[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB13610.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cnqS.bssp"
#ERROR : Can't open dsspfile "3bgoS.bssp"
#ERROR : Can't open dsspfile "1cseE.bssp"
#ERROR : Can't open dsspfile "2b6nA.bssp"
#ERROR : Can't open dsspfile "3dw3X.bssp"
#ERROR : Can't open dsspfile "1ea7A.bssp"
#ERROR : Can't open dsspfile "1a1yE.bssp"
#ERROR : Can't open dsspfile "1aqnA.bssp"
#ERROR : Can't open dsspfile "1c3lA.bssp"
#ERROR : Can't open dsspfile "1ak9A.bssp"
#ERROR : Can't open dsspfile "1a2qA.bssp"
#ERROR : Can't open dsspfile "3a3pA.bssp"
#ERROR : Can't open dsspfile "1c9jA.bssp"
#ERROR : Can't open dsspfile "1av7A.bssp"
#ERROR : Can't open dsspfile "1c13A.bssp"
#ERROR : Can't open dsspfile "1duiA.bssp"
#ERROR : Can't open dsspfile "1c9nA.bssp"
#ERROR : Can't open dsspfile "1bh6A.bssp"
#ERROR : Can't open dsspfile "3ee6A.bssp"
#ERROR : Can't open dsspfile "2e1pA.bssp"
#ERROR : Can't open dsspfile "3a3nA.bssp"
#ERROR : Can't open dsspfile "3edyA.bssp"
#ERROR : Can't open dsspfile "1dbiA.bssp"
#ERROR : Can't open dsspfile "1c9mA.bssp"
#ERROR : Can't open dsspfile "3eifA.bssp"
#ERROR : Can't open dsspfile "3bpsA.bssp"
#ERROR : Can't open dsspfile "2b4fA.bssp"
#ERROR : Can't open dsspfile "1detA.bssp"
#ERROR : Can't open dsspfile "2birA.bssp"
#ERROR : Can't open dsspfile "2e0wB.bssp"

## Summary of PDB Search
:442
    2e-49  40%  3cnqS  [x.x.x] SUBTILISIN BPN'
    1e-48  40%  3bgoS  [x.x.x] SUBTILISIN BPN'
    3e-45  40%  1cseE  [c.41.1] SUBTILISIN CARLSBERG
    4e-45  38%  2b6nA  [x.x.x] PROTEINASE K
    2e-44  33%  3dw3X  [c.41.1 (1bjrE)] PROTEINASE K
    2e-44  30%  1ea7A  [c.41.1] SERINE PROTEASE
    3e-44  40%  1a1yE  [x.x.x] ALCALASE
    4e-44  41%  1aqnA  [x.x.x] SUBTILISIN 8324
    1e-43  40%  1c3lA  [c.41.1] SUBTILISIN-CARLSBERG
    4e-43  40%  1ak9A  [x.x.x] SUBTILISIN 8321
    7e-43  39%  1a2qA  [x.x.x] SUBTILISIN BPN'
    6e-42  32%  3a3pA  [x.x.x] TK-SUBTILISIN
    3e-41  38%  1c9jA  [c.41.1] SERINE PROTEASE
    4e-41  37%  1av7A  [c.41.1 (1selA)] SUBTILISIN CARLSBERG, TYPE VIII
    7e-41  39%  1c13A  [x.x.x] SUBTILISIN
    2e-40  41%  1duiA  [c.41.1] PROTEIN (SUBTILISIN BPN')
    9e-40  38%  1c9nA  [c.41.1] SERINE PROTEASE
    3e-39  38%  1bh6A  [c.41.1] SUBTILISIN DY
    4e-39  13%  3ee6A  [x.x.x] TRIPEPTIDYL-PEPTIDASE 1
    3e-38  28%  2e1pA  [x.x.x] TK-SUBTILISIN
    4e-38  33%  3a3nA  [x.x.x] TK-SUBTILISIN
    4e-36  15%  3edyA  [x.x.x] TRIPEPTIDYL-PEPTIDASE 1
    6e-36  38%  1dbiA  [c.41.1] AK.1 SERINE PROTEASE
    3e-35  36%  1c9mA  [c.41.1] SERINE PROTEASE
    3e-32  18%  3eifA  [x.x.x] C5A PEPTIDASE
    1e-24  30%  3bpsA  [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    1e-23   7%  2b4fA  [x.x.x] ENDO-1,4-BETA-XYLANASE
    7e-12  13%  1detA  [x.x.x] RIBONUCLEASE T1
    5e-11  12%  2birA  [d.1.1] RIBONUCLEASE T1
    1e-04  20%  2e0wB  [x.x.x] GAMMA-GLUTAMYLTRANSPEPTIDASE
:442

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVIIEFEEGCHETGFQM
3cnqS           ----------------------------------------------------------------------
3bgoS           ----------------------------------------------------------------------
1cseE           ----------------------------------------------------------------------
2b6nA           ----------------------------------------------------------------------
3dw3X           ----------------------------------------------------------------------
1ea7A           ----------------------------------------------------------------------
1a1yE           ----------------------------------------------------------------------
1aqnA           ----------------------------------------------------------------------
1c3lA           ----------------------------------------------------------------------
1ak9A           ----------------------------------------------------------------------
1a2qA           ----------------------------------------------------------------------
3a3pA           ----------------------------------------------------------------------
1c9jA           ----------------------------------------------------------------------
1av7A           ----------------------------------------------------------------------
1c13A           ----------------------------------------------------------------------
1duiA           ----------------------------------------------------------------------
1c9nA           ----------------------------------------------------------------------
1bh6A           ----------------------------------------------------------------------
3ee6A           ----------------------------------------------------------------------
2e1pA           -----------------------------------------------------RVIVSVDKA-------K
3a3nA           ----------------------------------------------------------------------
3edyA           ----------------------------------------------------------------------
1dbiA           ----------------------------------------------------------------------
1c9mA           ----------------------------------------------------------------------
3eifA           ----------------------------------------------------------------------
3bpsA           ----------------------------------------------------------------------
2b4fA           ----------------------------------------------------------------------
1detA           ----------------------------------------------------------------------
2birA           ----------------------------------------------------------------------
2e0wB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AGEVLQKEKRSKLKSRFNKINCCSAEVTPSALHSLLSECSNIRKVYLNREVKALLDTATEASHAKEVVRN
3cnqS           ----------------------------------------------------------------------
3bgoS           ----------------------------------------------------------------------
1cseE           ----------------------------------------------------------------------
2b6nA           ----------------------------------------------------------------------
3dw3X           ----------------------------------------------------------------------
1ea7A           ----------------------------------------------------------------------
1a1yE           ----------------------------------------------------------------------
1aqnA           ----------------------------------------------------------------------
1c3lA           ----------------------------------------------------------------------
1ak9A           ----------------------------------------------------------------------
1a2qA           ----------------------------------------------------------------------
3a3pA           ----------------------------------------------------------------------
1c9jA           ----------------------------------------------------------------------
1av7A           ----------------------------------------------------------------------
1c13A           ----------------------------------------------------------------------
1duiA           ----------------------------------------------------------------------
1c9nA           ----------------------------------------------------------------------
1bh6A           ----------------------------------------------------------------------
3ee6A           --------------YVGGPTETHVVRSPHPYQLPQ-ALAPHVDFVGGLHRFPPTSHLGVTPSVIRKRYNL
2e1pA           FNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKL-KKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQT
3a3nA           ----------------------------------------------------------------------
3edyA           ----------------------------------------------------------------------
1dbiA           ----------------------------------------------------------------------
1c9mA           ----------------------------------------------------------------------
3eifA           ------------------------------------------------------IRDLNDPSQVKTLQEK
3bpsA           ----------------------------------------------------------------------
2b4fA           -----------------------------------------------------QKNPDNHPDAKKQGVYA
1detA           ----------------------------------------------------------------------
2birA           ---------------------------------------------------------------ACDYTCG
2e0wB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYRGPA
3cnqS           -QGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAG-----------TVLAVA
3bgoS           -QGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAG-----------TVLAVA
1cseE           -QGFKGANVKVAVLDTGIQAHPDLNVVGGASFVAGEA--YNTDGNGHGTHVAGTVAALDNTTG--VLGVA
2b6nA           -TDYDGSGVTAFVIDTGVLNHNEFGGRASSGYDFIDNDYDATDCNGHGTHVAGTIGGSTY-------GVA
3dw3X           -DESAGQGSCVYVIDTGIEAHPEFEGRAQMVKTYYYS---SRDGNGHGTHCAGTVGS-------RTYGVA
1ea7A           -STTGGSGINIAVLDTGVNTHPDLVNNVEQCKDFTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVA
1a1yE           -QGFKGANVKVAVLDTGIQAHPDLNVVGGASFVAGEAY--NTDGNGHGTHVAGTVAALDNTTG--VLGVA
1aqnA           -QGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTV--AALNNSIGVLGVA
1c3lA           -QGFKGANVKVAVLDTGIQAHPDLNVVGGASFVAGEA--YNTDGNGHGTHVAGTVAALDNTTG--VLGVA
1ak9A           -QGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTV--AALNNSIGVLGVA
1a2qA           -QGYCGSNVKVAVIDSGIDSHPDLKVAGGASMVPSE-TNPFQDNNSHGTHVAGTV--AALNNSIGVLGVA
3a3pA           ----SVSVIQVAVLDTGVDYHPDLAANIAWCVSTLTKLRDCADQNGHGTHVIGTIAALNNDI--GVVGVA
1c9jA           -RGLTGSGVRVAVLDTGISTPDLNIRGGASFVPGEPS---TQDGNGHGTHVAGTIAALNNSI--GVLGVA
1av7A           -QGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAY-NTDGNGHGTHVAGTVAALDNTTG--VLGVA
1c13A           -RGLTGSGVKVAVLDTGISTPDLNIRGGASF---VPGEPSTQDGNGHGTHVAGTIAALNNSIGV--LGVA
1duiA           -QGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAG-----------TVLAVA
1c9nA           -RGLTGSGVRVAVLDTGISTPDLNIRGGASFVPGEPS---TQDGNGHGTHVAGTIAALNNSI--GVLGVA
1bh6A           -QGYKGANVKVGIIDTGIASHTDLKVVGGASFVSGES--YNTDGNGHGTHVAGTVAALDNTTG--VLGVA
3ee6A           TVGSGTSNNSQACAQFLEQYHDSDLAQFMRLFGGNFAHQASVARGIEASLDVQYL-----------MSAG
2e1pA           IPDGSVSVIQVAVLDTGVDYHPDLAANIAWCVSTLTKLRDCADQNGHGTHVIGTIAALNNDIG--VVGVA
3a3nA           ----SVSVIQVAVLDTGVDYDPDLAANIAWCVSTLRGKVDCADQNGHGTHVIGTIAALNNDI--GVVGVA
3edyA           ----GTSNNSQACAQFLEQYHDSDLAQFMRLFGGNFAHQASVARGIEASLDVQYL-----------MSAG
1dbiA           ----GSSGQEIAVIDTGVDYTPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAGIAAAETNNATG-IAGMA
1c9mA           -RGLTGSGVKVAVLDTGISTPDLNIRGGASFVPGEPS---TQDGNGHGTHVAGTI--AALDNSIGVLGVA
3eifA           A--SKGAGTVVAVIDAGFDKHEAWRLTDVAYYHDYSKDGKTAVDQEHGTHVSGILAPSETKEPYRLEGAM
3bpsA           -DEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVV-------SGRDAGVA
2b4fA           WKLKLNQNGFVYKVDEGPAPAGEEY-FAFALLNASARWGNS-GEFNYYNDAITLMENQIIRFSPYIDNLT
1detA           GYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYWPILSSGDVYSGGSPGADRVENNQLAGVITHTGAS
2birA           SNCYSSSDVSYKLHEDGEVGSNSYPHKANNYEYYEWPILSSGDVYSGGSPGADRV---VFNENNQLAGVI
2e0wB           --------------------------------------------------------------------VD


                         .         .         .         +         .         .         .:280
query           PEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEA
3cnqS           PSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMSLGSP------SGSAALKAAVDKA
3bgoS           PSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMSLGSPS------GSAALKAAVDKA
1cseE           PSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNG-------MDVINMSLGGAS------GSTAMKQAVDNA
2b6nA           KNVNVVGVRVLNCSGSGSNSGVIAGINWVK-----NNASGPAVANMSLGGG---ASQATDD----AVNAA
3dw3X           KKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDK-------NNRNCPKGVVASLSLGGGYSSSVNSAAARL
1ea7A           PDADLWAYKVLLDSGSGYSDDIAAAIRHAA--DQATATGTKTIISMSLGSS------ANNSLISSAVNYA
1a1yE           PSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNG-------MDVINMSLGGA------SGSTAMKQAVDNA
1aqnA           PCASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGP------SGSAALKAAVDKA
1c3lA           PSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNG-------MDVINMSLGGA------SGSTAMKQAVDNA
1ak9A           PCASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGP------SGSAALKAAVDKA
1a2qA           PCASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGGP------SGSAALKAAVDKA
3a3pA           PGVQIYSVRVLDARGSGSYSDIAIGIAQAILGPDDPDDDAAEVISMSLGGP------ADDSYLYDMIIQA
1c9jA           PSAELYAVKVLGASGSGSYSSIAQGLEWAGNNG-------MHVASLSLGSPS------PSATLEQAVNSA
1av7A           PSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNG-------MDVINMSLGGASGSTAMKQ------AVDNA
1c13A           PNAELYAVKVLGASGSGSVSSIAQGLEWAGNNG-------MHVANLSLGSPSP------SATLEQAVNSA
1duiA           PSASLYAVKVLGADGSGQYSWIINGIEWAIANN-------MDVINMSLGG------PSGSAALKAAVDKA
1c9nA           PSAELYAVKVLGASGSGSYSSIAQGLEWAGNNG-------MHVASLSLGSPS------PSATLEQAVNSA
1bh6A           PNVSLYAIKVLNSSGSGSYSAIVSGIEWATQNG-------LDVINMSLGGPS------GSTALKQAVDKA
3ee6A           ANISTWVYSSPGRHEGQEPFLQWLMLLSNE-------SALPHVHTVSYGDDEDSLSSAYIQRVNTELMKA
2e1pA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDDPDDDAAEVISMSLGGP------ADDSYLYDMIIQA
3a3nA           PGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDDPDDDAAEVISMSLG------GPADDSYLYDMIIQA
3edyA           ANISTWVYSSPGRHEGQEPFLQWLMLLSNE-------SALPHVHTVSYGDDEDSLSSAYIQRVNTELMKA
1dbiA           PNTRILAVRALDRNGSGTLSDIADAIIYA-------ADSGAEVINLSLGCD------CHTTTLENAVNYA
1c9mA           PSAELYAVKVLGASGSGAISSIAQGLEWAGNNG-------MHVANLSLGSPS-------PSATLEQAVNA
3eifA           PEAQLLLMRVEIVNGLDYARNYAQAIRDAV-------NLGAKVINMSFGNAAL-AYANLPDETKKAFDYA
3bpsA           KGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGY--------SRVLNAACQRL
2b4fA           DPSYHIPAFYDYFANNVTNQADKNYWRQVATKSRT-----LLKNHFTKVSGS--------PHWNLPTFLS
1detA           GNNFVEC---------------------------------------------------------------
2birA           THT----GASGNNFVECT----------------------------------------------------
2e0wB           ATATQVGVDILKEGGNAVDAAVAVGYALAVT-------HP---QAGNLGGGMLIRSKNGNTTAIDFREMA


                         .         *         .         .         .         .         +:350
query           WSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAP
3cnqS           VASGVVVVAAAGNSGTSSSTVSYPAKYPSVIAVG----------------AVDSSNQRAPFSSELDVMAP
3bgoS           VASGVVVVAAAGNSGTSSSTVSYPAKYPSVIAVG----------------AVDSSNQRAPFSSELDVMAP
1cseE           YARGVVVVAAAGNSGNSTNTIGYPAKYDSVIAVGAVDSNSN-------RASFSSVGAEL------EVMAP
2b6nA           VAAGITFVVAAGNDNSNACNY-SPARAADAITVGSTTSNDSR-------SSFSNYGTCL------DIYAP
3dw3X           QSSGVMVAVAAGNNNADA-RNYSPASEPSVCTVGASDRYDR-------RSSFSNYGSVL------DIFGP
1ea7A           YSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYRVARGYISTAGDYVIQEGDIEISAP
1a1yE           YARGVVVVAAAGNSGSNTNTIGYPAKYDSVIAVGAVDSNSN-------RASFSSVGAEL------EVMAP
1aqnA           VASGVVVAGNEGTSGSSS-TVGYPAKYPSVIAVG-------AVDSSNQRASFSSVGPEL------DVMAP
1c3lA           YARGVVVVAAAGNSGSSGSTIGYPAKYDSVIAVGAVDSNSN-------RASFSSVGAEL------EVMAP
1ak9A           VASGVVVAGNEGTSGSS-STVGYPAKYPSVIAVG-------AVDSSNQRASFSSVGPEL------DVMAP
1a2qA           VASGVVVVAAAGNEGGSSSTVGYPAKYPSVIAVG-------------AVDSSNQRASFSSVGPELDVMAP
3a3pA           YNAGIVIVAASGNEGAPSPSY--PAAYPEVIAVG---------------AIDSNDNIASFSNRQPEVSAP
1c9jA           TSRGVLVVAASGNSGAGSIS--YPARYANAMAVG---------------ATDQNNNRASFSQYGLDIVAP
1av7A           YARGVVVVAAAGNSGNSTNTIGYPAKYDSVIAVGAVDSNSN-------RASFSSVGAEL------EVMAP
1c13A           TSRGVLVVAASGNSGAGSIS--YPARYANAMAVGATDQNNN-------RASFSQYGA------GLDIVAP
1duiA           VASGVVVVAAAGNEGTSSSTVGYPGKYPSVIAVG-------------AVDSSNQRASFSSVGPELDVMAP
1c9nA           TSRGVLVVAASGNSGAGS--ISYPARYANAMAVGATDQNNN-------RASFSQYGA------GLDIVAP
1bh6A           YASGIVVVAAAGNSGNSGSQIGYPAKYDSVIAVGAVD-------------SNKNRASFSSVGSELEVMAP
3ee6A           AARGLTLLFASGDSGAGCWSPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISSSYFNASGRAYPDVAAL
2e1pA           YNAGIVIVAASGNEGAPSPSY--PAAYPEVIAVGAIDSNDN-------IASFSNRQPE--------VSAP
3a3nA           YNAGIVIVAASGNEGAPSPSY--PAAYPEVIAVGAIDSNDN-------IASFSNRQPEV--------SAP
3edyA           AARGLTLLFASGDSGAGCWSPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISSSYFNASGRAYPDVAAL
1dbiA           WNKGSVVVAAAGNNSYEN-----------VIAVG-------AVDQYDRLASFSNYGTWV------DVVAP
1c9mA           TSRGVLVVAASGNSGAGS--ISYPARYANAMAVG-------ATDQNNNRASFSQYGAGL------DIVAP
3eifA           KSKGVSIVTSAGNDSSFGGKRLPLADHPDYGVVG-------TPAAADSTLTVASYSPDK------QLTET
3bpsA           ARAGVVLVTAAGN---------------------------------------------------------
2b4fA           RLDGSPVIGYIFNGQANPGAWRVIMNVGLDAHLMGAQAWHKSA-----VNKALGFLSYA------KTNNS
1detA           ----------------------------------------------------------------------
2birA           ----------------------------------------------------------------------
2e0wB           PAKATLASGTPG----------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW
3cnqS           GVSICSTLP--------------GGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKL
3bgoS           GVSICSTLP--------------GGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKL
1cseE           GAGVYSTYPTNTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
2b6nA           GSSITSSWYTSN------------SATNTISGTSMASPHVAGVAALYLDENPNLSPAQVTNLLKTRATAD
3dw3X           GTSILS--------------TWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGD
1ea7A           GSSVYSTW---------------YNGGYNTISGTMATPHVSGLAAKIWAENPSLSNTQLRSNLQERAKSI
1a1yE           GAGVYSTYPTNTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
1aqnA           GVSICSTLPGN--------------KYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1c3lA           GAGVYSTYPTNTYA--------------TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
1ak9A           GVSIQSTLP--------------GNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1a2qA           GVSI---------------QSTLPGNKYGAYSGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
3a3pA           GVDILSTYPDDSY--------------ETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKN
1c9jA           GVNVQSTYPGSTYA--------------SLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1av7A           GAGVYSTYP---------------TNTYATLNGTMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYL
1c13A           GVNVQSTYPGSTYA--------------SLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1duiA           GVSICSTLPGNK--------------YGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKL
1c9nA           GVNVQS---------------TYPGSTYASLNGTMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
1bh6A           GVSVYSTYPSNTYT--------------SLNGTSMASPHVAGAAALILSKYPTLSASQVRNRLSSTATNL
3ee6A           SDGYWVVSN--------------RVPIPWVSGTSASTPVFGGILSLINEHRILSGRPPLGFLNPRLYQQH
2e1pA           GVDILS--------------TYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKN
3a3nA           GVDILS--------------TYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKN
3edyA           SDGYWVVSN--------------RVPIPWVSGTSASTPVFGGILSLINEHRILSGRPPLGFLNPRLYQQH
1dbiA           GVDI--------------VSTITGNRYAYMSGTSMASPHVAGLAALLA--SQGRNNIEIRQAIEQTADKI
1c9mA           GV---------------NVQSTYPGSTYASLNGTMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL
3eifA           ATVK--------------TDDHQAKEMPVLSTNRFEPNKAYDYA--------------------------
3bpsA           ----------------------------------------------------------------------
2b4fA           KNCYEQVYSYGGAQ--------------NRGCAGEGQKAANAVALLASTNAG--QANEFFNEFW--SLSQ
1detA           ----------------------------------------------------------------------
2birA           ----------------------------------------------------------------------
2e0wB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KDEDPNIYGAGAVNAENSVPGQ
3cnqS           G--DSFYYGKGLINVEAAA---
3bgoS           G--DSFYYGKGLINVEAAA---
1cseE           G--SSFYYGKGLINVEAAA---
2b6nA           KVTDKTGSPNKLLFS-------
3dw3X           ----LSNIPFGTVNL-------
1ea7A           GDDYASGFGFARV---------
1a1yE           G--SSFYYGKGLINVEAAA---
1aqnA           G--DSFYYGKGLINVQAAA---
1c3lA           G--SSFYYGKGLINVEAAA---
1ak9A           G--DSFYYGKGLINVQAAA---
1a2qA           G--DSFYYGKGLINVQAAA---
3a3pA           TVRGILHITADDLGP-------
1c9jA           G--STNLYGSGLVNAEAAA---
1av7A           G--SSFYYGKGLINVEAAA---
1c13A           G--STNLYGSGLVNAEAAT---
1duiA           G--NSFYYGKGLINVQAAA---
1c9nA           G--STNLYGSGLVNAEAAA---
1bh6A           G--DSFYYGKGLINVEAAA---
3ee6A           GAGLFDVRGCHESCLDEEVEGQ
2e1pA           TVRGILHITADDLGP-------
3a3nA           TVRGILHITADDLGP-------
3edyA           GAGLFDVRGCHESCLDEEVEGQ
1dbiA           SG-TGTYFKYGRINSYNAV---
1c9mA           G--STNLYGSGLVNAEAAT---
3eifA           ----------------------
3bpsA           ----------------------
2b4fA           PTGDYRYYNGS-----------
1detA           ----------------------
2birA           ----------------------
2e0wB           ----------------------