[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bsub0:CAB15829.1

[Show Plain Result]


## Summary of Sequence Search
    1::82
    1::82      3e-43 100%   82 aa  YWDA_BACSU RecName: Full=Uncharacterized protein ywdA;
   62::109     7e-04  38% 1169 aa  EX5B_BORBU RecName: Full=Exodeoxyribonuclease V beta chain;        
    1::82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKEYALFVQSIET
YWDA_BACSU      MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKEYALFVQSIET
EX5B_BORBU      --------------------------------RILKVIENAYSNSKTNEILKEAYEQSKK--LFISTINK


                         .         .         *         .         .         .         .:140
query           FLRKSANNLKIK
YWDA_BACSU      FLRKSANNLKIK
EX5B_BORBU      FALHALNNFQIE