[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB12237.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e25A.bssp"
#ERROR : Can't open dsspfile "3e26A.bssp"
#ERROR : Can't open dsspfile "3ckqA.bssp"
#ERROR : Can't open dsspfile "3ckjA.bssp"
#ERROR : Can't open dsspfile "2d7iA.bssp"
#ERROR : Can't open dsspfile "2d0jD.bssp"
#ERROR : Can't open dsspfile "2bo4A.bssp"
#ERROR : Can't open dsspfile "2bo7A.bssp"
#ERROR : Can't open dsspfile "3bcvA.bssp"
#ERROR : Can't open dsspfile "2c0nA.bssp"
#ERROR : Can't open dsspfile "2d0jA.bssp"
#ERROR : Can't open dsspfile "2agdA.bssp"
#ERROR : Can't open dsspfile "2dm9A.bssp"
#ERROR : Can't open dsspfile "2ae7A.bssp"

## Summary of PDB Search
:420
    3e-28  16%  3e25A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-27  13%  3e26A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    7e-26  19%  3ckqA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-24  19%  3ckjA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    8e-24  16%  2d7iA  [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10
    2e-23   9%  2d0jD  [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
    5e-23  14%  2bo4A  [x.x.x] MANNOSYLGLYCERATE SYNTHASE
    2e-20  14%  2bo7A  [x.x.x] MANNOSYLGLYCERATE SYNTHASE
    7e-20  23%  3bcvA  [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN
    5e-18  11%  2c0nA  [x.x.x] A197
    3e-16   7%  2d0jA  [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
    3e-16   8%  2agdA  [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
    2e-11  10%  2dm9A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E
    5e-11   9%  2ae7A  [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
:420

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
3e25A           ---------------------------------------------KAGRTISVVLPALNEEATIESVIDS
3e26A           ----------------------------TTWHRPGWTIGELEAA-KAGRTISVVLPALNEEATIESVIDS
3ckqA           ----------------------------RSWNRPGWTVAELEAA-KAGRTISVVLPALDEEDTIGSVIDS
3ckjA           ---------------------------------------------KAGRTISVVLPALDEEDTIGSVIDS
2d7iA           -------------------YVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVH
2d0jD           -----------------------------------------------LPTIYAITPTYSRPVQKAELTRL
2bo4A           ---------------------------------------------------LVVFPFKHEHPEVLLHNVR
2bo7A           ---------------------------------------------------LVVFPFKHEHPEVLLHNVR
3bcvA           -----------------------------------------------IPKVSVIVPIYNVEKYLDQCVQA
2c0nA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------QLPTIYAITPTYSRPVQKAELTRL
2agdA           ---------------------------AKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYY
2dm9A           ------------------------------------------------------------------IISS
2ae7A           ---------------------------AKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYY


                         .         .         *         .         .         .         .:140
query           MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
3e25A           ISPLVDGLV-DELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPV-RPGKGEALWRSLAATSGDIVVF
3e26A           ISPLVDGLV-DELIVLDSGSTDDTEIRAIASGARVVSR-EQALPEVPVRPGKGEALWRSLAATSGDIVVF
3ckqA           ISPLVDGLV-DELIVLDSGSTDDTEIAVAAGARVVSREQALPEVPIRPGKGE--ALWRSLAASRGDIVVF
3ckjA           ISPLVDGLV-DELIVLDSGSTDDTEIRAVAAGARVVSREQALPEVPI-RPGKGEALWRSLAASRGDIVVF
2d7iA           SVNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKR--EGLIRTRMLGASVATGDVITF
2d0jD           ANTFRQVAQ-LHWILVEDAAARSELVSRFLARAGLPSTHLHVPTPRQRNAGLAWLRQRHQHQRAQPGVLF
2bo4A           VAAAHPR---VHEVLCIGYERDQTYEAVERAAPEISRATGTPVSVPGKGDGMNTALRYFLEETQWERIHF
2bo7A           VAAAHPR---VHEVLCIGYERDQTYEAVERAAPEISRATGLGTLRPGKGDGMNTALRYFLEETQWERIHF
3bcvA           L--LAQTLSDIEIILIDDESPDNCPKICDDYAAQYPNIKVIHKK-----NAGLGACNSGLDVATGEYVAF
2c0nA           -----------TLFFIPSGSVRLPLIDFLVK--NDIEYV-ILSRRNHVAVQR--EIALDFLEKDYDTLAF
2d0jA           ANTFRQVAQ-LHWILVEDAAARSELRFLARAGLPSTHLHVPTPRRGQRNAGLAWLRQRHQHQRAQPGVLF
2agdA           LHPVLQRQLDYGIYVINQAGDTIFNRAKLLN----------------------VGFQEALKDYDYTCFVF
2dm9A           VLEEVKR--RLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKT--LGLIASRIEEIKSELGDVSIE
2ae7A           LHPLQRQQLDYGIYVINQAGDT----------------------IFNRAKLLNVGFQEALKDYDYTCFVF


                         +         .         .         .         .         *         .:210
query           YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
3e25A           IDSDLINPHPLFVPWLVGPLLTGEGIQLVK------------SFYRRVTELVARPLLAALRPELGCVLQP
3e26A           IDSDLINPHPLFVPWLVGPLLTGEGIQLVK------------SFYRRVTELVARPLLAALRPELGCVLQP
3ckqA           VDSDLIPHPMFVPWLVGPLLTGDGVHLVKSFYRRPL-------GGRVTELVARPLLA-ALRPELGCILQP
3ckjA           VDSDLIPHPMFVPWLVGPLLTGDGVHLVKSFYRRPGRVTELVAR----------PLLAALRPELGCILQP
2d7iA           LDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVM
2d0jD           FADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFLQVIL
2bo4A           YDADITSFGPDWITKAEEAA-DFGYGLVRHYFPRASTDAMITWMITRTGFALLWP-----HTELSWIEQP
2bo7A           YDADITSFGPDWITKAEEAA-DFGYGLVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQP-----
3bcvA           CDSDDYVDSDYTYNVAQKYTCDAVFTFK------------LYKNKNEIHTLLKDLIASDPYAREERAIQV
2c0nA           LDEDVVPIEIDFQKVE-AKFNEGYDVVCGYYYLKTLRGYSVYRKDWEKEIFDGEVNGC------------
2d0jA           FADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVVIL
2agdA           SDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDD
2dm9A           LGETVDTMGGVIVETEDGRIRID--NTFEARMERFE----------------------------------
2ae7A           SDVDLIPMNDHNAYRCFSQPRHIS-VAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDD


                         .         .         .         +         .         .         .:280
query           PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGN
3e25A           LSGEYAASRELLTSLPFAPG--YGVEIGLLIDTFDRLGLDAIAQVNLGVRNRPLELGAMSRQVIATLLSR
3e26A           LSGEYAASRELLTSLPFAPG--YGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNPLDELGAMSRQVIATL
3ckqA           LGGEYAATRELLTSVPFAPG--YGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIAT
3ckjA           LGGEYAATRELLTSVPFAPG--YGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIAT
2d7iA           AGGLFAVDRKWFWELGGYDEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNL
2d0jD           SNPKAVFKRRGSQPGMQESDFLQITTVEELEP---KANNCTKVL---VWHTRTEKVNLANEPKYHLDTVK
2bo4A           LGGELLMRREVAAMLYEDERSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLYGGLDDLRTMLVECFAA
2bo7A           LGGELLMRREVAAMLYEDERSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLDLRTMLVECFAAIQSLQ
3bcvA           SAKVVLYRRNLIEKKHLRFRILPSEDLIFNVDVLANSNIVCVLP--------------------------
2c0nA           GLGFTFIKREFLEKIKRPAFLAIGEYFFSTHKPRTYALSSLKAYHFIDERLALSPDRKLILQNDHVARI-
2d0jA           SNPKAVFKRRGSQPGMQESD--FLKQITTVEELEPKANNCTKVL--------------------------
2agdA           IFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYP-
2dm9A           ----------------------------------------------------------------------
2ae7A           DIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLYQVLDVQRYP-


                         .         *         .         .         .         .         +:350
query           QYVVLKFLAQFFKLKRKRIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e25A           CGIPDSGVGLTQFYTRHTW---------------------------------------------------
3e26A           LSRCGIPDSGVGLTQFYT----------------------------------------------------
3ckqA           LLSRCGIPDSGVGLTQ------------------------------------------------------
3ckjA           LLSRCGIPDSGVGL--------------------------------------------------------
2d7iA           KRVAEVWMDEYAEYIYQRR---------------------------------------------------
2d0jD           IEV-------------------------------------------------------------------
2bo4A           IQSLQHEVVGQPAIHR------------------------------------------------------
2bo7A           HEVVGQPAIHRQEHPHRV----------------------------------------------------
3bcvA           ----------------------------------------------------------------------
2c0nA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
2ae7A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e25A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
2bo4A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3bcvA           ----------------------------------------------------------------------
2c0nA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
2ae7A           ----------------------------------------------------------------------