLRE
URE1_SYNR3      ICPQQIETAIASXXXXXXXXXXXXXXXXXXXXXXXXAFHISRMLQAADGLPVNLGFFGKGNASTPEALDE
URE1_BEII9      ICPQQIEEALASXXXXXXXXXXXXXXXXXXXXXXXXPWHIARMIEASDGFAMNLGFAGKGNASRSEGLVE
URE1_NITOC      ICPQLVEEALTSGVXXXXXXXXXXXXXXXXXXXXXXSWNIGRMLQAADAFPINMGFLGKGNASLPQSLEE
URE1_MESSB      ICPQQIEEAXXXXXXXXXXXXXXPAHGTLATTCTPGSFHIGRMIQSFDAFPMNIGLAGKGNASLPAPLIE
URE1_CLOTH      ICPQQIETALFSXXXXXXXXXXXPADGTNATTCTPGAFNIRKMLEAAEDFPVNLGFLGKGNASFETPLIE
URE1_RHOS5      ICPQQIEDSLHSGITTMLGGGTGPAHGTLATTCTPGPWHIGRMLQAADAFPINLAFAGKGNASLPAGLEE
URE1_ROSDO      IAPQQIDDALHSGVTTMLGGGTGPAHGTLATTCTPGSWHIGRMLQALDAFPMNFGISGKGNASQPAALVE
URE1_ARTCA      ISPDQVATALTSGVTTMIGGGTGPAEGTKATTVTPGKWHIHRMLQAAEAFPMNIGLFGKGHASAVEPLAE
URE1_DECAR      ICPQQIDEALYSGVXXXXXXXXXXXXXXXXXXXXXXXWHIHRMLEAADAFPMNLGFLGKGNASLPEALRE
URE1_RHOS4      ICPQQIEDSLHSGITTMLGGGTGPAHGTLATTCTPGPWHIGRMLQAADAFPINLAFAGKGNASLPAGLEE
URE1_RHOS1      ICPQQIEDSLHSGITTMLGGGTGPAHGTLATTCTPGPWHIGRMLQAADAFPINLAFAGKGNASLPAGLEE
URE1_RHOSK      ICPQQIEDSLHSGITTMLGGGTGPAHGTLATTCTPGPWHIGRMLQAADAFPINLAFAGKGNASLPAGLEE
URE1_RHISN      ICPQQIEEALMSGLTCMLGGGTGPAHGTLATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASLPGALVE
URE1_MICAN      ICPQQIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEWHIYRMLEAAEAFPMNLGFLGKGNSSQPEGLAE
URE1_ENT38      ICPQQAEEALVSGVXXXXXXXXXXXXXXXXXXXXXXXWYIARMLQAADTLPVNIGLLGKGNGSNPDALRE
URE1_ECO5E      ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXCTPGPWYIYQMLQAADSLPVNIGLLGKGNCSNPDALRE
URE1_ECO57      ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXCTPGPWYIYQMLQAADSLPVNIGLLGKGNCSNPDALRE
URE1_RHOP5      ICPQQIEHALMSGVTTMLGGGTGPSHGTFATTCTPGPWHIGRMMQSFDAFPVNLGISGKGNASRPAALQE
URE1_DELAS      ICPQQIDEALTSGVXXXXXXXXXXXXXXXXXXXXXXXWHMERMLQAVDGYPMNIGLLGKGNASQAAPLRE
URE1_JANSC      ICPQQIEDSLHSGITTMLGGGTGPAHGTLATTCTPGPWHIGRMLQSLDAFPMNFGLSCKGNASQPEALVE
URE1_RHOPB      ICPQQIEHALMSGVTSMLGGGTGPSHGTFATTCTPGPWHLGRMIQSFDAFPVNLGLAGKGNASQPAALKE
URE1_SYNJA      IAPQQAWEALFSXXXXXXXXXXXXXXXXKATTCTPGPWYIHRMLEALEGLPLNFGLLGKGNASSPQALEE
URE1_PROMS      ICPQQIETALSSGIXXXXXXXXXXXXXXXXXXXXXXSFHISRMLQSAEAFPMNLGFFGKGNSTNEINLID
URE1_MARAV      ICPQQVEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWHIGKMLQAVDSLPMNIGFLGKGNASLPEALEL
URE1_SACD2      ICPQQIDEALMSXXXXXXXXXXXXXXXXXXXXXXXXKWHIGKMLQAGESFAMNLGFLGKGNASLPGGLNE
URE1_CITK8      ICPQQAEEALVSGVXXXXXXXXXXXXXXXXXXXXXXXWYIARMLQAADSLPVNIGFLGKGNGSNPDALRE
URE12_PSYCK     IAPQQCETALMSGVTTMLGGGTGPAEGTLATTCTPGAYHIHSMLKATDAIPMNIGFLGKGNVSLPAPIVE
URE1_STAAW      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAT      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAS      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAN      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAM      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAE      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAC      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAA8      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAA3      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAA1      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_PROM0      ICPQQIETALASGIXXXXXXXXXXXXXXXXXXXXXXSFHISRMLQSAEAFPMNLGFFGKGNSTNETNLID
URE1_HERA2      IAPGQIPEALSNXXXXXXXXXXXXXXXXXXXXXXXXXWNMARMLQAADAWPVNLGFLGKGNAAQPESLIQ
URE1_AGRT5      ICPQQIEEALMSGVTCMLGGGSGPAHGTLATTCT-GAWHIERMIESFDAFPMNLALAGKGNASLPAPLEE
URE1_STAA9      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAA2      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_KOCRD      ISPDQIETALVSXXXXXXXXXXXPSESTKATTITPGAWNIHNMLRSFEQFPMNFGLLGKGHGSSVPAMAE
URE1_ANAVT      ICPQQIEVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXWNMYRMLQAADAFPMNLGFLGKGNASQPQGLTE
URE1_SYNS3      ICPQQIETALASGVXXXXXXXXXXXXXXXXXXXXXXXFHIGRMLQAAEGLPVNLGFFGKGNASTPEALEE
URE1_RHOPS      ICPQQIEHALMSGVTTMLGGGTGPSHGTFATTCTPGPWHIGRMIQSFDAFPVNLGISGKGNAALPGALIE
URE1_RHOPA      ICPQQIEHALMSGVTTMLGGGTGPSHGTFATTCTPGPWHIGRMIQSFDAFPVNLGISGKGNAALPGPLKE
URE1_SILST      ICPQQIEDALHSXXXXXXXXXXXPAHGTLATTCTPGAWHLGRMMQAADAFPMNLAFAGKGNASLPAAIEE
URE1_RHOPT      ICPQQIEHALMSGVTTMLGGGTGPSHGTFATTCTPGPWHIGRMIQSFDAFPVNLGISGKGNAALPGPLKE
URE1_RHILO      ICPQQIEEALMSGITTMLGGGTGPAHGTLATTCTPGPWHMARMIQSFDAFPMNIGLSGKGNASLPAALEE
URE1_RALEH      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWYMERMLQAADAYPMNIGLLGKGNASQQGPLLE
URE1_PSEE4      ICPQQVEEALTSGVXXXXXXXXXXXXXXXXXXXXXXXWYLARMLQAADSLPINIGLLGKGNASRPEALRE
URE1_PROM9      ICPQQIETALASGIXXXXXXXXXXXXXXXXXXXXXXSFHISRMLQSAEAFPMNLGFFGKGNSTNGRNLID
URE1_SYNSC      ICPQQIETALASGVXXXXXXXXXXXXXXXXXXXXXXXFHIGRMLQAAEGLPVNLGFFGKGNASTPEALEE
URE1_STAAR      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_STAAB      INPEQAEVALESXXXXXXXXXXXASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIE
URE1_METFK      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWHIHRMLQSADAFPMNLGFLGKGNASLPQPLRE
URE1_BACPA      INPDQVDVALANGITTLFGGGTGPAEGSKATTVTPGPWNIEKMLKSTEGLPINVGILGKGHGSSIAPIME
URE1_SYNPV      ICPQQIETALASXXXXXXXXXXXXXXXXXXXXXXXXAFHIGRMLQAAEGLPVNLGFFGKGNASTPEALEE
URE1_KLEP3      ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
URE1_RALEJ      ICPQQIEEALMSGVXXXXXXXXXXXXXXXXXXXXXXXWYMERMLQAIEAYPMNIGLLGKGNASQQAPILE
URE1_PSEPW      ICPQQVEEALTSGVXXXXXXXXXXXXXXXXXXXXXXXWYLARMLQAADSLPINIGLLGKGNASRPEALRE
URE1_PROM2      ICPQQIETALASGIXXXXXXXXXXXXXXXXXXXXXXSFHISRMLQSAEAFPMNLGFYGKGNSTNESNLID
URE1_KLEP7      ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
URE1_KLEAE      ICPQQAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
URE1_ANASP      ICPQQIEVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXWNMYRMLQAADAFPMNLGFLGKGNASQPQGLVE
URE1_RHOP2      ICPQQIEHALMSGVTTMLGGGTGPSHGTFATTCTPGPWHIGRMIQSFDAFPVNLGISGKGNAALPGALIE
URE1_THEEB      ICPQQXXXXXXXXXXXXXXXXXXXXXXXXX