[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB13082.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2c5mB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2c1lA.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "1e6yA.bssp"
#ERROR : Can't open dsspfile "1akyA.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"

## Summary of PDB Search
:250
    1e-41  12%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-40  32%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-38  13%  3cmvG  [x.x.x] PROTEIN RECA
    8e-38  19%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-38  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    9e-38  14%  3cmvC  [x.x.x] PROTEIN RECA
    1e-37  14%  3cmvH  [x.x.x] PROTEIN RECA
    1e-36   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-35  28%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    5e-35  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-34  11%  2akaB  [x.x.x] DYNAMIN-1
    2e-33   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    4e-33   9%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-32  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-32  14%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    2e-32  14%  3cmvA  [x.x.x] PROTEIN RECA
    7e-32   8%  2bifA  [c.37.1 - c.60.1] PROTEIN
    8e-32  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-31  13%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    2e-31  12%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-31  14%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    5e-31  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-31  12%  2cckA  [x.x.x] THYMIDYLATE KINASE
    3e-30   9%  1aroP  [e.8.1] T7 RNA POLYMERASE
    3e-30  13%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    8e-30  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    9e-30  10%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-29  10%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    2e-29  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    3e-29  10%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-29   9%  4dcgA  [x.x.x] VP39
    4e-29  20%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-28  11%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-28  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-28  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-28  17%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-28   9%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-27  10%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    2e-27  12%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-27   8%  2cgtH  [x.x.x] 60 KDA GROEL
    4e-27  10%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-26  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-26   9%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-26  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-26   8%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    2e-26   6%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    4e-26  10%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    5e-26   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    5e-26  10%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    5e-26  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-26   8%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25  28%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-25   8%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-25   8%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-25  10%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-25   6%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    5e-25  14%  3cmvE  [x.x.x] PROTEIN RECA
    7e-25  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-25  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-25  11%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-24  11%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    1e-24  14%  3cmxA  [x.x.x] PROTEIN RECA
    2e-24  32%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-24  16%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    4e-24  26%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    5e-24   9%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    7e-24   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    8e-24  12%  2axzC  [x.x.x] PRGX
    8e-24  13%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-23  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-23  10%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    1e-23  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-23  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-23  13%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-23  15%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-23  10%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-23  11%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-23  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-23  15%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-23  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    5e-23  12%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-23  11%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-23  12%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-22   8%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-22  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-22  11%  1e0jA  [c.37.1] DNA HELICASE
    2e-22  10%  2c9oC  [x.x.x] RUVB-LIKE 1
    3e-22  10%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-22   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    6e-22  11%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    9e-22   8%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-21  10%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-21  11%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-21  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    1e-21   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-21  10%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-21  11%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    2e-21  15%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    3e-21  15%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-21  11%  421pA  [x.x.x] H-RAS P21 PROTEIN
    6e-21  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-20  10%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-20   9%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-20  10%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    1e-20   9%  2ctsA  [x.x.x] CITRATE SYNTHASE
    1e-20  10%  3be4A  [x.x.x] ADENYLATE KINASE
    1e-20  10%  2cckB  [x.x.x] THYMIDYLATE KINASE
    2e-20   9%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-20  11%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-20  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    3e-20  12%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    4e-20   9%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-20  13%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    4e-20  11%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    4e-20  30%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-20  10%  3dlbB  [x.x.x] ARGONAUTE
    5e-20  12%  1e0jB  [c.37.1] DNA HELICASE
    5e-20  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    6e-20  30%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    6e-20  14%  3cmtD  [x.x.x] PROTEIN RECA
    6e-20  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-20  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    9e-20  12%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-19  11%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-19  10%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    2e-19   6%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    2e-19  11%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-19  10%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-19  11%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-19  10%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-19   8%  1e6cA  [c.37.1] SHIKIMATE KINASE
    8e-19  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-19  12%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-19   9%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    8e-19  13%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    9e-19  15%  3cmvB  [x.x.x] PROTEIN RECA
    1e-18  12%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    1e-18  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-18  15%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    1e-18  11%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-18  24%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-18  21%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-18  11%  2bdtA  [x.x.x] BH3686
    2e-18  13%  2bx2L  [x.x.x] RIBONUCLEASE E
    2e-18  11%  3adkA  [x.x.x] ADENYLATE KINASE
    2e-18  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-18  13%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-18  15%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-18  14%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-18   2%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    3e-18  16%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-18  10%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    4e-18  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    4e-18  10%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-18  10%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    4e-18  13%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-18   9%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-18  10%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    5e-18  12%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-18  13%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-18   9%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-18  28%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-18   9%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    1e-17  11%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-17  15%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-17   4%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    1e-17  28%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-17   9%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-17   8%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-17  11%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    2e-17  10%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-17  11%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-17   9%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-17   8%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    3e-17   9%  2b8tC  [x.x.x] THYMIDINE KINASE
    3e-17  11%  3da4A  [x.x.x] COLICIN-M
    4e-17   9%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-17  11%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-17   8%  2c4rL  [x.x.x] RIBONUCLEASE E
    6e-17  12%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-17  14%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    7e-17  11%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-17   9%  2c0bL  [x.x.x] RIBONUCLEASE E
    7e-17  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-17  22%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-16  11%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-16  12%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-16  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-16  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-16   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    2e-16  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    2e-16  15%  3cm0A  [x.x.x] ADENYLATE KINASE
    2e-16   2%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    2e-16   9%  3bczC  [x.x.x] PROTEIN MEMO1
    2e-16  10%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-16   9%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-16  11%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-16  11%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-16   7%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-16  13%  3a00A  [x.x.x] GUANYLATE KINASE
    3e-16  11%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16   9%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-16   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    6e-16  14%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-16   9%  1adoA  [c.1.10] ALDOLASE
    7e-16  15%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-16  10%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-16  15%  3cmwC  [x.x.x] PROTEIN RECA
    9e-16   9%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-16  10%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    1e-15   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    1e-15  14%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    2e-15   9%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-15  14%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    3e-15   9%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-15  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    3e-15  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-15   7%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    4e-15  10%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-15  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    5e-15  13%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    6e-15   7%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-15  10%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-15  11%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    8e-15  13%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    8e-15  11%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-15  13%  2bhvA  [x.x.x] COMB10
    8e-15  11%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-14   9%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    1e-14  15%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-14  14%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-14   2%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    2e-14  11%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    2e-14  19%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    2e-14   8%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    2e-14  12%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-14  11%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    4e-14  20%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    4e-14  12%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-14   7%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    5e-14  12%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-14   9%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-14  15%  2a1fC  [x.x.x] URIDYLATE KINASE
    5e-14   9%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    5e-14   3%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    6e-14   2%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    6e-14  12%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-14  11%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-14  11%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    7e-14  15%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-14  10%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-14   7%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    8e-14  29%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-14  10%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-13  14%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-13  17%  2d2fA  [x.x.x] SUFC PROTEIN
    1e-13   8%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-13  12%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-13  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-13  10%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13   6%  1eamA  [c.66.1] PROTEIN (VP39)
    2e-13  12%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-13  14%  2anbA  [x.x.x] GUANYLATE KINASE
    3e-13  13%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    3e-13   9%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    4e-13   9%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-13  10%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-13  10%  3ec1A  [x.x.x] YQEH GTPASE
    6e-13   9%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    6e-13  14%  2c5mD  [x.x.x] CTP SYNTHASE
    1e-12  12%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    1e-12  11%  1e2hB  [c.37.1] THYMIDINE KINASE
    1e-12  15%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-12  15%  2ancB  [x.x.x] GUANYLATE KINASE
    2e-12   7%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-12  12%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-12   9%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-12  13%  2bhvD  [x.x.x] COMB10
    3e-12  11%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-12  16%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-12  14%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-12  14%  3cmuA  [x.x.x] PROTEIN RECA
    4e-12  14%  2an9A  [x.x.x] GUANYLATE KINASE
    7e-12   9%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-12  15%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-12  11%  2dftA  [x.x.x] SHIKIMATE KINASE
    8e-12  10%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-11   8%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    1e-11  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-11  14%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    2e-11  11%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-11  12%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-11   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    4e-11   6%  3bm2B  [x.x.x] PROTEIN YDJA
    4e-11   8%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    4e-11  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    6e-11  15%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    7e-11  13%  1e2kB  [c.37.1] THYMIDINE KINASE
    7e-11   9%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    8e-11  23%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  14%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    2e-10   7%  3dfdA  [x.x.x] PROTEIN YQBN
    2e-10  16%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-10  12%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    4e-10  13%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-10  11%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    5e-10  14%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    6e-10  10%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    6e-10  17%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    6e-10   9%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    8e-10  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    8e-10  16%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    8e-10   9%  2c9oA  [x.x.x] RUVB-LIKE 1
    9e-10  15%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    9e-10  12%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    1e-09  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-09  14%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-09   7%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-09  15%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-09  22%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-09   9%  3dkvA  [x.x.x] ADENYLATE KINASE
    2e-09  12%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-09   9%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-09  13%  1e2lA  [c.37.1] THYMIDINE KINASE
    3e-09  10%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-09  12%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    3e-09  12%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-09  11%  1e2nA  [c.37.1] THYMIDINE KINASE
    6e-09  11%  1e2hA  [c.37.1] THYMIDINE KINASE
    7e-09  10%  2bhvC  [x.x.x] COMB10
    8e-09  11%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-08  10%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-08   9%  1chdA  [x.x.x] CHEB METHYLESTERASE
    1e-08  16%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-08  10%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-08  10%  1e2mA  [c.37.1] THYMIDINE KINASE
    3e-08  12%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-08  19%  2ancF  [x.x.x] GUANYLATE KINASE
    7e-08  14%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    8e-08   8%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    1e-07   9%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  10%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-07  13%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-07  11%  2c9gA  [x.x.x] PENTON PROTEIN
    2e-07  11%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    2e-07   8%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    3e-07  10%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-07  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    4e-07  19%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-07  23%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-07  15%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-06   5%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-06  13%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    4e-06  11%  2cdnA  [x.x.x] ADENYLATE KINASE
    5e-06  15%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    7e-06  10%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-05  19%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-05  22%  2c5mB  [x.x.x] CTP SYNTHASE
    2e-05  19%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-05  19%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-05  12%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-05  12%  2c95B  [x.x.x] ADENYLATE KINASE 1
    4e-05  11%  2c1lA  [x.x.x] RESTRICTION ENDONUCLEASE
    5e-05  14%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    7e-05  10%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    9e-05  20%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    9e-05  15%  2c9oB  [x.x.x] RUVB-LIKE 1
    1e-04  17%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    1e-04   8%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-04  33%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    2e-04  21%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    2e-04   7%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-04   8%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-04  12%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    2e-04  18%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    3e-04   4%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    5e-04  14%  1e6yA  [d.58.31 - a.89.1] METHYL-COENZYME M REDUCTASE I ALPHA
    5e-04  29%  1akyA  [x.x.x] ADENYLATE KINASE
    7e-04  18%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    7e-04   9%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-04  17%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
:250

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLSMCNLMRTPDS
3dmdC           ------------AVKEAVSEILETSRRI--DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHG
3b5jA           ----------HDITFRNIRFRYKPDSPV--ILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPEN
3cmvG           --------RLGEDRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2d3wB           ------------LSIKDLHVSV--EDKA--ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEV
3dmdB           ----GKIIEEAVKEAVSEILETSR----RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHG
3cmvC           ------------DRSMDVETISTGSLSL--DIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
3cmvH           ---------LGEDRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2dwoA           ---------LTQSRVQKIWVPVDHR-----PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIG
3b60A           ----------GDLEFRNVTFTYPGREVP--ALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDE
2c03B           --------TPAEVILATVYEALKE----ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKG
2akaB           ---------------EDLIPLVNRLQ---DAFSAIGNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPR
1bifA           -----------------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIG
2dwpA           ------------------------------RVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLNWIG
2ccgA           -------------------------------------------FITFEGPEGSGKTTVINEVYHRLVKDY
1d1cA           -----------------------------DVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVA
3cmvA           ----------RSMDVETISTGSLSL-----DIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2bifA           -------------------------------------------LIVMVGLPARGKTYISKKLTRYLNFIG
1e9cA           ---------------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAG
2ccgB           -----------------------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDY
3dm5A           ----------KKEHIIKIVYEELTKFLGT--EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRG
2ccjB           -------------------------------------------FITFEGPEGSGKTTVINEVYHRLVKDY
2c03A           --------TPAEVILATVYEALKE----ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKG
2cckA           -------------------------------------------FITFEGPEGSGKTTVINEVYHRLVKDY
1aroP           ----------------------------------------------------------------------
3c95A           ---NTSWVAPLAWHPENRNAVIMVDLA--GDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDA
3dt2A           ----------FALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKV
3eiuB           QLLDINGAAMNPYARLPPKDFI----QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG
2dr3A           -------------------RRVKTGIPG--VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG
2b8tA           -----------------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYAD
3eiuA           ------------YARLPPKDFI----QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG
4dcgA           ------------ESANEVAKKLPYQGQLKLLLGELFFQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLG
1e69A           ------------------------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKF
1e9fA           ---------------------------------------RRGALIVLEGVDGAGKSTQSRKLVEALCAAG
2c61B           ---------MNPYARLPPKDFI----QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG
2bbsA           ----------TEVVMENVTAFWEEGFGKAKVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
2awnD           -----------SVQLQNVTKAW--GEVV--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2a2zD           ----------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWE
2dr3E           -------------------RRVKTGIPG--VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG
2b8wA           ----------PMCLIENTNGRL---MANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS
2cgtH           -------KGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLA
1e9dA           ---------------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAG
2c04A           --------TPAEVILATVYEALKE----ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKG
3czpB           RGLLDSLDLGQYLDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQ
1e98A           ---------------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAG
1e2dA           ---------------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAG
2czvA           ------------------------------GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKL
3b2qB           ------------------------------STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG
2c9yA           -----------------------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCH
2a30D           ----------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWE
3dt4A           ----------FALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKV
2bc9A           ----------PMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS
2awnB           -----------SVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
3b2qA           -------AAMNPYARLPPKDFI----QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG
1e4yA           -------------------------------------------RIILLGALVAGKGTQAQFIMEKYGIPQ
2a30B           ----------------------------------------RIKKISIEGNIAAGKSTFVNILKWEVVPEP
2a2zA           ----------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWE
3cmvE           ----------SIMRLGEDRSMDVETGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2b92B           ----------PMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS
1e9sF           ----------SGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
3b85A           ------------------------------GQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQ
1bg0A           --------------FDSIKNKKTGMGATLL-DVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYH
3cmxA           -----------------------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2awnC           ------------------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMV
1cr4A           ----------HLSSEESVGLLF--SGCT--GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
2d62A           ----------AEVKLINIWKRFGDV----TAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRG
2a5gA           ----------------------------------------KEMRILMLGLDAAGKTTILYKLKLGQSVTT
2ahvA           ---------------KPPRINGRVPVLS---AQEAVNYIPDEATLCVLGAILEATTLITALADKYKSPTG
2axzC           ----------------------------------------------------------------------
1e9sG           ---------VSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
3dt4C           ----------FALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKV
2dr3B           ------------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG
3d3kA           ------------------------------LSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVLC
1e9sD           ---------VSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
3a1wA           --------------------------------------------VALAGCPNVGKTSLFNALTGTKQYVA
3c8uA           --------------------TLAALCQG--VLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQG
3d7wA           QQTTGEEYFSFITLLRYVSSGSFSNNIP--LLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVV
2cjwB           --------------------------------------------VVLIGEQGVGKSTLANIFAGVEDTYE
3dhwC           ------------IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTE
2a1fF           ----------------------------------------------------------------------
1e2fA           ---------------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAG
3bgwA           --------------------TGVPSGFT--ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDND
3bh0A           -EALVTVYEEIESADGNITGVP--SGFT--ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDND
1dhjA           ----------------------------------------------------------------------
3czpA           ------------------------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQ
3dt7A           ----------FALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKV
1e0jA           VSALSLRERIREHLSSSVGLLF--SGCT--GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
2c9oC           -GLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKV
1e9rA           ----------SGGKLKRMTREKAKQ----VTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRG
2ahwD           ---------------KPPRINGRVPVLS---AQEAVNYIPDEATLCVLGAILEATTLITALADKYKSPTG
1dg3A           ----------PMCLIENTNGRL---MANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKG
2c61A           --------AMNPYARLPPKDFI----QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG
1e9sJ           ---------VSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2d4hA           ----------PMCLIENTNGRLM-ANPE--ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS
2a30A           ----------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWE
2bkhA           ---------IKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESY
2a2zB           ----------------------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWE
2axpA           -------------------------------------------LIILEGPDCCFKSTVAAKLSKELKYPI
1cr1A           ------------------------------GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
3cr7C           ---------------------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDR
421pA           --------------------------------------------LVVVGARGVGKSALTIQLIQNHFVDE
1dekB           -------------------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVK
2eg5G           ----------SAYNQLVLAKVKPVEQCVRELLRANLPNINKCIKVADLGCAS-GPNTLLTVRDIVQSIER
2b8wB           ----------PMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS
2dr3C           ------------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG
2ctsA           --------------------ASSTNLKD--ILADLIPKARIKTFRQQHGNTAVGQITVDMMYGGMRGMKG
3be4A           --------------------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAH
2cckB           -------------------------------------------FITFEGPEGSGKTTVINEVYHRLVKDY
3dtbB           -------------RIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKV
3bgwD           ------------------------------ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDND
3bpbA           ------------IIARTPARSLV-DGLTSSHLGKPDYAKALEQHNAYIRALQTDITLLPRFPDSVFVEDP
2akaA           -------EMVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVA
3bb1B           ------------SGINTFAPATQTKLLE--LLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
2a5jA           --------------------------------------------YIIIGDTGVGKSCLLLQFTDKRFQPI
2bkiA           ---------IKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESY
2awoC           --------------------SVQLQNVT--VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
3dlbB           -------------------------------------WVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
1e0jB           VSALSLRERIHLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
2ausC           ----------------------------------------------------------------------
3d31A           ------------IEIESLSRKWKNF-----SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDS
3cmtD           -----------------------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2d0kA           ----------------------------------------------------------------------
2dflA           ------------KKERMNVKKISTGSQA--LDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPP
2b8tB           -----------------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYAD
3cddF           CTVDIGGERVITGYVDDWVPSYDESTITISV-SGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFG
1dkiA           KENKKLPVVKSLLDSKGIHYNQG-NPYNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNK
2bhjA           -----------------------------------------------------------------KNWGS
2d4hB           ----------PMCLIENTNGRLMANPEALKILSAITQPMV---VVAIVGLYRTGKSYLMNWMWCVPHPKK
3bb1F           ------------SGINTFAPATQ--TKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
1dhiA           ----------------------------------------------------------------------
3cddD           --------------------------------KIYQGWTK-IGITRSLEASGAFDLETYKF----NDAQY
1e6cA           -------------------------------------------PIFMVGARGCGMTTVGRELARALGYEF
2bbsB           -------------TTEVVMENV---TAFW-VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1e9rE           ----------SGGKLKRMTREKAKQ----VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRG
3d3qB           ----------------------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEI
1e3aB           ------------------------------AKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVP
3cmvB           ------------DRSMDVETIST--GSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE-
1cfrA           ---------------------------------------------DIISKSGEGNKYTINSASGLRDFIN
1bmfC           -------KAPGIIPRISVREPM----QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFN
1cr0A           ------------SSEESVGLLF--SGCT--GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
1ai4B           -------------------------------------NWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVP
3bk7A           -------------------------------LEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTE
2d2eA           ------------LEIRDLWASI--DGET--ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTV
2bdtA           -------------------------------------------LYIITGPAGVGKSTTCKRLAAQLDNSA
2bx2L           ----------------------------------------------------------------------
3adkA           -------------------------------------KLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTH
3dm9B           ------------AVKEAVSEILETSRR---IDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHG
1e3mA           ---------------------------------------------------LVNLAERAYTLNYTCPTFI
1e3mB           ---------------------------------------------------------LVNLAERAYTLNY
1cr2A           ------------SSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
3czjA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
2c7cH           -----------------------KDGVS--VAREIELDKFENMGAQMVKEVASKANDAAGDGTTTATVLA
1e2gA           ---------------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAG
3bb1E           ------------SGINTFAPATQ--TKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
2dr3D           -------------------RRVKTGIPG--VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG
1e9rD           ----------SGGKLKRMTREKAKQ----VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELA-YTGLLR
3d3qA           ----------------------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEI
2dr3F           ------------------------------VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG
3bb1A           --ASQQQTVRGWSGINTFAPATQTKLL--ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
3cr7A           ----------------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDR
3dfnC           ----------------------------------------------------------------------
2awoA           -----------SVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
3clvA           -------------------------------------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHEN
3dfqA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1b0uA           ------------LHVIDLHKRYGGH----EVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSE
2bjbA           --------------LQTLGLRVDGVGSEL-TVSGRIEPGPGARVD--CGLAG----TVLRFVPPLAALGS
3bb1H           ------------SGINTFAPATQTKLL--ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
1eilA           ----------------------------------------------------------------------
2ck3C           -------KAPGIIPRISVREPM----QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFN
3cddC           --------------------------------------------LKAGGKIYQGWTKIGITRSLEAYKFQ
3ecpA           ----------------------------------------------------------------LHRAAD
3bo6B           ------------HSLHNQMRQMPMS----HFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHR
2b8tC           -----------------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYAD
3da4A           ----ISTNIGYFCNADRNLVLHPGISVYDAYHFAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNG
3dfpC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2c4rL           -ERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQW
3cr7D           ---------------------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDR
3dauA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2c0bL           DKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIELKEAL---ASLELPLIVRTAGVGKSAEALQ
1e9sB           -----------GGKLKRMTREKAKQV----TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2bbtB           ----------FGELFEKAKQNN--NNTP--VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1aldA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1e2kA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYV
1ak2A           -----------------------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCH
3brwA           ------------LECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTY
2aumA           ----------------------------------------------------------------------
3cm0A           -----------------------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKK
3dymA           ----------------------------------------------------------------------
3bczC           -------------------------------------HAGSWYTASGPQLNAQLEGWLSQVQSTKRPARA
2d4uA           ----------------------------------------------PLGSGGLFFNALKNCKENFTVLQT
3dfnD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1dekA           -------------------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVK
3a00A           -------------------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSF
3dftD           ----------------------------------------------------------------------
1akeA           -------------------------------------------RIILLGAPGAGKGTQAQFIMEKYGIPQ
1e59A           --------------------------------------VRHGESQWNKENRFTGWYDVDLSEKGVSEAKA
2d3wC           ------------LSIKDLHVSVEDK----AILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEV
1adoA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3bb1C           ------------SGINTFAPATQ--TKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
3cmwC           ----------------------------SLSLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
3dfoC           ----------------------------------------------------------------------
3cbnA           ---------------------------------------------------------------------R
3dffA           ----------------------------------------------------------------------
1ek0A           --------------------------------------------LVLLGEAAVGKSSIVLRFVSNDFAEN
3dfqD           ----------------------------------------------------------------------
2bv7A           ----------KQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISAVYDTNPTKFRTLQNILEVEKEMYG
3dftC           ----------------------------------------------------------------------
1d6jA           -----------------------HASAL-TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDR
1draA           ----------------------------------------------------------------------
3crmA           -----------------------------------------PPAIFLMGPTAAGKTDLAMALADALPCEL
3dm5B           ----------KKEHIIKIVYEELTKFLG--TEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRG
3ch4B           ---------------------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADV
4atjA           ----------------------------------------------------------------------
1e4vA           -------------------------------------------RIILLGAPVAGKGTQAQFIMEKYGIPQ
1e9rF           -----------GGKLKRMTREKAKQV----TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2bwjA           ----------------------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTH
2ccjA           -------------------------------------------FITFEGPEGSGKTTVINEVYHRLVKDY
3bb1G           --ASQQQTVRGWSGINTFAPATQTKLLE--LLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
2bhvA           ----------------------------------------------------------------------
1c9kC           -------------------------------------------MILVTGGARSGKSRHAEALIGDAPQVL
2bofX           -------------------------------------------------------------------PNM
1dyhA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dvlD           ------------------------------------GGLPIGRSTLVSGTSGTGKTLFSILYNGIIEFDE
3c7kC           --------------------------------------------LLLLGAGESGKSTIVKQMKIIHEDGF
1e9sI           -----------GGKLKRMTREKAKQV----TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
1ckvA           ------------AYDAGIMGLKGKDFADQ-FFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKN
2e85B           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2czvB           -------------------------------------------VVVSIKFNEEVDKEKLREARKEYGKVA
1cs4C           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEK
3bv4A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------LQNLPI
2d3wA           ------------LSIKDLHVSVEDK----AILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEV
1culC           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEK
1av6A           ------------PESANEVAKKLYQGQLKLLLGELFFQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLG
2awnA           -----------SVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
1e9sL           ---------VSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2ancD           ----------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD
2d2fA           ------------LEIRDLWASIDGE----TILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTV
2cvfA           -----------------------------SLDSLLGGGFAPGVLTQVYGPYASGKTT--LALQTGLLSGK
3d1mB           ----------------------------------------------------------------------
1d6jB           ------------------------------RSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDR
1e9sM           ---------VSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
1eamA           --------------------------------------RHGILDGATVVYIGSAPGTHIRYLRDHFYNLG
1accA           ------------------------------IIFNGKDLNLVERRIAAVNPSTTKPDMTLKEAKIAFNEPN
2anbA           ----------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD
3b55A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3cnlA           ----------------------------PRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGI
1e9sH           ---------VSGGKLKRMTREKAKQV----TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
3ec1A           ------------------------------------------------------------RIIEEATGKG
3cioD           --------------------------------HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
2c5mD           ----------------------------------------------------------------------
3cueF           -------------------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTI
1e2hB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDD
3c15C           --------------------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGE
2ancB           ----------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD
1dvrA           ----------------------------------------ESIRMVLIGPPGAGKGTQAPNLQERFHAAH
2bkeA           --------ALEVKKERNVKKISTG----SQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPP
2b0lC           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3a00B           -------------------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSF
3cr7B           ----------------------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDR
1cjtC           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEK
3cmuA           ----------------------------SLSLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG
2an9A           ----------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD
1e9sE           ---------VSGGKLKRMTREKAKQ----VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2d3wD           ------------LSIKDLHVSVEDK----AILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEV
2dftA           -------------------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGL
3b9qA           ----------EIKDALKESVLEMLA----KSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEG
3di4A           ----------------SARKTGEVLVP---PREGRCFEVKAGQFFRISSVEGPQ-----VGDLNLHNLHD
1e2jA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVP
3bwdD           ----------------------------------------RFIKCVTVGDGAVGKTCLLISYTSNTFPFS
3e70C           RIGGKIIEEAVKEAVSEILETSRRI-----DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHG
1e2mB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTLLVALGSRPMT
3cqcA           ----------ALKQGNAIMRKFLASKKHE-AAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAH
3bm2B           ----------------------------------------------------------------------
1cjaA           ------------------------------------------------------TTSAPEVLTKSTMQQL
1e2iB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDD
3e8aC           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGE
1e2kB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLIVYVPEPMT
2aumB           ----------------------------------------------------------------------
2bbtA           ----------WEEGFGELFEKAKGT----PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
1ckeA           -----------------------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDS
3dfdA           ----EKVYDLSTIDAEEVEVPISKRFVDKEGNVPFIFKAITTDRIDELEKENTTKEL-------DSQRFY
2dpyA           -------PPFNPLQRTPIEHVL----DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADV
1e1qB           -------KAPGIIPRISVREPM----QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFN
1e9rG           ---------VSGGKLKRMTREKAKQV----TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
3ed8A           ------------IELKGTDFKEDGN-----ILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVED
3b85B           ----------------------------TLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQ
1afrA           ------------------------------VHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQ
2dpyB           -------PPFNPLQRTPIEHVL----DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADV
2aexA           ----------------------------------------------------------------------
2dftC           -------------------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGL
3c14C           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGE
2c9oA           -GLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKV
3c7kA           --------------------------------------------LLLLGAGESGKSTIVKQMKIIFSGED
3bjqB           ----------------------------------------------------------------------
1cjuC           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGE
1e2lB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQL--LVALGSR
2b8tD           -----------------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYAD
1azsC           --------------------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGE
2cbzA           -----------SITVRNATFTWA--RSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVE
3dkvA           -------------------------------------------NIVLMGLPGAGKGTQAER--IVEKYGI
2d7vB           ---------AFVAALSSCHLVF--LSIA--AKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFS
1e2iA           --------------------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWR
1e2lA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEP
1e9sA           ------------GKLKRMTREKAKQV----TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2d7vA           ---------AFVAALSSCHLVF--LSIA--AKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFS
1d8jA           ----------------------------------------------------------------------
1e2nA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDD
1e2hA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVP
2bhvC           ----------------------------------------------------------------------
3cnnA           ----------------------------PRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQ
3bs4A           ------------------------------------KIKKHSLILIHEEDASSRGKDILFYILSRKLKSD
1chdA           ----------------------------------------------------------------------
2a5vB           ---------------------------------EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPG
3dmdA           ----------------------------------------------------------------------
1e2mA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLL-RDDIVYV
3bb1D           ------------SGINTFAPATQTKLL--ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSI
2ancF           ----------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD
3ci2A           ----------------------------------------------------------------------
1d6aA           ---------AGVKSRSQVQLGIQILDSNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKY-IENQVKT
1e9rB           ------------VSGGKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
3do6A           ----------DILYPYGHYIAKID----HRFLKSLENHEDGKLTAVTPTPAGEGKTTTSIGLSSLNRIGK
3cphA           --------------------------------------------ILLIGDSGVGKSCLLVRFVEDKFNPS
2c9gA           ----------RVMVSRSLTKDKQVE----LKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGV
1dw9A           ---------IQSQINRNIRLDLADAILLSKAKKDLS-------FAEIADGTGLAEAFVTAALLGQQALPA
1dwmA           ----------------------------------------------------------------------
1e2nB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDD
3c85A           -------------------------------------------------------------------PGH
1cjvC           -----------------------------------------THRLLLLGAGESGKSTIVKQMRILHVEKA
2awoD           -----------SVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITS
2a5vA           -----------MFVVRTAGHVI--DSAVLGSI-EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPG
1d2zD           ----------NFPAEIKKGFKYTAQD--VFQIDEAANRLPPMIDEWKTSGKLNERPTVGVLLQLLVLFSA
2a78A           --------------------------------------------VIMVGSGGVGKSALTLQFMYDEFVED
2cdnA           -----------------------------------------HMRVLLLGPPGAGKGTQAVKLAEKLGIPQ
3cbqA           --------------------------------------------VMLVGESGVGKSTLAGTFGGLQGDSA
1bccF           ----------------------------------------------------------------------
2ax4B           ---------------------------------------FRGCTVWLTGLSGAGKTTIFALEEYLVSHAI
2c5mB           ----------------------------------------------------------------------
2bboA           ----------TEVVMENVTAFWEEGLGTP-VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE-----
1e2jB           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQL--LVALGSR
1e9sK           ---------------GKLKRMTREKAKQVT-VAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRG
2c95B           -------------------------------------KLKKTNIIFVVGGPGSGKGTQCEKYTHLSTGDL
2c1lA           -----------------------------RFYETFTEHINQGGRVIAILGGSTSQRLSSRQVVEELLNRG
3cr8B           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2bwjB           -------------------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTH
2c9oB           -------SGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAI--------
1dapA           ----RIENDIRTMPDYFVGYEVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDRNPDT
3cddA           -----------------------KIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAF--IEPIKQG
2bwjD           -------------------------------------DLRKCKIIFIIGGPGSGKGTQCEK---------
1agpA           --------------------------------------------LVVVGADGVGKSALTIQLIQNHFVDE
3cddE           -------------------------GHSEEIVLKAGG-KIYQGWTKIGITRSLEASGAFDTYKFLGNDAQ
1delA           -------------------------------------------LIFLSGVKRSGKDTT---ADFIMSNYS
1e6vC           ----------------------------------------------------------------------
2ax4A           ---------------------------------------FRGCTVWLTGLSGAGKTTIFALEEYLVSHAI
2dx7A           ----------------------------------------------------------------------
1e6yA           ------------------------------ALEDHFGGSQRATVLAATGNANAGLSGWYLS--MYLHKEA
1akyA           ----------------------------------------ESIRMVLIGPPGAGKGTQAPN---------
3dvlC           ------------------------------------GGLPIGRSTLVSGTSGTGKTLFSILYNGIIEFDE
3cddB           ---------------------------VLKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKA
2ausA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQLYSPEKLASLAGLPPELLDR
3dmdC           FSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAK-------------ARGIDV
3b5jA           GQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNILANPGMSVEKVIYAAKLAELREGYNTIVGE
3cmvG           KTCAFIDAEHALDPIYARKLGVD-IDNLLCSQPDTGEQALEICDALARSDVIVVDSVAALTPKA-EIEGL
2d3wB           TGGTVEFKGKDLLALSPAGEGIFMAFQYPVEIPGVNQFFLQTALNAVRSYRLMEEKIALLKMPEDLLTRS
3dmdB           FSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAK-------------ARGIDV
3cmvC           KTCAFIDAEHALDPIYA-RKLGVDIDNLLCSQPDTGEQALEICDALARSDVIVVDSVAALTPKA-EIEGL
3cmvH           KTCAFIDAEHALDPIYARKL-GVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKASHM
2dwoA           VPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAK------------EGGQI
3b60A           GHILMDGHDLREYTLASLRNQVADTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLD-TIIGE
2c03B           RRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARL-------------EARDL
2akaB           GSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKVLNLTLVDLPGMTKVP
1bifA           VPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSE------------EGGHV
2dwpA           VPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDV------------KSYLAKEGGQI
2ccgA           DVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRY----IDS
1d1cA           GRNQAGVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASEKSRVVFQSETERNYH
3cmvA           KTCAFIDAEHALDPIYARKLGVDI-DNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALT-PKAEI
2bifA           VPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVR-----------KFLSE-EGGHV
1e9cA           HRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANREQVPLIKEKLSQGVTLVVDRYAFSGVAY
2ccgB           DVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPA---LKEGKVVLCD-RYIDS
3dm5A           YKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKS-------------KGVDI
2ccjB           DVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASR----REHLVLKVIPALKEGKVVLCDRYIDS
2c03A           RRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARL-------------EARDL
2cckA           DVIMTREPGGVPTGEEIRKIVLEDMDI----------RTEAMLFAASRREHLVLKVIPALKEGKVVLCDR
1aroP           ----------------------------------NDFSDIELAAIPFNTLADHYGERLAREALEHESYEM
3c95A           DRLGINRQHCLDNLKILRREKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALFNYRARN
3dt2A           ECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPQKNTIFTNVAETSDGGVYWEGIDEPLAPGV
3eiuB           SESAFAVVFAAMGITNEEAQYFMSDFEKTGALERVFLNLADDPAVERIVTPRMALTAAEYLYTDLATLYE
2dr3A           EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKY-----------------I
2b8tA           VKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSVQFFDDRICEVANILAENGFVVIIDKN
3eiuA           SESAFAVVFAAMGITNEEAQYFSDFEKTGALERAVVFLNLVILTDITNYAEALRQMGPGYMYTDLATLYE
4dcgA           VIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSNVMISILNPVASSLKWRCPFPAQWI
1e69A           DMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDEGRLEISIRKPGRRDQ
1e9fA           HRAELLRFPERSTEIG--KLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRSGVAF
2c61B           SESAFAVVFAAMGITNEEAQYFMSDFEKTGALERVFLNLADDPAVERIVTPRMALTYPGYMYTDLATLYE
2bbsA           GKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKD-----------NI
2awnD           GDLFIGEKRMNDTPPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDTLAD
2a2zD           VVPEPVARWCNVQSTNVLERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESNET
2dr3E           EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKY-----------------I
2b8wA           LGSTVQSHTKGIWMWCVKKPGHILVLLDTEGGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINRIRSK
2cgtH           QAIITEGLKAVAAGMNPMDSKAIAQVGTISANSDTVGKLIAEAMDKVGKEGVITVEDGTGLDVV-EGMQF
1e9dA           HRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPIKEKLSQGVTLVVDRYAFSGVAY
2c04A           RRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKA-------------RLEARDL
3czpB           YHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADFEEQLSEYGIIVVK
1e98A           HRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANREQVPLIKEKLSQGVTLVVDRYAFSGVAF
1e2dA           HRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVYAFSGVAFT
2czvA           REARKEYGKVAILLSNPKPSLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKNVALGFSLR
3b2qB           SESAFAVVFAAMGITNEEAYFMSDFEKTGALERAVVFLNLADDPAVERALRQMGRGYPGYMYTDLATLYE
2c9yA           LATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPDGFPRTVRQAEMLDDLMEKRKEK
2a30D           VVPEPVARWCNVQSTNVLQERWSFTFQTYACSRIRAQLASLNGKPFERSVYSDRYIFASNLYESECMNET
3dt4A           ECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQNVAETSDGGVYWEGIDEPLAPGV
2bc9A           LGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVL----------LSSTF
2awnB           GDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDR
3b2qA           SESAFAVVFAAMGITNEEAYFMSDFEKTGALERAVVFLNLAVERIVTPRMALTAAEYLAYEHGMHVLVIL
1e4yA           ISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVI-----------------ALVKERIAQEDCRNGF
2a30B           VARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFEYIFASNLYESECMNET
2a2zA           VVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFERSVYSDRYIFAS
3cmvE           KTCAFIDAEHALDPIYA-RKLGVDIDNLLCSQPDTGEQALEICDALARSDVIVVDSVAALTPKA-EIEGL
2b92B           LGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSITHRIR
1e9sF           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-----------------YALSV
3b85A           VSRIILTRPAVEAGEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAQNTTPA
1bg0A           GGFKLTDKHPPKQW---GDINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCKVSSTLSSMEDELKGTYY
3cmxA           KTCAFIDAEHALDPIY--ARKLGVDIDNLLCSQPTGEQALEICDALARSGLTPKAEARMMSQAMRKLALI
2awnC           FQ------------------------SYALYPHLSVAENMSFGLKLAGKKEVINQRVNQVAEVLAHLLDR
1cr4A           GKK-VGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQ-------WFDELFGNDTFHLYD
2d62A           QIYIEDNLVADKGVFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPQEIDKRVREVAELGTELLNR
2a5gA           IPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARMRDAIILIFAN
2ahvA           LGDRADRGISPLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISVDP
2axzC           ---------------------------------------------------------------VSNLLNV
1e9sG           DRMVIVDPNGDMLSKFGRDK--DIILNPDQRTKGWSFFNEIRNDYDWQR----------------YALSV
3dt4C           ECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIGV
2dr3B           EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEK--------------------YI
3d3kA           GPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKQQVSSLKDLPTSPVDLVINCLDCP
1e9sD           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR--------------
3a1wA           NWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVLLLEILEME
3c8uA           LPAEVVPDGFHLDNRLLEPR--------GLLPRKGAPETFDFEGFQRLCHALKHQERVIYP-----LFDR
3d7wA           AYEAGNQSYFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERY-----------AGHRDQIPLGIDQLIQ
2cjwB           RTLMVDGESATIILLDMWENHDHMQVGDAYLIVYSITDRASFEKASELRRARQTEDIPIILVGNKSDLVR
3dhwC           GSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVLSLVGLGDKHDS
2a1fF           ----------------------------------------------------------------------
1e2fA           HRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAF
3bgwA           DVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNS-------NINIFDK
3bh0A           DVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDK-AGQSVN
1dhjA           -----------------------------------------------------------------FKRNT
3czpA           YHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRAPADWLRAYGEINDFEEQLSEYGIIVVK
3dt7A           ECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNIQKNTIFTNVAETSDGGVYWEGIDEPLAPGV
1e0jA           GKKVGLAMLEESVE-ETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAET
2c9oC           PFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRKETKKKEIIQDVTLHDLDVAGEIYIDQGIAELVPGVLF
1e9rA           DRMVIVDPNG--DMLSKFGRDKDIILNPDQRTKGWSFFNEIRDWQRYALSVVPRGKTDEAEEWASYGRLL
2ahwD           LGDRADRGISPLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISVDP
1dg3A           IWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQALTHRIRSKS
2c61A           SESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLPAVERIVTPRMALTAAEYLAYEHGMHVLVIL
1e9sJ           DRMVIVDPNGDMLSKFGRDKD-------------IILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRG
2d4hA           LGSTVQKGIWMWCVPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNDQLYYVTELTHRI
2a30A           VVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDR
2bkhA           GTGQDIDDRIVEANPLLEAFGNA---KTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICYHI
2a2zB           VVPEPVARWCNVQSTNVLERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASSECMNET
2axpA           IKGSSFELAKSGNEKLFEHFNDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKKKRLRVR
1cr1A           GKKVGLAMLEESV--------EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYD
3cr7C           RVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRILFADSNSIAITSFISPYRKDRDLHEVTGLPFDPKGL
421pA           YDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTNTKSFEDIHQYREQIKRVKDSDDVPMV
1dekB           YQL-----------AGPIKDALAYAWGVFAANDYPLTRKEFEGIDYDRETNLNLTKL-----EVITIMEQ
2eg5G           PTIQIFLNDLFPNDFNSVFLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSLVTEIGT
2b8wB           LGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVSIGTINQQA
2dr3C           EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYIVH----------------
2ctsA           LVYETSVLDPIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWSHVVTMLDN
3be4A           LSTGDMLREAIKNGIGLEAKSIIESGNFVGIVLGLVKEKFDLGVCEGLAKILSEIGDSLTSVIYFEIDDS
2cckB           DVIMTREPGGVPTGEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSGVEEV
3dtbB           ECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGIDEPLAPGV
3bgwD           DVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNS-NINIFDKAGQSVN
3bpbA           VLCTSRCAIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGTVEAGDIMMVGDHFYI-GE-SARTNA
2akaA           GRNQANGSGVLEQQILQANPILEAFGNAKTTNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVYHI
3bb1B           SPFQSGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDAIT
2a5jA           GVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSIML
2bkiA           GTGQDIDDRIVEANPLLEAFGNAKTVRNNNS---SRFGKFVEIHFNEKSSVVGGFVSICVQGKEERNYHI
2awoC           GDLFIGEKRMNDTPPAERGV-----GMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL
3dlbB           GAFLLEVDPAYRILCEMSLEAW-LAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLS----LLD
1e0jB           GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA-ET
2ausC           ----------------------------ADIKREVIVKDDKAETNPKWGFPPDKRPIELHIQYGVINLDK
3d31A           GRILLDGKDVTDLSPEK-HDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDR
3cmtD           KTCAFIDAEH--ALDPIYARKLGVDIDNLLCSQPTGEQALEICDALARSGALAARMMSQAMRKLAGTLLI
2d0kA           -----------------------------------------------------------------FKRNT
2dflA           EKGGLSGKAVYID------------TEGTFRWERIENMAKALGLDIDNVMNNIYYIRAINTDHQIAIVDD
2b8tB           VKYLVFKPKILPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVISGLDKN
3cddF           IKVIVNTDVGEPFQRIQHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAASWRQRFS
1dkiA           GLKDYTYTLSSNNPYFNHPKNLFAAISTRQYNWNNILPTYSGRES-NVQKMAISELMADVGISVDMDYGP
2bhjA           GEILHDTLHHKATSCLGSIKSLTRGPRDKPTPLELLPHAIEFINQYYGSFKEAKEAVTKEIETTGTY-QL
2d4hB           PGHILVLLDTEGLGQNDSWIFALAVLLSSTFVYNQAMDQLYYVTELTKSSDSADFVSFFPDFVWTLRDFS
3bb1F           SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKRLDAYRVDNLDKLVAKAIT
1dhiA           ----------------------------------ALAVDRVIGMENAM------PWNLPASLAW-FKRNT
3cddD           KAFIEPIKQGQACTV-DIGGERVITGYVDDWVSYDESTITISVSGRDKTADLVDDIVCKPFGIKVIVNTD
1e6cA           VDTDIFMQHTSGMTVADVVAAEGRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVRLQASLQ
2bbsB           GKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA---------EKDNIVL
1e9rE           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV----------------
3d3qB           ISGDSQVYQGDIGTAKVTTEEEGIPHYIDILPPDAKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYAF
1e3aB           GTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSA
3cmvB           GKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIG
1cfrA           DEAIRLGGKISDNKCNGDWYEWLIGIRAFFLESETNFIKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLN
1bmfC           DGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLA--------------
1cr0A           GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL--------YD
1ai4B           ---GTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGASRQDLNLRLFLPTLQA
3bk7A           GKVEWDLTVAYKPQYIKAEYEG------------TVYELLSKIDSSKLNSNFYKTELLKPLGII-DLYDR
2d2eA           ERGEILLDGENISPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDY
2bdtA           YIEGDIINHVVGLLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFWTNREE
2bx2L           --------------------------------------------------------------------KL
3adkA           LSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLREVKQGEEFERKIGQ
3dm9B           FSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAI--------QHAKARGIDVVLIDT
1e3mA           DKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKGPI
1e3mB           TCPTFID--KPGIRITEGRHPVVEQVLNEPFINLSPQRRLIITGPNGGKSTYRQTALIALAQKVEIGPID
1cr2A           GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREI---------IENGKFDQWFDELFGNDTFHLY
3czjA           --------------------------------------------------------------------LD
2e85A           ---------------------------------ASAVTDVLLCVGNS---MMGDDGAGPLLAECAAAPKG
2c7cH           QAIITEGLKAVAAGMNPMDLKRGIAVTAAVESDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEG
1e2gA           HRAELLRFPERSTEIG--KLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDFSGVAF
3bb1E           SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVAIT
2dr3D           EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIV--------------
1e9rD           GDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL----------------SV
3d3qA           ISGDSQVYQGDIGTAKVTTEEEGIPHYIDILPPDFKKRAEKYIKDITRRGKVPIIAGGTGLYI-QSLLYN
2dr3F           EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEK---------------YI
3bb1A           SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLDRLDAYRVDNLDT
3cr7A           RVHAYRLDGDNIRFGLNKDLGFSEADRNENLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFDPKGL
3dfnC           --------------------------------------------------------------------HS
2awoA           GDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVALQLAHLLDR
3clvA           TNTTIGASFCTNENLCNIKFDIWDTAGQRYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISI
3dfqA           ---------------------------------------------------------------------S
2a1fD           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1b0uA           GAIIVNGQNINLVRDKDRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDAKYLAKVGIDERAQGK
2bjbA           VPVTFDGDQARGRPIAPLRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAA------
3bb1H           SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKT--------IDVLLYVDRL
1eilA           ------------------------------------------------------FAVKDVPAWD-HFLTK
2ck3C           DGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPL------------------
3cddC           YKAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGYPSGQFNNQTLTQIAGIKVIVNTD
3ecpA           WAKSVFSSAA--LGDPRRTARLVNVAAQLAKYSGKSITISSEGSK---------AAQEGAYRFIRNPNVS
3bo6B           ENPQCKGDFAGDKFHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTQQSRVAVGAQFTLYVKPDQENSQ
2b8tC           VKYLVFKPKIDSRTGTSLPSVEVAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGLDKN
3da4A           AERSVNIANIGLKISPMKINQIKDIPVSTKFTHATGDYNVITGAYLGNITLKTEGNASTHRGIIGESLTR
3dfpC           --------------------------------------------------------------------HS
2drcA           ----------------------------------ALAVDRVIGMENAM------PFNLPADLAW-FKRNT
2c4rL           DLSFRLKHWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHGRPDSKIKL
3cr7D           RVHAYRLDGDNIRFGLNKDLNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVEVYVDVVAEQRDPKGL
3dauA           ----------------------------------ALAVDRVIGMENA-----MPWNLPADLAW--FKRNT
3dfnA           ---------------------------------------------------------------------S
2c0bL           WDLSFRLKHWEAIKKAAESRPAPFLIHQESNVIVAFRDYLRQDIGEIPKVLELARQHIAALGRPDSKIKL
1e9sB           DRMVIVDPNGDMLSKFGRDK-DIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEWASYGRLL
2bbtB           GKIKHSGRISFCSQNSWIMPGTIKENI----------IGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV
1aldA           --------------------------------------------------------------------YQ
3d1mA           ------------------------------------------------------AYKQFIPNVA-EKTLG
1e2kA           PEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPY-------------AVTDAV
1ak2A           LATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCFPRTVRQAEMLDDLMEKRKEK
3brwA           HDVIPISCLTEFPNVVQMAKLVCEDVNV---------------DRFYPVLYPKASRLIVTFDEHVISNNF
2aumA           --------------------------DQTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYRHVEA
3cm0A           LSTGDILRDHVARGTPLGERVRPIMERGDLVPDDLILELIELAERVIFDGFPRTLAQAEALD---RLLSE
3dymA           -----------------------------------------------------------------FTRAP
3bczC           IIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYERSL
2d4uA           IRQQQSTLNGLQTRNTLNRAGIRYMMDQNTVAELMESASISLKQAEKNWADYEALPRDPRQSTAAAEIKR
3dfnD           --------------------------------------------------------------------HS
3dfoD           ---------------------------------------------------------------------S
3dfpD           ---------------------------------------------------------------------S
1dekA           YQLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETQAFCYLNGKSPIKGVFVFDDEGKESVNFVA
3a00A           GFSVSSTTRTPRAGEVNGKDY---NFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTV-----ASVKQVSKS
3dftD           ---------------------------------------------------------------------S
1akeA           ISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTDAMKEAGIN
1e59A           AGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRAVT
2d3wC           TGGTVEFKGKDLLALSPIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED-LLTRS
1adoA           ---------------------------------------------------------------------S
4dfrA           ----------------------------------ALAVDRVIGMENA-----MPWNLPADLAW--FKRNT
3bb1C           SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDAYRVDNLDKLVAKAIT
3cmwC           KTCAFIDAEHALD--PIYARKLGVDIDNLLCSPDTGEQALEICDALARSDVIVVDSVAALTPKAEIEGEI
3dfoC           ---------------------------------------------------------------------S
3cbnA           YTLRARGHPNVT----AGHRTTFEVTVD-PEI--GETADCIIGVSSSDSISTLPRVILRTENGYDEIRGY
3dffA           ------------------------------------------------------IAALDHLRVAHRHGRF
1ek0A           KEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPVTKPQSFIKARHWVKELHEQASKDIIIALVG
3dfqD           ---------------------------------------------------------------------S
2bv7A           AEWPKVGATLALMWLKRGLRFIQVFLQ--SICDGERDENHPNLIRVNATKAY-----------------E
3dftC           ---------------------------------------------------------------------S
1d6jA           RVHAYRLDGDNIRFGLNKDL-----GFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQ
1draA           ----------------------------------ALAVDRVIGMENAMPWNLPAELAW-------FKRNT
3crmA           ISVDSALIYRGMDIGTAKPSRELLARYPHDIR--DPAESYSAAEFRADALAAMAKATARGRIPLLVGGTM
3dm5B           YKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKG--------------VD
3ch4B           CAVLRLSGPLKEQYAQEHGLNFQYKEAFRKDMIRGEEKRQADPGFFCRKIVEGISQWFREAYGAVTQTVR
4atjA           ----------------------------------DAFGNANSVIDRMKAAVESACPRTVSCADLLTIAAQ
1e4vA           ISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRLLDGFPRTIPQADAMKEAGI
1e9rF           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR
2bwjA           LSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYQGEEFGRRIGD
2ccjA           DVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVL----CDRYIDS
3bb1G           SPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNT
2bhvA           ---------ITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAV-----------LIPKGSKVIGY
1c9kC           YIATSQI---LHHKDGRPAHWRTARHLDTLITADLAPDDAILLECITTMVTNLL------FALGDPEQWD
2bofX           SSAEWVRNNPNDPRTPVIRDRIASVPQ------GTWFAHHNPGQIGQVDALMSAAQAAGKIPILVVSNAP
1dyhA           ----------------------------------ALAVDRVIGMENA-----MPWNLPADLAW--FKRNT
2a1fE           ----------------------------------------------------------------------
3dyoA           -----------------------------------------------------------------RAPLD
6aldA           ---------------------------------------------------------------------S
3dvlD           PGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLS----------ALIER
3c7kC           SGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVE---------YGDKERKTDSKMVCDVVSRMEDTEPFSA
1e9sI           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ-----------------RYALSV
1ckvA           VNPWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIGRAYTL--GNKFTITSELMGL-DRKLEDY--
2e85B           -----------------------------------------------------------LAEKCAAAPKG
5dfrA           ------------------------------------------------------PWNLPADLAW-FKRNT
2czvB           ILLSNPKPSLVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVKKNVALGFSLR
1cs4C           ATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRV------------------------------
3bv4A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------PIDGRVALIASAIATEVLEALRQLEVHGVDYRHVEA
2boeX           --------------------------------------------------------------------HH
1dp0A           ----------------------------------------------------------------------
1drbA           ------------------------------------------------------PWNLPACLAW-FKRNT
3dfqC           ---------------------------------------------------------------------S
3bjdB           EEARIVADALAVHAT--SRQIDSAASKLAALAEAGLKQQLLYVLSLSDDVTAQTRRWLARAIYR-VEERF
2d3wA           TALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDS
1culC           ATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEG
1av6A           VIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTLSNYALQNVMIS
2awnA           GDLFIGEKRMNDTPPAERGV--------------------------------------------------
1e9sL           DRMVIVDPNGDMLSKFGRDKDIILNPY-DQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYG
2ancD           TQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVGNYYGTSREAIEQVLATGVDVFLDI
2d2fA           ERGEILLDGENILELSPDERARKGLFYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALYLSRY
2cvfA           KVAYVDTEGGFSPERLVQMAETRGLNPEALSRFILFTPSDFKEQRRVFALVVVDSITAHYRAEENRSGLI
3d1mB           -----------------------------------------------------------------EKTLG
1d6jB           RAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAESNSIAITSFISPYRKDRDTARQLHEVATP-GEETGL
1e9sM           DRMVIVDPNGDMLSKFGRDK-DIILNPYDQRTKGWSFFNEDYDWQRYALSVVPRGKTDEAEEWASYGRLL
1eamA           VIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILI-SDVRSPSTADLLSNYALQN
1accA           GNLQYQGKDITEFD---------------FNFDQQTSQNIKN--QLAELNATNIYTVLDKIKLNAKMNIR
2anbA           TQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTREAIEQVLATGVDVFLDI
3b55A           -----------------------------------------------------------------HAKPL
2aunA           ---------------------------------DGRVALIAPASAIATEVLEATLRQLEVHGVDYRHVEA
3cnlA           QWFSLENGVKILDGILYKNIFSEDLAAKLLLVGSLPVERIEDQERAFEIFARSIGIESSFSEFFEDFARK
1e9sH           DRMVIVDPNGDMLSKFG-RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAASYGRLL
3ec1A           NVITTSYFPGTTLDMIEIPLESGATLYDTPGIINHHQMAH--FVDARDLKIITPKREINEGQTLFFGGLA
3cioD           QKVLFIDADLRRGYSHNLFTVSNEHGLLNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMLLEWANDHY
2c5mD           ----------------------------------------------------------------------
3cueF           GVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMYATSTVLKLL
1e2hB           IVYVPGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYATDAVLAPHIGGEAGSPPPALPIA
3c15C           KATKVQDIKNNLKEAIETIV--------------------------------------------------
2ancB           TQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTREAIEQVLATGVDVFLDI
1dvrA           LATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVEKLDQMLKEQGTP
2bkeA           EKGGLSGKAVYIDTEGTFRWE--------------RIENAKALGLDIDNVNNIYYIRAINTDHQIAIVDD
2b0lC           ----------------------------------------------------------------------
2bhvD           ---------ITADKMIPAFLITPISSQIAGKVIAQVESDI----------FAHMGKAVLIPKGSKVIGYY
3a00B           GFSVSSTTRTPRAGEVNGKDYN--FVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVA------SVKQVSKS
3cr7B           RVHAYRLDEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVY--------VDVPVEVAE-
1cjtC           ATKVQDIKNNAIETIVAAMSNLVPPVE-------------------------------------------
3cmuA           KTCAFIDAEH--ALDPIYARKLGVDIDNLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIE
2an9A           TQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVVFLDI
1e9sE           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYG
2d3wD           TGGTVEFKGKDLLALSPEDRAGEGIFMAFEIPGVSNQFFLQTALNETLDRFDFQDLMEEKIALLKMPERS
2dftA           LDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLVRAALAGHTVVYLEISAAEGVRRT
3b9qA           TKVLMAAGDTFRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRL---HT
3di4A           LTERFFSGKTRALHGTHVTTGERLWSNLPYLRPATIIEDTLGRCDPYTGNLLAGGHYHHCCHSNLTRALA
1e2jA           EPMVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPIFDR
3bwdD           ANVVLGLWDTAGEDYNRLRPLSYRGADVFILAFSLISKENVSKKWIPELKHYAPGVPIVLVGTKLDLRDD
3e70C           FSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARG-------------IDV
1e2mB           YWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQAVTDAVLAPHIGGEAGSPPALTLIFDRHPIA
3cqcA           ETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDAL----------------TA
3bm2B           -------------------------ALELLINRRSASRLAELQNILRAGRAPDWHFFVIEGEGRERFSAV
1cjaA           GSLMALDVIVLPIAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELAHPGHESSQFHSIR
1e2iB           IVYVPEPMTYW-RVLGASETIANIYTTQHRLDQGEISAGDAAVVMT---------SAQITMGMPYAVTDA
3e8aC           KATKVQDI--KNNLKEAIETIVAAMSN-------------------------------------------
1e2kB           YWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQI-------------------TMGMPYAVTDA
2aumB           ---------------------------------DGRVALIAPASAIATEVLEATLRQLEVHGVDYRHVEA
2bbtA           GKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA---------EKDNIVL
1ckeA           GAIHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLR
3dfdA           ARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVSVGGEYANWLNKAI----------------------
2dpyA           IVVGLIGERGREVKDFIENILGPDGRARSVVIAAPADVS-------------------------------
1e1qB           DGTDEKKKLYCIYVAIGQKRSTVAQLVRLTDADAMKYTIVVSATDNGKHALIIYDDLSKQAVAYRQMSLL
1e9rG           DRMVIVDPNGDMLSKFGRDK--------------------------------------------------
3ed8A           GSVQLADHYQQNTPIGDGPV----LLPDNHYLSQTVLSKD------------------------------
3b85B           VSRIILTRPAVEAGEKLGFLPDPYLRPLHD----ALRDVEPEVIPKLEAGIVEVAPLAYR--GRTLNDAF
1afrA           PQDFLPDPASDGF---------------------------------------------------------
2dpyB           IVVGLIGERGREVKDFIENILGPDGRA-------------------------------------------
2aexA           ----------------------------------------------------------------------
2dftC           LDTDVAIEQRTGRSIADIFATDDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRR
3c14C           KATKVQDIKNNLKEAIETIV--------------------------------------------------
2c9oA           PFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDFE
3c7kA           VKQYKPVVYSNTIQSLAAIVRAMDTLG-------------------------------------------
3bjqB           ----------------------------------------------------------------------
1cjuC           KA--TKVQDIKNNLKEAIETIVAAMSNLVPPVELANP---------------------------------
1e2lB           DDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGG
2b8tD           VKYLVFKPKSIRNIQSRTGTSLPSVEVESAPEILNYIMSNVQFFDDRICEVANILAENGFVVIISGLDKN
1azsC           KATKVQDIKNNLKE--------------------------------------------------------
2cbzA           GHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPS------GDRTEIGE
3dkvA           PHISTGDMFRAAKEETPLGLEAKSYIDKELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEE
2d7vB           GTSKPTLQQLE---KHHLAHENCFIAN-------SVETEVVT----------------------------
1e2iA           VLGASETIANIYTTQHRLDQGISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRH
1e2lA           MTYWRVLGASETIATTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLI
1e9sA           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR
2d7vA           GTSKPTLQQLE---KHHLAHENCFIAN-------SVETEVVT----------------------------
1d8jA           -------------------------------LSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTL-DEILD
1e2nA           IVYVPEPYWRVLGASETIANIYTTQHRLDQEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSP
1e2hA           EPMVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDSPPPALTLIFDRHPIAALLC
2bhvC           ---------ITADKMIPAFLITPISSQIAGKVIAQVESD----------IFAHMGKAVLIPKGSKVIGYY
3cnnA           WFSLENGVKILDTPGILYKNIFSEDLAAKLLLVGSLPVERRIFERAFEIFARSIGIESSFSEFFEDFARK
3bs4A           NLVGMFSISYPLQLIIRILSRFGVDVIKY-LENHRLAIVDTFGSFHGIMPGVSETLPIKYAKAVEDHKKV
1chdA           ----------------------------------------------------------------------
2a5vB           GYVRDV--------VERVAPSVLLGRRDLSRVDEFEQRHVHEVAILMARSSAISERIAAIVGVTYQLDDG
3dmdA           ----------------------------------------------------------------------
1e2mA           PEPMTYWRVLGASETIA-NIYTTQHRLDQGEISAGDAAVVMTSAQITM--------GMPYAVTDAVLAPH
3bb1D           SPFQSEGPRPVMVSRSRAGF--------------------------------------------------
2ancF           TQEAIEQVLATGVDVFLDIDWQGAQQIRQKMIFILPPSKIELDRRLRGRGQDSEEVIASHYAEYDYLIVN
3ci2A           ----------------------------------------------------------------------
1d6aA           NFNRAFNPNPKVLNLQETWG--------------------------------------------------
1e9rB           DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR
3do6A           KSI-------------------------------------------------------------------
3cphA           FITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTNEHANDEAQLL
2c9gA           L---------------------------------------------------------------------
1dw9A           DAARLVGAKLDLDEDSILLLRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKPEGGER
1dwmA           ----------------------------------------------------------------------
1e2nB           IVYMTYWRVLGASETIANIYTTQHRLDGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPA
3c85A           AQVLILGGRIGTGAYDELRARYGKISLREEAAQQHRSEGRNVISGDATLDTGHVKLVLLAPHHQGNQTAL
1cjvC           TKVQDIKNNLKEAIETIVA---------------------------------------------------
2awoD           GDLFIGEKRMNDT---------------------------------------------------------
2a5vA           GYV--------RDVVERVAPSVLLGRRDLSRVDEFEQRHVHEVAILMARSSAISERIA------------
1d2zD           ADFVALDFLNESTPADGPGALISLELL-------------------------------------------
2a78A           ADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREDENVPFLL
2cdnA           ISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHE
3cbqA           HEPENPEDTYERRIMVDKEAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVIL
1bccF           ------------------WYYNAAGFNKYGLMDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMR
2ax4B           PCYSLDGDNVRHGLNRNLGFSPGIAEVAKLFADAGLVCITSFI-SPFAKDRENARKIHESAGLPFICESR
2c5mB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           DDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQSAGDAAVVMTSAN-----------------------
1e9sK           DRMVIVDPNGDMLSKFGRDK------------------DIILNPYDQRTKGWSFFNEIRNDYDWQRYASV
2c95B           LRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEF-ERRIGQ
2c1lA           VEVHIISSGNFTGPGMSQNIEASLLLDNNTTQSMGFSWNDMISEMLNQNWHIHNMTNATDASPGWNDERT
3cr8B           -----------------------------------------------------------IDPEKREALKH
2d4uB           ----------------------------------TVAELMESASISLKQAEKNWADYEALPRDPRQSTKR
2bwjB           LSTGELLREASESERSKLIRDIMERGDLVP--SGIVLELLKEAMVASLGDT-------------------
2c9oB           ----------------------------------------------------------------------
1dapA           ASSQIFGRAA------------------------------------------------------------
3cddA           QACTVDIGGERVITGYVDDWVPSYDESTITISVSDKTADLVDCSIDYPSGQFNNDIVCKPFGIKVIVNTD
2bwjD           ----------------------------------------------------------------------
1agpA           YDPTIEDSYRKQVVID------------------------------------------------------
3cddE           YKAFIEPIKQGQACTVDIGGERVITGYDDWVPSYDESTTISVSGRDKTADLVDCSIDYPSGQFNNQTLTQ
1delA           AVKYQLAGPIKD----ALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNG
1e6vC           ----------------------------------------------------------------------
2ax4A           PCYSLDGDNVRHGLNRNLEENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFICESR
2dx7A           ----------------------------------------------------------------------
1e6yA           WGRLGFF-----FDLQDQGATNVLSYQGDEGLPDELRGPNYPNYAMNVGH------QGGYAG----IAQA
1akyA           ----------------------------------------------------------------------
3dvlC           PGVFVTFEETPQDIIKNARS---FGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQK
3cddB           FIEPIKQGQACTV---------------------------------------------------------
2ausA           ------------------------------------------------------------------NLDK


                         +         .         .         .         .         *         .:210
query           SARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSALEIEELIKRQHQEKKWTVMWVTHNMEQAKR
3dmdC           VLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARG
3b5jA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR--TVIIIAHRLSTV-K
3cmvG           AARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIA
2d3wB           VNVGFSGGEKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGV--NSLRDGKRSFIIVTHYRILDYI
3dmdB           VLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARG
3cmvC           AARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIKEGENVVGSETRVKVVKNKIAAPF
3cmvH           GLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVVKVVKNKIAAPF
2dwoA           AVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSP-DYKDCNSAEAMDDFMKR
3b60A           NGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNR--TSLVIAHRLSTIEQ
2c03B           ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARG
2akaB           VGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQ--RTIGVITKLDLMDE
1bifA           AVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV-NRDSDEATEDFMRR
2dwpA           AVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYK-DCNSAEAMDDFMKR
2ccgA           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQE-DLKFHEKVIE
1d1cA           IFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKI---TRQAMDIVGFSQEEQMSIFK
3cmvA           GLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVK-EGENVVGSETRVKVVKN
2bifA           AVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV-NRDSDEATEDFMRR
1e9cA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG-----HERYENGAFQERALRCFHQLMKD
2ccgB           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVGYQEIIHN
3dm5A           IIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKG
2ccjB           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERII-KNNRLDQEDLKFHEKVIEGYQE
2c03A           ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARG
2cckA           YIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERNSRLDQEDLKFHEKVIEGYQE
1aroP           GEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAV-AYITIKTTLACLTS
3c95A           FPGTLDYAEQQRWLEHRRQFTP---EFLQGYADELQMLVQKEKVALLKALWQYAD---------------
3dt2A           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGGRRPAGVPLVYEALSWQHGVF
3eiuB           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVV------ARELHRKGIYPPINVLPSLSR
2dr3A           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSLQLKRVLAGTGCTSIFVSQVSGFGPH
2b8tA           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSL-------RKIDGKHADYNDDIVKIGCQEFYSA-
3eiuA           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL------HRKGIYPPINVLPSLSR
4dcgA           KDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNK--IVRNKVVVNFDY
1e69A           KLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHT--QFIVITHNKIVM-E
1e9fA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK------------RYENGAFQERALRCFHQLMKD
2c61B           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYIT-----EGQIVVARELHRKGIYPPINVLPSLS-R
2bbsA           VLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI--LVTSKMEHLK
2awnD           KIVVLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQV
2a2zD           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYL
2dr3E           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIQLKRVLAGTGCTSIFVSQVSPGVEH
2b8wA           SVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR
2cgtH           DRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVN
1e9dA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG-----HERYENGAFQERALRCFHQLMKD
2c04A           ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARG
3czpB           FWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDQYAVGDVDRTSTEIAPWTL--VEANDKRFAR
1e98A           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN-----GAFQERALRCFHQLMKD
1e2dA           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQER------ALRCFHQLMKD
2czvA           PLLYSNPYERANKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGM----EIPQAKASISMY--
3b2qB           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR------KGIYPPINVLPSLSR
2c9yA           LDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPP---KEPMKDDITGEPLIRRSDDNEKALKIRLQ
2a30D           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIQGIPLEYLEKLHYKHESWLLHRTLKTNFDYL
3dt4A           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGGRRPAGVPLVYEALSWQHGVF
2bc9A           VYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTLTYSLKLKKGTS
2awnB           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
3b2qA           TDITNYAEALRQMGAARN--EV-PGRRGYPGYMYTDLATLYERAGIV-KGAKGSVTQIPILSMPGDDI-T
1e4yA           LLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRV---YHVKFNPPKVEGKDDV
2a30B           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYL
2a2zA           NLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLH
3cmvE           AARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIA
2b92B           SKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLCIRKFFPKKKCFVFD
1e9sF           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESAGSNEASKA
3b85A           QKFLTRLGFGSKVVTGDGLRLV-RHILRGVDDVHFSELTSSDVHQLVGHIVDA-----------------
1bg0A           PLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKNEEDHLRIISMQKGGDLKTVYK
3cmxA           FINQIRNPETTTGGNALKF-YASVRLDIRRIGAVKEGENVVGSETRVKVVKNK------IAAPFKQAEFQ
2awnC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
1cr4A           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMID---NLMTKLKGFAKSTGVVLVVICHLKDLLRQ
2d62A           KPRELSGGQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELKKLQRQLGV-TTIYVTHDQ---VE
2a5gA           KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY-------------------
2ahvA           RQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNN
2axzC           LPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFIKNISINGYYDLEIYQF
1e9sG           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAEFAGSNEASKA
3dt4C           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIIFGGRRPAGVPLVYEALSWQHGVF
2dr3B           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILKRVLAGTGCTSIFVSQVSVGERG
3d3kA           ENVFLRDQPWYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPLGEHA-GRIYLCDIGIPQQVFQ
1e9sD           ---GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKA
3a1wA           KKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ------------------
3c8uA           -ARDIAAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRVPADLEARLVQRWLDHGLNHDAAVA
3d7wA           SVTALRFPGGQTKTQARSILIL--IQMISEAARFNP------ILWRARQYINSGA-SFLPDVYMETSWGQ
2cjwB           REVSVSEGRAAVVFDCKFIETSAAVQHNV--------------------KELFEGIVRQVRLRRDSKE-K
3dhwC           YPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKR
2a1fF           -----SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMG-VEVSVVLGGGNLFRG
1e2fA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ----ERALRCFHQLMKDT
3bgwA           AGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKVVIALSQLSRQVEQ
3bh0A           YIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQSRDLKKMARELDVVVIALSQLSRQVEQ
1dhjA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
3czpA           FWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDQYVVGDVDRTSTEIAPWTL------VEANDK
3dt7A           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPIEGIIFGGRRPAGVPLVYEALSWQHGVF
1e0jA           DRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKG
2c9oC           VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQE
1e9rA           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
2ahwD           RQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHN
1dg3A           DSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR
2c61A           TD-ITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHP-I
1e9sJ           ----KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKA
2d4hA           RSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLNLPRLCIRKFFPKKKCFVFDR
2a30A           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYL
2bkhA           FYRLCAGASEDIRERLHSSPDNFRYLNRGCTRYFANKETDKQILQNKSPEYLKAGSLKDPLLDDHGDFIR
2a2zB           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYL
2axpA           GDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSEIAKDIIFLVELEHH------------------
1cr1A           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMID---NLMTKLKGFAKSTGVVLVVICHLKGALRQ
3cr7C           YKKAREGVIKEFTGISAPYEAP-ANPEVHVKNYELPVQD--AVKQIIDYLDTK-----------------
421pA           LVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQ-----------------
1dekB           AFCYLNGKSPIKGVFVFDDEGK-ESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVK
2eg5G           NKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEE----LFSHGRMLLTCICKGVELDARNAIDLLEM
2b8wB           MDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLP
2dr3C           --DLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILKRVLAGTGCTSIFVSQVSGVEHG
2ctsA           FPTNLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELIDCMDLIAKLPCVAAKIYRNLYREGSSIGA
3be4A           EIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYED
2cckB           RALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVE
3dtbB           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRPLVYEALSWQHG-V
3bgwD           YIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNISQISRDLKKMARELDVVVIALSQLSRQVEQ
3bpbA           EGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDF-NIIEIPEEE----S
2akaA           FYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMD----IVGFSQEEQMSIFK
3bb1B           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGAS-LASDIPVVLIENSGRCNSDEK
2a5jA           IGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL-----------
2bkiA           FYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLD-----
2awoC           LDRKPKGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
3dlbB           YHASKGRLQGREGGRVAWVAD---PKDPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRRLG
1e0jB           DRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKG
2ausC           PPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHL--HGDVP
3d31A           NPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARI
3cmtD           FINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVKE-----GENVVGSETRVKVVKNKIAAPFKQAEFQ
2d0kA           LNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLP
2dflA           LQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMHTLYH
2b8tB           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYN--------DDIVKIGCQEFYSA
3cddF           KFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQR--SIGKSNAEYTVTGWRIGKLWN
1dkiA           SSGSAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWEAQI-------DKELSQNQPVYYQGVGKV----
2bhjA           TLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRS
2d4hB           LDLEADGQPLTPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDELDPEFVQQVADFCSYIFSNSKTKT
3bb1F           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDIP--VVLIENSGRCNKND
1dhiA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
3cddD           VGEPIEQGETPHELLARLAKQR-GVLLTSDTFGNLVITRASKTKAGVSLILGD---NVKAARGRFSWRQR
1e6cA           AHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDA--TQPPAAIVCE---------------------
2bbsB           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILVTSKME-HLK
1e9rE           -PRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAEFAGSNEASKA
3d3qB           EDKKQVKLKLKELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKTLLIGIESRETLYLR
1e3aB           ATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVV-AAVPMPFDKWYSAS
3cmvB           LAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGE--NVVGSETRVKVVKN
1cfrA           NVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTFR
1bmfC           ------PYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR--QMSLLLRRPPGREAYPGDVFYLHSRLLER
1cr0A           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMID---NLMTKLKGFAKSTGVVLVVICHDLRALRQ
1ai4B           ATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVV-AAVPMPFDKWYSAS
3bk7A           NVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDY
2d2eA           LSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYI
2bdtA           LLRRDALRKKGERCLELVEEFE--SKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI------------
2bx2L           YTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDI---EETAFNTNLEAADE
3adkA           PTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLEKATEPVIAFYEKRGIVRKVNAEGSVDDVFS
3dm9B           AGRSETNRNLDEKK-------IARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARG
1e3mA           DRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAELANKIKALTLFATHYFELTQL
1e3mB           RIFTRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACENLANKIKALTLFATHYFELTQL
1cr2A           DSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLM---TKLKGFAKSTGVVLVVICHKSGALRQ
3czjA           NDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDG
2e85A           NWVVIDGGSAPENDIVAIRLRPTRLLIVDATDMGLNP------GEIRIIDPDDIAEMFMMTTHNMPLNYL
2c7cH           MQFDLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVN
1e2gA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENG---------AFQERALRCFHQLMKD
3bb1E           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCNKN-
2dr3D           -HDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSLQLKRVLAGTGCTSIFVSQVSVGERG
1e9rD           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGAESLFAGSNEASKA
3d3qA           YAFEISEDKKYLASFDKESAKDIHPNNRKRVLRAIEYYKLLSSRKKVQQFTENYDTLLIGIESRETLYLR
2dr3F           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSLQLKRVLAGTGCTSIFVSQVSGFGPG
3bb1A           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIP--VVLIENSGRCNKND
3cr7A           YKKAREGVIKEFTGISAPYEAPANEVHVKNYELPVQDAVKQIIDYLDTK---------------------
3dfnC           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
2awoA           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
3clvA           ILVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI---------------
3dfqA           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPC
2a1fD           -----SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEI-KELVEMGVEVSVVLGGGNLFRG
1bglA           -DIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDG
1b0uA           YPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGK-TMVVVTHEMGFARH
2bjbA           ----SFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVA
3bb1H           DAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLYDEFFSKRSEALLQVVRSGASLKKD-S
1eilA           SVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLVDDAAALERMADKLRQAGVAFTRGDEAL--
2ck3C           --QYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLL--LRRPPGREAYPGDVFYLHSRLLER
3cddC           VGEPIEQGETPHELLARLAKQR-GVLLTSDTFGNLVITRASKTKAGVSLIL----GDNVKAARGRFSWRQ
3ecpA           AEAIRKAGAMQTVKLAQEFPE----LLAIEDTTSLSYRHQVAEE--LGKLGSIQDKSRGWWVHSVLLLEA
3bo6B           YSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQQALREEPFYRL
2b8tC           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGK--------HADYNDDIVKIGCQEFYSA
3da4A           LGAMFSGKEYQILLPGEIH---------------------------------------------------
3dfpC           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
2drcA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
2c4rL           YTGEIPLFSHYQIESQIESFQREVRLIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRL-R
3cr7D           YKKAREGVIKEFTGISAPYEAPA-NPEVHVKNYELPVQD--AVKQIIDYLDTK-----------------
3dauA           LNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
3dfnA           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPC
2c0bL           YTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARDIEETAARQLRLRDLGIVID
1e9sB           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
2bbtB           LGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE-SCVCKLMANKTRILVTSKME-HLK
1aldA           YPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
3d1mA           ASGRYEGKITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNKLRVTEGWDEDGHH
1e2kA           LAPHIGGEAGPPPALTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
1ak2A           LDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDITGEPLIRRSDDNKKALKIRLEAYHT
3brwA           KFGVIYQKLGATSEEELFSTNEE-SPAFVEFLEFLGQKVKLQDFKGFRGGHGQTGTESVYCNFRNKEIYT
2aumA           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPG---LDWGRLEAASPRPLIGFADISVLL
3cm0A           TGTRLLGVVLVEVELVRRILRRAELDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYA
3dymA           LDNDIGVSEATRIDPNAWVEKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDG
3bczC           QTDEDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSYYDESQGE
2d4uA           NYDIYHNALAELIQLLGAGKIN---EFFDQPTQGYQDGFEKQYVAYMEQNDRLHD---------------
3dfnD           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
3dfoD           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
3dfpD           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
1dekA           FNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDA
3a00A           GKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKEL--KDFIFAE-------
3dftD           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPC
1akeA           VDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDTAPLIGYYSKEAEA
1e59A           PPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI-IAAHGNSL-RA
2d3wC           VNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFII--VTHYQRIL-DYI
1adoA           HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
4dfrA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
3bb1C           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIP--VVLIENSGRCNKND
3cmwC           GDSHMGLAARMMSQAMR-------KLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVR
3dfoC           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPC
3cbnA           GHPELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRD---------LRKGRELKVEIIVEYEGH
3dffA           LDSIYRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLVG--EVADDIRSIIDEFDPTLVVTCAAIG---E
1ek0A           NKIDLQEGGERKVARGEKLAEEKGLLFFE--TSAKTGENVNDVFLGIGEKIPLK----------------
3dfqD           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPC
2bv7A           MALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYT-ATIDVIYEMYTRMN
3dftC           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
1d6jA           LHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKQIIDYLDTK----------------
1draA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
3crmA           LYYKALLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQ
3dm5B           IIIVDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKG
3ch4B           VVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFD---------------------WVIENHGVEQRLEE
4atjA           QSVTLAGGPSWRVPLGRRDSLDLANANLPAPFFTLPQLKDSFRNVGL-NRSSDLVALSGGHTFGKNQCRF
1e4vA           NVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRMTAPLIGYYSKEAEA
1e9rF           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
2bwjA           PQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLE-AYYRASIPVIAYYETKTQLHKINAEGTPE
2ccjA           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQE
3bb1G           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSE----ALLQVVRSGASLSDIPVVLIENSGR-CNK
2bhvA           YSNNNKGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVSAFGDYLLMQLMRQSGMGINQ
1c9kC           YAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAG----------RVNQRLAA
2bofX           GGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQEVLETMAYAGKALKAGSSQARIYFD
1dyhA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
2a1fE           -----------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGV-EVSVVLGGGNLFRG
3dyoA           NDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDG
6aldA           HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENR-RFYRQLLLTADDRVNPC
3dvlD           INYAIQKYRARRVSID----SVTSVFQQYDASSVVR----RELFRLVARLKQIGA-TTVMTTERIEEYGP
3c7kC           ELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTF
1e9sI           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESAGSNEASKA
1ckvA           ----------------------------------------------------------------------
2e85B           NWVVIDGGSAPEDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDP------DDIAEMFMMTTHNMPLNYL
5dfrA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
2czvB           PLLYSNPYERANKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMYPEII--
1cs4C           ----------------------------------------------------------------------
3bv4A           --ALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
2a1fC           -----SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGV-EVSVVLGGGNLFRG
2aunB           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPR-PLIGFSDISVLLSA
2boeX           NPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPRSWIDEFAAGLKNRPAYIIVEPDLISLMSS
1dp0A           -DIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDG
1drbA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLP
3dfqC           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPC
3bjdB           PAADLSRALEQEIAAQSRERHPSQYVSGSASRAQLQVFLRHQWFRTFRLYRDAA--DLLVNLTDVD-EAA
2d3wA           VNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYI
1culC           VRACYERSNEYQLIDCAQLDKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDE
1av6A           ILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKK
2awnA           -------------------------------LSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMT
1e9sL           RLLTAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
2ancD           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAYAEYDYLIVNDDFDTALT
2d2fA           LNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYI
2cvfA           AELSRIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRL-DKLPKPGLRVAVLERHRFRPEG
3d1mB           ASGRYEGKITRNSERFKEPNYNPDIIFKDEENTGADRLMTQRCKDKLNALVMNQWPGVKLRVTEGWDEDG
1d6jB           PFVEVYVDVPVEVAEQRAPYEAPANPEVHVKNYELPVDAVKQIIDYLDTK--------------------
1e9sM           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
1eamA           VMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVN
1accA           DKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVE------IEDTEGLKEV-
2anbA           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKAVAEMSHYAEYDYLIVNDDFDTALT
3b55A           KTTNPTASLNDLKPLKNVGSAS--IVGLGEATHGAHEVFT--KHRIVKYLVSEKGFTNLVLEEGWDRALE
2aunA           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVL-LSA
3cnlA           RGLLKKGGVPDIERALMLFFTEVGRVSFERPED-------------------------------------
1e9sH           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
3ec1A           RLDYIKGGRRSFVCYMANELTVH-RTKLEKADSLYANQLGELLSPPSKRYAA---EFPPLVPRSLSV-KE
3cioD           DLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGV----NIKGAILNGVIKRA
2c5mD           ---------KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQYVINKERYLGKTVQVVPHITDAIQE
3cueF           VGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESM---------------
1e2hB           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGL--
3c15C           ----------------------------------------------------------------------
2ancB           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHDYLIVNDDFDTALT
1dvrA           LEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISD---DNADALKKRLA
2bkeA           LQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVVPG---
2b0lC           ------------------MSKAV-VQMAISSLSYSELEAIEHIFEELDGNEGLLVDRVGITRSVIVNALR
2bhvD           SNNNKMGEYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPTFGDYLLMQLMRQSGQVVNQ
3a00B           GKTCILDIDMQGVKSVKAIPELNARFLFIAPPSGAHD--KVIVNDDLDKAYKEL--KDFIFAE-------
3cr7B           -----QRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYL-----------
1cjtC           ----------------------------------------------------------------------
3cmuA           GEI-GDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYAS-----
2an9A           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHDYLIVNDDFDTALT
1e9sE           RLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKSARFVLSDKLPEHVT
2d3wD           VNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKR--SFIIVTHYQRILYI
2dftA           GGNDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGA----VVRHILSR---------------------
3b9qA           NYSLMEELIACKKAVGKIVSGAPNE-----ILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARG
3di4A           DHTGLPLHEAELVHDVLNVTRDTGQYFKASPVRPGDYLEFFAEIDLLGNLS------ACPGGDCSSEASC
1e2jA           HPIAALLCYPAARYLMGSMTPQAVLAFVALNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL
3bwdD           KQFFIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ------------------
3e70C           VLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARG
1e2mB           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGL--
3cqcA           DVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLC-----LPMLCFLLHTILHSTGQYQECLQ
3bm2B           LEQGAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAGCA--VAQAAVAQGFGGIWRSGALTESPV
1cjaA           DIITLYTGYDVGT--EGSISMQEGFLATVRECASFDLDAFEREQESLQKCHSISPQAIPFILRML-----
1e2iB           VLAPHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPIVLGALPEDRHIDR
3e8aC           ----------------------------------------------------------------------
1e2kB           VLAPHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
2aumB           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPR-PLIGFADISVLLSA
2bbtA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMAN-KTRILVTSKME-HLK
1ckeA           RQRAFRELPGLIAD---GRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVP
3dfdA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e1qB           LRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGD-------VSAYIPTNVIS---
1e9rG           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
3b85B           VILDEAQNTTPAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLVGHIVD----
1afrA           ------------------------ARQAKEHGDIKLA-------QICGTIAADEKRHETAYTKIVEKLFE
2dpyB           ----------------------------------------------------------------------
2aexA           ------------------------LAHRCSSFMAPPVTDLGELRLLILETQAQVCQALAQVDGGANFSVD
2dftC           TGGDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGA----VVRHILSR---------------------
3c14C           ----------------------------------------------------------------------
2c9oA           SLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANG
3c7kA           ----------------------------------------------------------------------
3bjqB           ---------QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGG-KILTFGKEAYNTKR
1cjuC           ----------------------------------------------------------------------
1e2lB           EAG-----SPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTPGTNIVLGALPEDLAKR
2b8tD           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLR--------KIDGKHADYNDDIVKIGCQEFYSA
1azsC           ----------------------------------------------------------------------
2cbzA           KGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLP
3dkvA           ILEEMG----RPIDYVINIQVDKEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDG-GELYQRADD
2d7vB           ----------------------------------------------------------------------
1e2iA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIR
1e2lA           FDRIAALLCYPAARYLMAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL
1e9sA           LLETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
2d7vA           ----------------------------------------------------------------------
1d8jA           ETQHLDIGLKQKQWLMTEALNNPKIEVIDGKYAFKPKYN-------------------------------
1e2nA           PALTDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL
1e2hA           YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL
2bhvC           SNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG----------------------
3cnnA           RGLLKKGGVPDIERALMLFFTEVGRVSFERPE--------------------------------------
3bs4A           WMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLE--TSAEVRYGHPAYKKYPRGTNFWLWEGVKDK-R
1chdA           ------------------LSSEK-LIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQHMPPGFTRS
2a5vB           RAVLRDHIGNIG----------------------------------------------------------
3dmdA           ---------------------------------------------QARQFNEAVKIDGIILTKLDADARG
1e2mA           IGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
3bb1D           ----------------------------------------------------------------------
2ancF           DDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLL----------------------------------
3ci2A           ----------------------------------LVGKSVEEAKKVILQDKPEAQ-IIVLPVGTIVTMEY
1d6aA           ----------------------------------------------------------------------
1e9rB           LLLRETAKKLALIGTPSMR-ELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKSARFVLSDKLPEHVT
3do6A           ----------------------------------------------------------------------
3cphA           LVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNK-LVGVG-----
2c9gA           ----------------------------------------------------------------------
1dw9A           AVITLDGK--------------------------------------------------------------
1dwmA           -------------------------------------KSGNMAAATVERENRNVH-AIVLKEGSAMTKDF
1e2nB           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHLAKLDLAMLAAIRRVYGLLANTVR
3c85A           EQLQRRNYKGQIAAIAEYPDQLE-GLLESGVDAAFNIYSEAGSGFA------------------------
1cjvC           ----------------------------------------------------------------------
2awoD           --------------------------------------------DQVQVELPMPNRQQVWLPVESRDVQV
2a5vA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2a78A           VGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARK---------------
2cdnA           MLERVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLE--YYRDQLKTVDAVGTMDEVFA
3cbqA           VGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR---------------
1bccF           QQILPKEQWTKYEEDVPYLEPYLKEVI-------------------------------------------
2ax4B           DVKGLYKRARAEIKGFTGIDSDYEKPETPERTNLSTVDCVHQVVELLQEQ--------------------
2c5mB           -------------------------INIDAGTTKDNNLTTGKIYQYVINKERKGDYTVQVVPHITDAVMR
2bboA           -------------------------------------------------VCKLMANKTRILVTSKMEHLK
1e2jB           ----------------------------------------------------------------------
1e9sK           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLALFAGSNEASKA
2c95B           PTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETATEPVIAFYEKRGIVRKVNAEGSVDSVFS
2c1lA           TNLTLDETERVTLIVTLGHADTARIQAAPGTTAGQGTQYFWLSKD--SYDFFPPLTIRNRRGTKATYSSL
3cr8B           EALSLP-----SLDLDWQQQC-ELEMLMTGAYSPLTGFMTRAQCARVESAQQLDDGITLTSRDRALADRR
2d4uB           NYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDG---FEKQYVA----------------------
2bwjB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddA           VGEPIEQGETPHELLARLAKDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAAKAD
2bwjD           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3cddE           IADIVCKGIKVIVNTDVGEPFQRIQIPHELLARLAKQRGVLLTSDTFGNLVI------------------
1delA           KSPIKGVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQGTDLIVNNFDRMYWVKLFALDYLDKFNS
1e6vC           -NRRKYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPLEEMEEPECPIRE------LVEPTEGAK
2ax4A           DVKGLYKRARAGEIKGFTIDSDYEKPETPERTNLSTVDCVHQVVELLQEQ--------------------
2dx7A           ---------VEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIACTEVSVVLKQ
1e6yA           AHSG--RGDAFTVLLKVCFADDLLPFNFAEPRREFGRGAIREFVPAGER---------------------
1akyA           ----------------------------------------------------------------------
3dvlC           YRARR-----------VSIDSVTSVFQQYDASSVV----RRELFRLVARLKQIGA-TTVMTTERIEEYGP
3cddB           ----------------------------------------------------------------------
2ausA           PPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALM---------


                         .         .         .         +         .         .         .:280
query           IADTIWFMADGRLLEIAETDTFFSAPQHEAAKEFLKGGTR
3dmdC           GAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLER---
3b5jA           NADRIIVMEKGKIVEQGKHKELLSEPE-------------
3cmvG           APFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA-----
2d3wB           KPDYVHVLYQGRIVKSGDFTLVKQLEEQ------------
3dmdB           GAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLER---
3cmvC           KQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWY----
3cmvH           KQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAW-----
2dwoA           ISCYEASY--QPLDPDKCDRDLSLIKVI------------
3b60A           -ADEIVVVEDGIIVERGTHSELLA--QHGVYAQLHKM---
2c03B           GAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGR---
2akaB           GTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKD-----
1bifA           IECYENSYESLDEEQDRDLSYIKIMDVGQ-----------
2dwpA           ISCYEASY--QPLDPDKCDRDLSLIKVI------------
2ccgA           GYQEIIHNESQRFKSVQPLENVVEDTYQTIIKYL------
1d1cA           IIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTV-----
3cmvA           -KIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLI----
2bifA           IECYENSYESLD----EEQDRDLSYIKIMDVGQSY-----
1e9cA           TTLNWKMVDASKSIERVLSEDAIATATEKPLKELWK----
2ccgB           ESQRFKSVNADQPLE-------------------------
3dm5A           GGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSR---
2ccjB           IIQRFKSVNADQPLE-------------------------
2c03A           GAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGR---
2cckA           IIRFKSVNADQPLENVVED---------------------
1aroP           ADNTTVQAVASAIGRAIEDEARFGRIRDLEAKHF------
3c95A           ----------------------------------------
3dt2A           VGATAAAEHKGKVIMHDPFAMRPFFGYNFGK---------
3eiuB           LMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGLV----
2dr3A           GVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRR-----
2b8tA           -VCRHHHKVPNRPYLNSNSEEFIKFFK-------------
3eiuA           LMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGL-----
4dcgA           PNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLF--------
1e69A           AADLLHGMVNG-----------------------------
1e9fA           TTLNWKMVDASKSIEAVHED--------------------
2c61B           LMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGLV----
2bbsA           KADKILILHEGSSYFYGTFSELQ-NLRPDFSSKLMS----
2awnD           GANMSLGIRPEHLLPSDIADVILEGEVQVVE---------
2a2zD           QEVPILTLDVNEDFK-------------------------
2dr3E           GVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRH----
2b8wA           PVHRRKLAQLEKLQDEE-LDPEFVQQVADFCSYIFSN---
2cgtH           TMRGIVKVAAVKAPGFGDRRKAMLQDIAT-----------
1e9dA           TTLNWKMVDASKSIERVLSEDAIATATEKPLKELWK----
2c04A           GAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGR---
3czpB           VK----VLRT-INDAIEAAY--------------------
1e98A           TTLNWKMVDASKRIEAVHEE--------------------
1e2dA           TTLNWKMVDASKSIE-------------------------
2czvA           ----------------------------------------
3b2qB           LMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGLV----
2c9yA           AYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASIL----
2a30D           QEVPILTLDVNEYESLVE----------------------
3dt4A           VGATAAAEHKGKVIMHDPFAMRPFFGYNFGK---------
2bc9A           QKDETFNLPRLCIRKFFPKKKCFVFDRP------------
2awnB           LADKIVVLDAGRVAQVGKPLELYHYPADR-----------
3b2qA           HPIPDLSGYITEGQIVVAREL-HRKGIYPPINVLP-----
1e4yA           TGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSK----
2a30B           QEVPILTLDVNEYESLVE----------------------
2a2zA           YKHESWLLHRTLKTNFDYLQ--------------------
3cmvE           APFKQAEFQILYGEGINFYGELVDLGVKEKLIEK------
2b92B           RPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFS----
1e9sF           LTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG------
3b85A           ----------------------------------------
1bg0A           RLVTAVDNIESKLPFSHDDRFGFFCPTNLGTTMRA-----
3cmxA           ILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEK----
2awnC           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGF------
1cr4A           LSDTIIALERNQLVLVRILKCRFTGDTGIGYMEY------
2d62A           ATGDRIAVNKGELQQVGTPDEVYYKPVNTFVAGFI-----
2a5gA           ----------------------------------------
2ahvA           GGIVMMQV--------------------------------
2axzC           LTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEEL-----
1e9sG           LTSARFVLSDKLPEHVTMPDGDFSIRSW------------
3dt4C           VGATAAAEHKGK---VIMHDPFAMRPFF------------
2dr3B           FGGPGVHGVDGIIRLDLDEIDGELKRSLIVWKMRG-----
3d3kA           EVGINYHSPFG-----------------------------
1e9sD           LTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG------
3a1wA           ----------------------------------------
3c8uA           RAQGNDLANARAIEAARLPADLT-----------------
3d7wA           QSTQVQHSTDGVFNN-------------------------
2cjwB           NERRLAYQKRKE----------------------------
3dhwC           ICDCVAVISNGEL---------------------------
2a1fF           AKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRA-----
1e2fA           TLNWKMVDASKSIEAVHE----------------------
3bgwA           RQDKRPMLSDLRESGQLEADIIEFLYRDDYYDKESE----
3bh0A           RQDKRPMLSDLRESGQLEADIIEFLYRDDYYDKES-----
1dhjA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVSSEFHD---
3czpA           RFARVKVLRT-INDAIEAAY--------------------
3dt7A           VGATAAAEHKGKVIMHDPFAMRPFFGYNFGK---------
1e0jA           KAHEEGRPVSITDLR-------------------------
2c9oC           MKQIIKIRAQTEGINISEEA--------------------
1e9rA           MPDGDFSIRS------------------------------
2ahwD           NGGIVMMQVQKMVKKATLHPKSVRIPGY------------
1dg3A           PVHELDPEFVQQVADFCSYIFSNSKTKT------------
2c61A           PDLSGYITEGQIVVARELHRKGIYPPIN------------
1e9sJ           LTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG------
2d4hA           PVHRRKLA-QLEKLQDEELDPEFVQQVADFCSYIF-----
2a30A           QEVPILTLDVNEYESLVE----------------------
2bkhA           MCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFE------
2a2zB           QEVPILTLDVNEDFKDKYESL------VEKVKEFLS----
2axpA           ----------------------------------------
1cr1A           LSDTIIALERNQLVLVRILKCRFTGDTGIAYMEY------
3cr7C           ----------------------------------------
421pA           ----------------------------------------
1dekB           LFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAM------
2eg5G           AINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCI------
2b8wB           RLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEE-----
2dr3C           V-DGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRH----
2ctsA           IDSKLDWSHNF-----------------------------
3be4A           LGILKRVNAKLPPKEVTE----------------------
2cckB           DTYQT-----------------------------------
3dtbB           FVGAAMRSEAKVIMHDPFAMRPFGYNFGKYLAHWLS----
3bgwD           RQDKRPMLSDLRESGQLEADIIEFLYRDDYYDKESE----
3bpbA           YAANCIWVNERVIMPAGYPRTREKIARLVDTSEYRKIDGG
2akaA           IIAGILHLGNIKFEKGAGEGAVLKDKTA------------
3bb1B           VLPNGIAWIPHLVQTITEVALNKSESIF-VDKNLIDG---
2a5jA           ----------------------------------------
2bkiA           --DHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGV------
2awoC           LADKIVVLDAGRVAQVGKPLELYHYPADR-----------
3dlbB           LGTPEAVRAQAYRLSIPKLMGRRAVSKPADALRV------
1e0jB           KAHEEGRPVSITDLR-------------------------
2ausC           EDKIRAVMKEFEGEIIQRTRKVYYIEILEIDGRDV-----
3d31A           MADRIAVVMDGKLIQVGKPEEIFEKPVE------------
3cmtD           ILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEK----
2d0kA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS-------
2dflA           VPGIRIQLKKSRGNR--RIARVVDAPHLPEGEVVF-----
2b8tB           VCRHH-HKVPNRPYLNSNSE--------------------
3cddF           INTLVPVIDEIGLDEELIASILFSEDDAGRLAVISVV---
1dkiA           -GGHAFVI-DGADGR-------------------------
2bhjA           DGKHDFRLWNTIRGDAATLEFTQLCIDLGWKPRYG-----
2d4hB           LSGGIQVNGPRLESLVLTYVNAISSGDL------------
3bb1F           SDEKV--LPNGIAWIPHLVQTITEVALNKSESIFV-----
1dhiA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS-------
3cddD           F-SKFTIKDSAGLPTVGGIKADVTDSEI------------
1e6cA           ----------------------------------------
2bbsB           KADKILILHEGSSYELQNLRDSFDQFSAERRNSILT----
1e9rE           LTSARFVLSDKLPEHVTMPDGDFSIRSW------------
3d3qB           INKRVDILGHGLFNEVQHLVEQGFEASQSQAIGY------
1e3aB           GYETTQDGPTGSLNISVGAKILYEAVQG------------
3cmvB           -KIAAPFKQAEFQIFYGELVDLGVKEKLIEKAGAWY----
1cfrA           PDRRLQLA--------------------------------
1bmfC           AAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNV------
1cr0A           LSDTIIALERNQLVLVRILKCRFTGDTGIAG---------
1ai4B           GYETTQDGPTGSLNISVGAKILYEAVQGDKSPIPQ-----
3bk7A           VSDRLIVF-EGEPGRHGRALPPMGMREG------------
2d2eA           QPDKVHVMMDGRVVATGGPELALELEAKGYEW--------
2bdtA           ----------------------------------------
2bx2L           IARQLRLRDLGGLIVIDFIDMTPVRHQRAVENRLR-----
3adkA           QVCTH-----------------------------------
3dm9B           GAALSISYVIDAPILFVGVGQGYDDLRPFEKEWF------
1e3mA           PEKEGVANVHLDALEHGDTIAFHSVQDGAASKSY------
1e3mB           PEKEGVANVHLDALEHGDTIAFHSVQDGAASKSY------
1cr2A           LSDTIIALERNNLVLVRILKCRFTGDTGIAGYEYNKETGW
3czjA           SGQMAITVDVEVA---------------------------
2e85A           IDDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQ----
2c7cH           TMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTV-----
1e2gA           TTLNWKMVDASKSIE-------------------------
3bb1E           -DSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNL-
2dr3D           FGGPGEHGVDGIIRLDLDEIDGELKRSLIVWKMRG-----
1e9rD           LTSARFVLSDKLPEHVTMPDGDFSIRSW------------
3d3qA           INKRVDILGHGLFNEVQHLVEQGFEASQSQA---------
2dr3F           VEDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMR------
3bb1A           SDEKV--LPNGIAWIPHLVQTITEVALNKSESIFV-----
3cr7A           ----------------------------------------
3dfnC           IGGVILFHETLYQKADDGR---------------------
2awoA           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIG----
3clvA           ----------------------------------------
3dfqA           IGGVILFHETLYQ--KADDGRPF-----------------
2a1fD           AKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRA-----
1bglA           SGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGL
1b0uA           VSSHVIFLHQGKIEEEGDPEQVFGNPQSPRLQQFLKG---
2bjbA           FLSAA-VVSGGTVRIT------------------------
3bb1H           DIPVVLIENSGRCNKNDSDEKVLPNGIA------------
1eilA           MQQRKVMGLLCLQDPFGLPLEIYYGPAEIFHEPFL-----
2ck3C           AAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNV------
3cddC           RFSKFTIKADSAGLP-------------------------
3ecpA           TTFRTVGLLHQEWWMRPDDPADADEKESGKWLAAA-----
3bo6B           MAE-------------------------------------
2b8tC           VCRHHHKVPNRPYLN-------------------------
3da4A           ----------------------------------------
3dfpC           IGGVILFHETLYQKADDGR---------------------
2drcA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS-------
2c4rL           DLGGLIVIDFIDMTPVRHQRAVENRLREAV----------
3cr7D           ----------------------------------------
3dauA           KAQKLYLTHIDA---EVEGDTHFPDYEPDDWES-------
3dfnA           IGGVILFHETLYQ--KADDGRPF-----------------
2c0bL           FIDMTPVRHQRAVE-----NRLREAVRQDRARIQ------
1e9sB           MPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPL-----
2bbtB           KADKILILHEGSSYFYGTFSELQ-NLRPDFSSKLMD----
1aldA           IGGVILFHETLYQ--KADDGRPF-----------------
3d1mA           SEESLHY--EGRAVDITTSDRDRSKYGMLARLAVE-----
1e2kA           LAKRQRPGERLDLAMLAAIRRVYGLLANT-----------
1ak2A           QTTPLVEYYSKRIDASQTPDVVFASILAAFSKA-------
3brwA           EGDAQQLQRKRHIGND-IVAVVFQDENTPFVPDMIA----
2aumA           SA----FHRHGLPAIHGPVATGLGLQERLAS---------
3cm0A           RIRAA-----------------------------------
3dymA           SGQMAITVDVEVASDT------------------------
3bczC           IYRSIEHLDKGSIIEQLDPVSFSNYLKKYH----------
2d4uA           ----------------------------------------
3dfnD           IGGVILFHETLYQKADDGR---------------------
3dfoD           IGGVILFHETLY--QKADDGRPF-----------------
3dfpD           IGGVILFHETLY--QKADDGRPF-----------------
1dekA           ARAMGATVIHVVRPGQ------KSNDTHITEAGLPI----
3a00A           ----------------------------------------
3dftD           IGGVILFHETLY--QKADDGRPF-----------------
1akeA           GNTKYAKVDGTKPVA-------------------------
1e59A           LVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLK----
2d3wC           KPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGW--------
1adoA           IGGVILFHETLYQKADDGR---------------------
4dfrA           KAQKLYLTHIDA---EVEGDTHF-PDYEPDDWESVF----
3bb1C           SDEKV--LPNGIAWIPHLVQTITEVALNKSESIFV-----
3cmwC           LDIRRIGAVKEG----------------------------
3dfoC           IGGVILFHETLYQKADDGR---------------------
3cbnA           ----------------------------------------
3dffA           HPDHEATRDAALFATHEKNVPVRLWEDLPYAVFKS-----
1ek0A           ----------------------------------------
3dfqD           IGGVILFHETLYQKADDGR---------------------
2bv7A           AELN------------------------------------
3dftC           IGGVILFHETLYQKADDGR---------------------
1d6jA           ----------------------------------------
1draA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS-------
3crmA           VWDYLDGKLSYAEMTERGIIATRQLAKRQFTW--------
3dm5B           GGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSR---
3ch4B           QLENLIEFIRSRL---------------------------
4atjA           IMDRLYNF-SNTGLPDPTLNTTYLQTLRGLCPLN------
1e4vA           GNTKYAKVDGTKPVA-------------------------
1e9rF           MPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPL-----
2bwjA           FLQLCTAIDSI-----------------------------
2ccjA           IIHRFKSVNADQPLE-------------------------
3bb1G           NDSDEKVLPNGIAWIPHLVQTITEVALNKSESIFV-----
2bhvA           VVNQILVIREGSRVFISPNDIFFPIPENEVIAEFLK----
1c9kC           AADEVWLVVSGIGVKI------------------------
2bofX           AGHSAWHSPAQMASWLQQADI-------------------
1dyhA           KAQKLYLTHIDA---EVEGDTHF-----------------
2a1fE           AKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRA-----
3dyoA           SGQMAITVDVEVASD-------------------------
6aldA           IGGVILFHETLY--QKADDGRPF-----------------
3dvlD           IARYGVFVSDNV----------------------------
3c7kC           KNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCV------
1e9sI           LTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG------
1ckvA           ----------------------------------------
2e85B           IDDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQ----
5dfrA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS-------
2czvB           ----------------------------------------
1cs4C           ----------------------------------------
3bv4A           IGGVILFHETLYQKADDGR---------------------
2a1fC           AKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRA-----
2aunB           FHRHGLPAIHGP----------------------------
2boeX           CMQHVQQEVLETMAYAGKALKAG-----------------
1dp0A           SGQMAITVDVEV----------------------------
1drbA           KAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFS-------
3dfqC           IGGVILFHETLYQ--KADDGRPF-----------------
3bjdB           ALARYLYGELGEEDEKGSHPRLLAKLLEA-----------
2d3wA           KPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGW--------
1culC           RRKWIQCFVTAIIFVVASSS--------------------
1av6A           MYYLNKIVVNFDYPNQEYDYFHMYFMLRTVYCNKTF----
2awnA           LADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI-----
1e9sL           MPDGDFSIRSWLEDPNGGNLFITWREDMG-----------
2ancD           DLKTIIRAERLRMSRQKQRHDALIS---------------
2d2fA           QPDKVHVMMDGRVVATGGPELALELEAKGYEW--------
2cvfA           LMAYFRITERG-----------------------------
3d1mB           HHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVE-----
1d6jB           ----------------------------------------
1e9sM           MPDGDFSI--------------------------------
1eamA           YAKKMYYL-NKIVRNKVVVNFDYPNQEYDYFHMYFM----
1accA           INDRYDMLNISSLRQDGKTFIDFKKYND------------
2anbA           DLKTIIRAERLRMSRQKQRHDALISK--------------
3b55A           LDRYVLTG---KGNPSQHLTPVFKTKELD-----------
2aunA           FHRHGLPAIHGPVAT-------------------------
3cnlA           ----------------------------------------
1e9sH           MPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPL-----
3ec1A           RKTDIVFSGLGWVTCNDPGAQLV-VHAPKGVDVFIR----
3cioD           ----------------------------------------
2c5mD           WVMRQALEPQVCVIELGGTVGIESMPFIEAFRQFQ-----
3cueF           ----------------------------------------
1e2hB           LANTVRYLQCGGSWREDWGQLSGPQSNAGPRPHI------
3c15C           ----------------------------------------
2ancB           DLKTIIRAERLRMSRQKQRDALISKL--------------
1dvrA           AYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADIL----
2bkeA           IRIQLKKSRGNRRIA-----RVVDAPHLPEGEVVF-----
2b0lC           KLESAGVIESRSLGMKGTYIKVLNNKFLIELENL------
2bhvD           IIAPIVVIREGSRVFISPNTFFPIPRENEVIAEFLK----
3a00B           ----------------------------------------
3cr7B           ----------------------------------------
1cjtC           ----------------------------------------
3cmuA           ----------------------------------------
2an9A           DLKTIIRAERLRMSRQKQRHDALISK--------------
1e9sE           MPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPL-----
2d3wD           KPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGW--------
2dftA           ----------------------------------------
3b9qA           GCVVSVVEELGIPVKFIGVGEAVEDLQPFDPEAFVN----
3di4A           HPLLVEIFAPAEGLGDWPSP--------------------
1e2jA           LANTVRYLQCGGSWREDWGQLSGPRPHIGDT---------
3bwdD           ----------------------------------------
3e70C           GAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLER---
1e2mB           LANTVRYLQCGG----------------------------
3cqcA           LADMVSSE-RHKLYLV------------------------
3bm2B           -VREAFGCREGTPQLVPDPTPFVTYFHH------------
1cjaA           ----------------------------------------
1e2iB           LAK-------------------------------------
3e8aC           ----------------------------------------
1e2kB           DRHIDRLAKRERL---------------------------
2aumB           FHRHGLPAIHGPVAT-----GLGLEQQ-------------
2bbtA           KADKILILHEGSSYFYGTFSELQNLRSAERRNSILT----
1ckeA           AADALVLDSTTLSIE-------------------------
3dfdA           ----------------------------------------
2dpyA           ----------------------------------------
1e1qB           ITDGQIFLETEL----------------------------
1e9rG           ----------------------------------------
3ed8A           ----------------------------------------
3b85B           ----------------------------------------
1afrA           IDPDGTVLAFADMMRKKISMPAH-----------------
2dpyB           ----------------------------------------
2aexA           RWERKEGGGG------------------------------
2dftC           ----------------------------------------
3c14C           ----------------------------------------
2c9oA           EINKVVNKYIDQGIAELVPGVLFVDEVH------------
3c7kA           ----------------------------------------
3bjqB           NTKRIDFGYEGDPYSIVPSALEAKVPRELRDASQV-----
1cjuC           ----------------------------------------
1e2lB           LDLAMLAAIRRVYGLLANT---------------------
2b8tD           VCRHHHKVPNRPYLNSNSEE--------------------
1azsC           ----------------------------------------
2cbzA           QVDVIIVMSGGKISEMGSYQELLARDGAFAE---------
3dkvA           NEETVTKRLEVNMKQTAP----------------------
2d7vB           ----------------------------------------
1e2iA           RVYGLLANTVRYLQCGGS----------------------
1e2lA           LANTVRYLQCGGSWREDWGQLSGPRPTLFRAPELLAPN--
1e9sA           MPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPL-----
2d7vA           ----------------------------------------
1d8jA           ----------------------------------------
1e2nA           LANTVRYLQCGGSWREDWGQLSGPRPHIGDTLFTLF----
1e2hA           LANTVRYLQCGGSWREDWGQLSGPRPHIGDT---------
2bhvC           ----------------------------------------
3cnnA           ----------------------------------------
3bs4A           VLLSVYRRADYVL---------------------------
1chdA           FAERLNKLCQISVKEAEDGERVLP----------------
2a5vB           ----------------------------------------
3dmdA           GAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLER---
1e2mA           LAK-------------------------------------
3bb1D           ----------------------------------------
2ancF           ----------------------------------------
3ci2A           RIDRVRLFVDKLDNIA------------------------
1d6aA           ----------------------------------------
1e9rB           MPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPL-----
3do6A           ----------------------------------------
3cphA           ----------------------------------------
2c9gA           ----------------------------------------
1dw9A           ----------------------------------------
1dwmA           RCDRVWVIVNDHGVVT------------------------
1e2nB           YLQCGGSWREDWGQLSGPQSNAGPRPHIG-----------
3c85A           ----------------------------------------
1cjvC           ----------------------------------------
2awoD           GANMSLGIRPEHLLPSDIADVILEGEVQVVE---------
2a5vA           ----------------------------------------
1d2zD           ----------------------------------------
2a78A           ----------------------------------------
2cdnA           RALRA-----------------------------------
3cbqA           ----------------------------------------
1bccF           ----------------------------------------
2ax4B           ----------------------------------------
2c5mB           QALIPVDEPQVCVIELGGTDI-ESMPFIEAFRQF------
2bboA           KADKILILHEGSSYFYGTFSELQ-NLQPDFSSKLMS----
1e2jB           ----------------------------------------
1e9sK           LTSARFVLSDKL----------------------------
2c95B           QVCTH-----------------------------------
2c1lA           INMNYIDINYTD----------------------------
3cr8B           PGERLLRDGEGYMLAILTLSDVWKDGER------------
2d4uB           ----------------------------------------
2bwjB           ----------------------------------------
2c9oB           ----------------------------------------
1dapA           ----------------------------------------
3cddA           VTDSEIGRYRPLI---------------------------
2bwjD           ----------------------------------------
1agpA           ----------------------------------------
3cddE           ----------------------------------------
1delA           GYDYYI----------------------------------
1e6vC           AGDRIRYIQFTDSVYFAPIHPYI-----------------
2ax4A           ----------------------------------------
2dx7A           DDLKVPLIDPMDVIAEV-----------------------
1e6yA           ----------------------------------------
1akyA           ----------------------------------------
3dvlC           IAGVEEFVSDNVV---------------------------
3cddB           ----------------------------------------
2ausA           ----------------------------------------