[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB13622.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bq1F.bssp"
#ERROR : Can't open dsspfile "2bq1E.bssp"
#ERROR : Can't open dsspfile "2cvtA.bssp"
#ERROR : Can't open dsspfile "2cvuA.bssp"
#ERROR : Can't open dsspfile "2cvwA.bssp"
#ERROR : Can't open dsspfile "2cvxA.bssp"
#ERROR : Can't open dsspfile "2cvsA.bssp"
#ERROR : Can't open dsspfile "3eaaA.bssp"
#ERROR : Can't open dsspfile "2b3wA.bssp"

## Summary of PDB Search
:700
    e-163  44%  2bq1F  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-150  44%  2bq1E  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    e-147  25%  2cvtA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    e-144  25%  2cvuA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    e-142  25%  2cvwA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    e-142  25%  2cvxA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    e-115  24%  2cvsA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    3e-20  16%  3eaaA  [x.x.x] EVPC
    2e-15  15%  2b3wA  [x.x.x] HYPOTHETICAL PROTEIN YBIA
:700

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxPKWIQLNNEIMIXXXXXXXXXXXXEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
2bq1F           ------MDYHALNAMLNLYDKAGHIQFDKDQAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
2bq1E           ------MDYHALNAMLNLYDKAGHIQFDKDQAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
2cvtA           ------------------------------KQTTKQFSKVVEDLYRYVNAATGKPAPMISDDVYN-----
2cvuA           --------------------------------TTKQFSKVVEDLYRYVNAATGKPAPMISDDVYN-----
2cvwA           ------------------------------------FSKVVEDLYRYVNAATGKPAPMISDDVYN-----
2cvxA           ------------------------------KQTTKQFSKVVEDLYRYVNAATGKPAPMISDDVYN-----
2cvsA           ------------------------------KQTTKQFSKVVEDLYRYVNAATGKPAPMISDDVYN-----
3eaaA           ----------------------------------------------------------------------
2b3wA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
2bq1F           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
2bq1E           RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
2cvtA           -IVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2cvuA           -IVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQV--AERPQHLIMRVALGIHGRDIEAALET
2cvwA           -IVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQV--AERPQHLIMRVALGIHGRDIEAALET
2cvxA           -IVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
2cvsA           -IVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQ--VAERPQHLIMRVALGIHGRDIEAALET
3eaaA           ----------------------------------------------------------------------
2b3wA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
2bq1F           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
2bq1E           TDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
2cvtA           YNLMSLKYFTHASPTLFNAG-TPKPQMSSCFLVAMEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvuA           YNLMSLKYFTHASPTLFNAG-TPKPQMSSCFLVAKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvwA           YNLMSLKYFTHASPTLFNAG-TPKPQMSSCFLVAKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvxA           YNLMSLKYFTHASPTLFNAG-TPKPQMSSCFLVAMEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
2cvsA           YNLMSLKYFTHASPTLFNAG-TPKPQMSSCFLVAMEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTG
3eaaA           ---------------------------FDTYIKL--DKVDGESTDDKHKKWIEVLG----FAWGAGNECT
2b3wA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
2bq1F           APIKRIENQSSGVIPVMKMLEDAFSYA-----NQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
2bq1E           APIKRIENQSSGVIPVMKMLEDAFSY-----ANQGAGAVYLHAHHPDILRFLDTK--------RIKTLSL
2cvtA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvuA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvwA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvxA           SYIAGTNGTSNGLIPMIRVFNNTARYVDQGGKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
2cvsA           SYIAGTNGTSNGLIPMIRVFNN------TARYVDGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFP
3eaaA           ESGTQGLNTGKASVLRVTKWDCAASAAVQGQNFPTLELEICTQAG-DKFAFCIYKF--THVAVSSYQCSG
2b3wA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
2bq1F           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
2bq1E           GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
2cvtA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
2cvuA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGR--GKTIKAQKLWYSILEAQ
2cvwA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
2cvxA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
2cvsA           ALWIPDLFMKRVEENGTWTLFSPTSAPGLSDCYGDEFE--ALYTRYEKEGRGK--TIKAQKLWYSILEAQ
3eaaA           ATGGSDRPQETID-------FAYKEVTWEYVPQDQNGKAGPEGWSLITNKK-------------------
2b3wA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
2bq1F           FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
2bq1E           FESGYPYIMFEDTVNRA--NPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
2cvtA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE------YSAPDE------TAVCNLASVALPAFI
2cvuA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE------YSAPDE------TAVCNLASVALPAFI
2cvwA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE------YSAPDE------TAVCNLASVALPAFI
2cvxA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE------YSAPDE------TAVCNLASVALPAFI
2cvsA           TETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVE------YSAPDE------TAVCNLASVALPAFI
3eaaA           ----------------------------------------------------------------------
2b3wA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
2bq1F           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
2bq1E           DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
2cvtA           ETKKLHEIAKVVTRNLNRVIDRNYY-PVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvuA           ETSKLHEIAKVVTRNLNRVIDRNYY-PVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvwA           ETSKLHEIAKVVTRNLNRVIDRNYY-PVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvxA           ETSELHEIAKVVTRNLNRVIDRNYY-PVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
2cvsA           EFKKLHEIAKVVTRNLNRVIDRNYY-PVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQ
3eaaA           ----------------------------------------------------------------------
2b3wA           --------------------------------------------------VMQDTIINFYS-----TSDD


                         *         .         .         .         .         +         .:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
2bq1F           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
2bq1E           YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFSGITLPTREMWLK
2cvtA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGILQFDMWDQK----------------PYGMWDWDT
2cvuA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGILQFDMW----------------DQKPYGMWDWDT
2cvwA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGILQFDMW----------------DQKPYGMWDWDT
2cvxA           IFETIYHASMEASCELAQKDG-PYETFQGSPASQGILQFDMW----------------DQKPYGMWDWDT
2cvsA           IFETIYHASMEASCELAQKDGP-YETFQGSPASQGILQFDMWD----------------QKPYGMWDWDT
3eaaA           ----------------------------------------------------------------------
2b3wA           YGDFSNFAA--WPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSP--MVAARMGRDRSKPLRKNWES


                         .         .         .         *         .         .         .:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
2bq1F           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
2bq1E           LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
2cvtA           LRKDIMKHGVRNSLTMAPMPTASTNYLLRDLVDLGIWDEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
2cvuA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSFQVVNPYLIQGLPNVPQELKDLYKTVW
2cvwA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSFQVVNPYLIQGLPNVPQELKDLYKTVW
2cvxA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSFQVVNPYLLRGLPNVPQELKDLYKTVW
2cvsA           LRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEPVTEGMKQYLITQNGSIQGLPNVPQELKDLYKTVW
3eaaA           ----------------------------------------------------------------------
2b3wA           VKEQVMRKALRAKFE-------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDxxxxxxxxxxx
2bq1F           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQ-----------
2bq1E           DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQ-----------
2cvtA           EISQKTIINMAADRSVYIDQSHSLNLFLRAPT-MGKLTSMHFYGWKKGLKTGYYLRTQ------------
2cvuA           EISQKTIINMAADRSVYIDQSHSLNLFLRAPT-MGKLTSMHFYGWKKGLKTGYYLRTQ------------
2cvwA           EISQKTIINMAADRSVYIDQSHSLNLFLRAPT-MGKLTSMHFYGWKKGLKTGYYLRTQ------------
2cvxA           EISQKTIINMAADRSVYIDQSHSLNLFLRAPT-MGKLTSMHFYGWKKGLKTGYYLRTQ------------
2cvsA           EISQKTIINMAADRSVYIDQSHSLNLFLRAPT-MGKLTSMHFYGWKKGLKTGYYLRTQ------------
3eaaA           ----------------------------------------------------------------------
2b3wA           ----------------------------------------------------------------------