[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB13612.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eerA.bssp"
#ERROR : Can't open dsspfile "2bjoA.bssp"
#ERROR : Can't open dsspfile "2e8eA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"

## Summary of PDB Search
:150
    6e-23  20%  3eerA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN,
    4e-20  25%  2bjoA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
    1e-18  17%  2e8eA  [x.x.x] HYPOTHETICAL PROTEIN AQ_1549
    2e-08  16%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-07  16%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
:150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
3eerA           -----YQTSATASAGRNGVVSTEDKLLELNLSYPKE-GGSGTATNPEQLFAVGYAACFSNAILHVAREAK
2bjoA           --------KVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQN
2e8eA           ------------------------------KTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKR
2d7vA           ---SEHSAIVTWKRKDSEAFTDNQYSRAHTWEVVPVPLSVEANVDPEEAFVAALSSCHLVFLSIAAKQ-R
2d7vB           ----EHSAIVTWKRKDSEAFTDNQYSRAHTWEVVPVPLSVEANVDPEEAFVAALSSCHLVFLSIAAKQ-R


                         .         .         *         .         .         .         .:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
3eerA           VALKEAPVTATVGIGPNGQGGFALSVA----LAAHIALEDEQ---ARQLVTVAHQVCPYSNAVRGNIDVQ
2bjoA           IEDSEIEGQVSLMKDESDGGFKIGVTLV---VNTK-DLDREK---AQELVNAAHEFCPYSKATRGNVDVK
2e8eA           QEVKDIKIFLKGKRREKHPKIYEEIEIK---YVAVGKVEEKALEQA--VKLSTEKYCSVLAMVKPSTNLK
2d7vA           YLVESYTDNAVGILGKNSGKTSVTKVVLRPQVVFSGTSKPTLQQL--EKHHLAHENCFIANSVETEVVTE
2d7vB           YLVESYTDNAVGILGKNSGKTSVTKVVLRPQVVFSGTSKPTLQQL--EKHHLAHENCFIANSVETEVVTE


                         +         .         .         .         .         *         .:210
query           LEASVKxxxx
3eerA           VSVNG-----
2bjoA           LE--------
2e8eA           ISWEVK----
2d7vA           I---------
2d7vB           I---------