[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB14191.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dp7A.bssp"
#ERROR : Can't open dsspfile "3bkwA.bssp"
#ERROR : Can't open dsspfile "2e5wA.bssp"
#ERROR : Can't open dsspfile "2aowA.bssp"
#ERROR : Can't open dsspfile "3bgvA.bssp"
#ERROR : Can't open dsspfile "2b25B.bssp"
#ERROR : Can't open dsspfile "2b25A.bssp"
#ERROR : Can't open dsspfile "3e05B.bssp"
#ERROR : Can't open dsspfile "3bzbB.bssp"
#ERROR : Can't open dsspfile "3bxoA.bssp"
#ERROR : Can't open dsspfile "3busA.bssp"
#ERROR : Can't open dsspfile "3c3yA.bssp"
#ERROR : Can't open dsspfile "3bkwB.bssp"
#ERROR : Can't open dsspfile "3bgvC.bssp"
#ERROR : Can't open dsspfile "3bgvB.bssp"
#ERROR : Can't open dsspfile "3cggB.bssp"
#ERROR : Can't open dsspfile "3busB.bssp"
#ERROR : Can't open dsspfile "3dlcA.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "3bzbA.bssp"
#ERROR : Can't open dsspfile "3e8sA.bssp"
#ERROR : Can't open dsspfile "2e5wB.bssp"
#ERROR : Can't open dsspfile "2a14A.bssp"
#ERROR : Can't open dsspfile "3e05C.bssp"
#ERROR : Can't open dsspfile "2dulA.bssp"
#ERROR : Can't open dsspfile "3bgdA.bssp"
#ERROR : Can't open dsspfile "3c3pA.bssp"
#ERROR : Can't open dsspfile "2br5D.bssp"
#ERROR : Can't open dsspfile "3b3fA.bssp"
#ERROR : Can't open dsspfile "2e58D.bssp"
#ERROR : Can't open dsspfile "3ccfA.bssp"
#ERROR : Can't open dsspfile "3c6kA.bssp"
#ERROR : Can't open dsspfile "2an4B.bssp"
#ERROR : Can't open dsspfile "3bwbA.bssp"
#ERROR : Can't open dsspfile "3b5iA.bssp"
#ERROR : Can't open dsspfile "2an4A.bssp"
#ERROR : Can't open dsspfile "2cmgA.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "2b2cA.bssp"
#ERROR : Can't open dsspfile "3e7pA.bssp"
#ERROR : Can't open dsspfile "3b5iB.bssp"
#ERROR : Can't open dsspfile "3bkxA.bssp"
#ERROR : Can't open dsspfile "2br3F.bssp"
#ERROR : Can't open dsspfile "3dp7B.bssp"
#ERROR : Can't open dsspfile "3dtnA.bssp"
#ERROR : Can't open dsspfile "2e58B.bssp"
#ERROR : Can't open dsspfile "2an3A.bssp"
#ERROR : Can't open dsspfile "3bwbB.bssp"
#ERROR : Can't open dsspfile "2e58A.bssp"
#ERROR : Can't open dsspfile "3bwcA.bssp"
#ERROR : Can't open dsspfile "1d2gA.bssp"
#ERROR : Can't open dsspfile "3c6mC.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "2br5C.bssp"
#ERROR : Can't open dsspfile "3bwcB.bssp"
#ERROR : Can't open dsspfile "3e05H.bssp"
#ERROR : Can't open dsspfile "1bhjA.bssp"
#ERROR : Can't open dsspfile "3dtnB.bssp"
#ERROR : Can't open dsspfile "2bm8K.bssp"
#ERROR : Can't open dsspfile "3bgvD.bssp"
#ERROR : Can't open dsspfile "3e05G.bssp"
#ERROR : Can't open dsspfile "2bm9B.bssp"
#ERROR : Can't open dsspfile "2br4A.bssp"
#ERROR : Can't open dsspfile "3c6mD.bssp"
#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "2ckdA.bssp"
#ERROR : Can't open dsspfile "3d2lC.bssp"
#ERROR : Can't open dsspfile "2ejuA.bssp"
#ERROR : Can't open dsspfile "3c6mA.bssp"
#ERROR : Can't open dsspfile "2aotB.bssp"
#ERROR : Can't open dsspfile "2b9eA.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "2as0A.bssp"
#ERROR : Can't open dsspfile "3e05D.bssp"
#ERROR : Can't open dsspfile "2br5A.bssp"
#ERROR : Can't open dsspfile "1aqjB.bssp"
#ERROR : Can't open dsspfile "2aztA.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "1e50C.bssp"
#ERROR : Can't open dsspfile "2aztB.bssp"
#ERROR : Can't open dsspfile "3egiA.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "1cmvB.bssp"
#ERROR : Can't open dsspfile "3cjtC.bssp"
#ERROR : Can't open dsspfile "2br4F.bssp"
#ERROR : Can't open dsspfile "3e05A.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "2bh2A.bssp"
#ERROR : Can't open dsspfile "1aqiA.bssp"
#ERROR : Can't open dsspfile "3cggA.bssp"
#ERROR : Can't open dsspfile "2br3B.bssp"
#ERROR : Can't open dsspfile "3dr5A.bssp"
#ERROR : Can't open dsspfile "2admA.bssp"
#ERROR : Can't open dsspfile "2cl5B.bssp"
#ERROR : Can't open dsspfile "2b78A.bssp"
#ERROR : Can't open dsspfile "2aouB.bssp"
#ERROR : Can't open dsspfile "2b3tA.bssp"
#ERROR : Can't open dsspfile "3e23A.bssp"
#ERROR : Can't open dsspfile "2avnA.bssp"
#ERROR : Can't open dsspfile "2avdA.bssp"
#ERROR : Can't open dsspfile "3b3gA.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "2dpmA.bssp"
#ERROR : Can't open dsspfile "2br3D.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "3egeA.bssp"
#ERROR : Can't open dsspfile "2bt8A.bssp"
#ERROR : Can't open dsspfile "3a17D.bssp"
#ERROR : Can't open dsspfile "3ckkA.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "3bwyA.bssp"
#ERROR : Can't open dsspfile "2bzgA.bssp"
#ERROR : Can't open dsspfile "3cvoA.bssp"
#ERROR : Can't open dsspfile "3duwA.bssp"
#ERROR : Can't open dsspfile "2bm8A.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "2bm8B.bssp"
#ERROR : Can't open dsspfile "2cwwA.bssp"
#ERROR : Can't open dsspfile "2br3A.bssp"
#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "1admA.bssp"
#ERROR : Can't open dsspfile "3dh0A.bssp"
#ERROR : Can't open dsspfile "3b89A.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "3cc8A.bssp"
#ERROR : Can't open dsspfile "1cmoA.bssp"
#ERROR : Can't open dsspfile "3bt7A.bssp"
#ERROR : Can't open dsspfile "3bwmA.bssp"
#ERROR : Can't open dsspfile "3cjrA.bssp"
#ERROR : Can't open dsspfile "3egiD.bssp"
#ERROR : Can't open dsspfile "3d2lA.bssp"
#ERROR : Can't open dsspfile "3cjqD.bssp"
#ERROR : Can't open dsspfile "2bm8G.bssp"
#ERROR : Can't open dsspfile "3dh0B.bssp"
#ERROR : Can't open dsspfile "1d2hA.bssp"
#ERROR : Can't open dsspfile "2bh2B.bssp"
#ERROR : Can't open dsspfile "2ckdB.bssp"
#ERROR : Can't open dsspfile "2cwwB.bssp"
#ERROR : Can't open dsspfile "3dxxA.bssp"
#ERROR : Can't open dsspfile "2aotA.bssp"
#ERROR : Can't open dsspfile "2br5F.bssp"
#ERROR : Can't open dsspfile "3cc2M.bssp"
#ERROR : Can't open dsspfile "3a27A.bssp"
#ERROR : Can't open dsspfile "3dxyA.bssp"
#ERROR : Can't open dsspfile "3dmfA.bssp"
#ERROR : Can't open dsspfile "1af7A.bssp"
#ERROR : Can't open dsspfile "1aqjA.bssp"
#ERROR : Can't open dsspfile "1e50E.bssp"
#ERROR : Can't open dsspfile "3e05E.bssp"
#ERROR : Can't open dsspfile "1eaoA.bssp"
#ERROR : Can't open dsspfile "3ccfB.bssp"
#ERROR : Can't open dsspfile "3dxzA.bssp"
#ERROR : Can't open dsspfile "3eeyG.bssp"
#ERROR : Can't open dsspfile "1co1A.bssp"
#ERROR : Can't open dsspfile "3cjtA.bssp"
#ERROR : Can't open dsspfile "3a15B.bssp"
#ERROR : Can't open dsspfile "3eeyC.bssp"
#ERROR : Can't open dsspfile "3dliA.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "1e50Q.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "3c0kA.bssp"
#ERROR : Can't open dsspfile "3eeyF.bssp"
#ERROR : Can't open dsspfile "3a17B.bssp"
#ERROR : Can't open dsspfile "3cjqA.bssp"
#ERROR : Can't open dsspfile "3e05F.bssp"
#ERROR : Can't open dsspfile "1e50A.bssp"
#ERROR : Can't open dsspfile "3cjqG.bssp"
#ERROR : Can't open dsspfile "2d16B.bssp"
#ERROR : Can't open dsspfile "1bc5A.bssp"
#ERROR : Can't open dsspfile "2ar0B.bssp"
#ERROR : Can't open dsspfile "2br5E.bssp"
#ERROR : Can't open dsspfile "3cjtG.bssp"
#ERROR : Can't open dsspfile "2ekmA.bssp"
#ERROR : Can't open dsspfile "1booA.bssp"
#ERROR : Can't open dsspfile "3douA.bssp"
#ERROR : Can't open dsspfile "2d16A.bssp"
#ERROR : Can't open dsspfile "1eanA.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "3c6kC.bssp"
#ERROR : Can't open dsspfile "3c6kD.bssp"
#ERROR : Can't open dsspfile "2ar0A.bssp"

## Summary of PDB Search
:233
    1e-32  13%  3dp7A  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    1e-31  12%  3bkwA  [x.x.x] S-ADENOSYLMETHIONINE DEPENDENT METHYLTRANSFERASE
    9e-30  12%  2e5wA  [x.x.x] PROBABLE SPERMIDINE SYNTHASE
    4e-28  12%  2aowA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    1e-27  12%  3bgvA  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    1e-27  10%  2b25B  [x.x.x] HYPOTHETICAL PROTEIN
    1e-26  10%  2b25A  [x.x.x] HYPOTHETICAL PROTEIN
    1e-26  12%  3e05B  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-26   9%  3bzbB  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-26  17%  3bxoA  [x.x.x] N,N-DIMETHYLTRANSFERASE
    3e-26  16%  3busA  [x.x.x] METHYLTRANSFERASE
    4e-26  13%  3c3yA  [x.x.x] O-METHYLTRANSFERASE
    6e-26  12%  3bkwB  [x.x.x] S-ADENOSYLMETHIONINE DEPENDENT METHYLTRANSFERASE
    2e-25  12%  3bgvC  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    2e-25  10%  3bgvB  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    2e-25  13%  3cggB  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    1e-24  18%  3busB  [x.x.x] METHYLTRANSFERASE
    1e-24  15%  3dlcA  [x.x.x] PUTATIVE S-ADENOSYL-L-METHIONINE-DEPENDENT
    2e-24   9%  3c3pC  [x.x.x] METHYLTRANSFERASE
    2e-24  12%  1dusA  [c.66.1] MJ0882
    1e-23   9%  3bzbA  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-23  13%  3e8sA  [x.x.x] PUTATIVE SAM DEPENDENT METHYLTRANSFERASE
    2e-23  11%  2e5wB  [x.x.x] PROBABLE SPERMIDINE SYNTHASE
    7e-23   9%  2a14A  [x.x.x] INDOLETHYLAMINE N-METHYLTRANSFERASE
    8e-23  14%  3e05C  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    9e-23  13%  2dulA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    1e-22  12%  3bgdA  [x.x.x] THIOPURINE S-METHYLTRANSFERASE
    3e-22   8%  3c3pA  [x.x.x] METHYLTRANSFERASE
    4e-22   4%  2br5D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-22  12%  3b3fA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    6e-22  11%  2e58D  [x.x.x] MNMC2
    7e-22  16%  3ccfA  [x.x.x] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE
    8e-22  11%  3c6kA  [x.x.x] SPERMINE SYNTHASE
    1e-21  12%  2an4B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    2e-21  10%  3bwbA  [x.x.x] SPERMIDINE SYNTHASE
    2e-21  11%  3b5iA  [x.x.x] S-ADENOSYL-L-METHIONINE:SALICYLIC ACID CARBOXYL
    2e-21  12%  2an4A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    2e-21  12%  2cmgA  [x.x.x] SPERMIDINE SYNTHASE
    2e-21  10%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    2e-21  11%  2b2cA  [x.x.x] SPERMIDINE SYNTHASE
    2e-21  16%  3e7pA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    6e-21  10%  3b5iB  [x.x.x] S-ADENOSYL-L-METHIONINE:SALICYLIC ACID CARBOXYL
    2e-20  13%  3bkxA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    3e-20   6%  2br3F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-20  13%  3dp7B  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    4e-20  13%  3dtnA  [x.x.x] PUTATIVE METHYLTRANSFERASE MM_2633
    5e-20  12%  2e58B  [x.x.x] MNMC2
    5e-20  10%  2an3A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    5e-20  13%  3bwbB  [x.x.x] SPERMIDINE SYNTHASE
    6e-20   9%  2e58A  [x.x.x] MNMC2
    7e-20   9%  3bwcA  [x.x.x] SPERMIDINE SYNTHASE
    7e-20  15%  1d2gA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    9e-20  13%  3c6mC  [x.x.x] SPERMINE SYNTHASE
    9e-20  11%  3c3pB  [x.x.x] METHYLTRANSFERASE
    9e-20   7%  2br5C  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-19  12%  3bwcB  [x.x.x] SPERMIDINE SYNTHASE
    1e-19  14%  3e05H  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-19  15%  1bhjA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    1e-19  13%  3dtnB  [x.x.x] PUTATIVE METHYLTRANSFERASE MM_2633
    2e-19   6%  2bm8K  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-19  12%  3bgvD  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    3e-19  11%  3e05G  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    4e-19   6%  2bm9B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-19   6%  2br4A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-19  11%  3c6mD  [x.x.x] SPERMINE SYNTHASE
    7e-19  12%  1eizA  [c.66.1] FTSJ
    7e-19   7%  2ckdA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    8e-19  14%  3d2lC  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    9e-19  13%  2ejuA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    1e-18  11%  3c6mA  [x.x.x] SPERMINE SYNTHASE
    1e-18  11%  2aotB  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    1e-18  14%  2b9eA  [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    2e-18  11%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    4e-18  12%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    4e-18  20%  2as0A  [x.x.x] HYPOTHETICAL PROTEIN PH1915
    4e-18  12%  3e05D  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    4e-18   8%  2br5A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-18  13%  1aqjB  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    5e-18  15%  2aztA  [x.x.x] GLYCINE N-METHYLTRANSFERASE
    5e-18   9%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    6e-18  10%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    7e-18  10%  1e50C  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    7e-18  14%  2aztB  [x.x.x] GLYCINE N-METHYLTRANSFERASE
    8e-18  10%  3egiA  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    8e-18  16%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    9e-18  10%  1cmvB  [b.57.1] HUMAN CYTOMEGALOVIRUS PROTEASE
    2e-17  18%  3cjtC  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-17   6%  2br4F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-17  11%  3e05A  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-17  19%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-17  12%  2bh2A  [x.x.x] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA
    3e-17  11%  1aqiA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    4e-17  14%  3cggA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    5e-17   7%  2br3B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    5e-17  11%  3dr5A  [x.x.x] PUTATIVE O-METHYLTRANSFERASE
    6e-17  13%  2admA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    6e-17  12%  2cl5B  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    8e-17  12%  2b78A  [x.x.x] HYPOTHETICAL PROTEIN SMU.776
    8e-17  13%  2aouB  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    9e-17  14%  2b3tA  [x.x.x] PROTEIN METHYLTRANSFERASE HEMK
    1e-16  17%  3e23A  [x.x.x] UNCHARACTERIZED PROTEIN RPA2492
    1e-16  17%  2avnA  [x.x.x] UBIQUINONE/MENAQUINONE BIOSYNTHESIS
    1e-16  14%  2avdA  [x.x.x] CATECHOL-O-METHYLTRANSFERASE
    2e-16  11%  3b3gA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    2e-16   8%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-16   9%  2dpmA  [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
    2e-16   5%  2br3D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-16  11%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-16  18%  3egeA  [x.x.x] PUTATIVE METHYLTRANSFERASE FROM ANTIBIOTIC
    3e-16  10%  2bt8A  [x.x.x] SIGMA C
    3e-16  10%  3a17D  [x.x.x] ALDOXIME DEHYDRATASE
    3e-16  13%  3ckkA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    3e-16  19%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    4e-16  10%  3bwyA  [x.x.x] COMT PROTEIN
    4e-16  12%  2bzgA  [x.x.x] THIOPURINE S-METHYLTRANSFERASE
    4e-16   9%  3cvoA  [x.x.x] METHYLTRANSFERASE-LIKE PROTEIN OF UNKNOWN
    5e-16  12%  3duwA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    5e-16   7%  2bm8A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    8e-16  13%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    9e-16   6%  2bm8B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-15  14%  2cwwA  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    1e-15   7%  2br3A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-15  12%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    1e-15  11%  1admA  [x.x.x] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-15  21%  3dh0A  [x.x.x] SAM DEPENDENT METHYLTRANSFERASE
    3e-15  10%  3b89A  [x.x.x] 16S RRNA METHYLASE
    3e-15  19%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-15  16%  3cc8A  [x.x.x] PUTATIVE METHYLTRANSFERASE
    4e-15   9%  1cmoA  [b.2.5] POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
    5e-15   8%  3bt7A  [x.x.x] TRNA (URACIL-5-)-METHYLTRANSFERASE
    6e-15  13%  3bwmA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    1e-14  20%  3cjrA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-14  18%  3egiD  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    2e-14  14%  3d2lA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    2e-14  20%  3cjqD  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-14   6%  2bm8G  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-14  21%  3dh0B  [x.x.x] SAM DEPENDENT METHYLTRANSFERASE
    3e-14  14%  1d2hA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    3e-14  13%  2bh2B  [x.x.x] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA
    3e-14   8%  2ckdB  [x.x.x] PUTATIVE METHYLTRANSFERASE
    3e-14  13%  2cwwB  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    5e-14  18%  3dxxA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    6e-14  13%  2aotA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    7e-14   6%  2br5F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    7e-14  10%  3cc2M  [x.x.x] 50S RIBOSOMAL PROTEIN L15E
    9e-14  14%  3a27A  [x.x.x] UNCHARACTERIZED PROTEIN MJ1557
    1e-13  18%  3dxyA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    1e-13  13%  3dmfA  [x.x.x] PROBABLE RIBOSOMAL RNA SMALL SUBUNIT
    1e-13  10%  1af7A  [x.x.x] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
    1e-13  14%  1aqjA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-13  11%  1e50E  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    5e-13  10%  3e05E  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    6e-13  11%  1eaoA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    7e-13  16%  3ccfB  [x.x.x] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE
    7e-13  11%  3dxzA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    8e-13  20%  3eeyG  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-12  13%  1co1A  [b.2.5] CORE BINDING FACTOR ALPHA
    1e-12  20%  3cjtA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-12  10%  3a15B  [x.x.x] ALDOXIME DEHYDRATASE
    2e-12  19%  3eeyC  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-12  13%  3dliA  [x.x.x] METHYLTRANSFERASE
    2e-12  12%  1eg2A  [c.66.1] MODIFICATION METHYLASE RSRI
    4e-12   9%  1e50Q  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    5e-12  11%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    6e-12  12%  3c0kA  [x.x.x] UPF0064 PROTEIN YCCW
    8e-12  19%  3eeyF  [x.x.x] PUTATIVE RRNA METHYLASE
    9e-12   9%  3a17B  [x.x.x] ALDOXIME DEHYDRATASE
    1e-11  17%  3cjqA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-11  16%  3e05F  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-11   9%  1e50A  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    2e-11  19%  3cjqG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-11   5%  2d16B  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    3e-11  11%  1bc5A  [a.58.1 - c.66.1] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE
    4e-11   7%  2ar0B  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
    5e-11   7%  2br5E  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-10  19%  3cjtG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-10   9%  2ekmA  [x.x.x] HYPOTHETICAL PROTEIN ST1511
    2e-10   8%  1booA  [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE
    2e-10  13%  3douA  [x.x.x] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
    6e-10   6%  2d16A  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    3e-09   9%  1eanA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    1e-08  10%  1dctA  [c.66.1] PROTEIN (MODIFICATION METHYLASE HAEIII)
    3e-07  15%  3c6kC  [x.x.x] SPERMINE SYNTHASE
    8e-07  13%  3c6kD  [x.x.x] SPERMINE SYNTHASE
    2e-05  10%  2ar0A  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
3dp7A           EWPTIYEGLSQLPEQVQKSWFGFDHFYSDQ----SFGKALEIVFSHHPKRLLDIGGNTGKWATQCVQYNK
3bkwA           -------------------------------DGAAEWPALRALPEVGGLRIVDLGCGFGWFCRWAHEHGA
2e5wA           ---------TEGFGKLLAIDGTVQLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEE
2aowA           ----DHGKYVESFRRFLNHSTEHQCMQEFM-DKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQ
3bgvA           ----------------IFYLRNFNNWM----KSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRI
2b25B           --KFPGQILRSQYMLRRPALEDYVVLMKRGTAITFPKDINMIMDINPGDTVLEAGSGSGGMSLFLSKAVG
2b25A           VGKFPGQILRSQYMLRRPALEDYVVLMKRGTAITFPKDINMIMDINPGDTVLEAGSGSGGMSLFLSKAVG
3e05B           ------------YPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
3bzbB           -------RVERYQSPAGAPLQCSVQVQTTSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGA
3bxoA           ------------EVDHADVYDLFYLGRGKDYAAEASDIADLVSRTPEASSLLDVACGTGTHLEHFTKEFG
3busA           ------------GENLHFGWEDAGADVSVDDATDRLTDEIALLDVRSGDRVLDVGCGIGKPAVRLATARD
3c3yA           ---SVYPREAGFLKELREANESHPDSY-MSTSPLAGQLMSFVLKLVNAKKTIEVGVFTGYSLLLTALSIP
3bkwB           -------------------------------DGAAEWPALRALPEVGGLRIVDLGCGFGWFCRWAHEHGA
3bgvC           -------------------------IFYLRNFNNWMKSVLIGEFLEKVRQKRDITVGCGKGGDLLKWKKG
3bgvB           -----------------FYLRNFNNWM----KSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRI
3cggB           -------------PAHSENYAQRWRNLAAAGNDIYGE-ARLIDAAPRGAKILDAGCGQGRIGGYLSKQGH
3busB           -------------ENLHFGYWES-----VDDATDRLTDEIALLDVRSGDRVLDVGCGIGKPAVRLATARD
3dlcA           ------------FDKKGAKNDEISKTLFAPIYPIIAEN-IINRFGITAGTCIDIGSGPGALSIALAKQSD
3c3pC           --PIVDSRIGAYLDGLLPEADPVVAAEQIARDRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAIS
1dusA           ----DVKIVEDILRGKKLKFKTDSGVFSYGKVDKGTKILVENVVVDKDDDILDLGCGYGVIGIALADE--
3bzbA           ------------YQSPAGAPQCSVQVQTTSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGA
3e8sA           ---NPEDALLDSWHQNAQAWIDAVRHGAIESRRQVDQAILLAILGRQPERVLDLGCGEGWLLRALADRG-
2e5wB           ---------TEGFGKLLAIDGTVQLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEE
2a14A           -----PRDYLATYYSFDGSPSPEAEMLKFNLECLHK---TFGPGGLQGDTLIDIGSGPTIYQVLAACDSF
3e05C           ------------YPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
2dulA           -------------------KILIPPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFALETP
3bgdA           ----VQKNQVLTLEDWKEKWVTRHISFHQEQHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGH
3c3pA           --PIVDSRIGAYLDGLLPEADPVVAAEQIARERQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAIS
2br5D           ----------------SDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3b3fA           ---TEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGA
2e58D           --QEIADTADGSKTLIHKTYGEPYHSQTAGAIRESLSRILEKAKERKVIRILDVGFGLGYNLAVALKHLW
3ccfA           ----------------------------FVWQ--YGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQSGA
3c6kA           -EDSPYQNILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLIL--GGGDGGILCEIVKL
2an4B           ----QRFEPRAYLRNNYAPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHF
3bwbA           ----------------------------------------------------------------------
3b5iA           ---------------------MHARSMLHLLEETLENVHLNSSASPPPFTAVDLGCSSGANTVHIIDFIV
2an4A           ---EPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQ---TFATGEVSGRTLIDIGSGPTVYQLLSACSHF
2cmgA           ------------GEIAMLNRQLLFKNFLHIES--ELLAHMGGCTKKELKEVLIVDGFDLELAHQLFKYDT
2an3B           ----QRFEPRAYLRNNYAPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHF
2b2cA           ----SKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAAHPDPKRVLIIGGGDGGILREVLKHES
3e7pA           --------ILGFDVNLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVP
3b5iB           IIDFIVKHISKRFDAAGIDPPEFTAFFSDLPSNDFNTLFQLLVSNDGNRSYFVAGVPGSFYRRLFPA---
3bkxA           ------EKRLDYITDLALGPTANARTIQ-RRQTAHRLAIAEAWQVKPGEKILEIGCGQGDLSAVLADQVG
2br3F           --DRWAEAPRDLGYSDFSPYQWRGLR--MLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3dp7B           EWPTIYEGLSQLPEQVQKSWFGFDHFYS----DQSFGKALEIVFSHHPKRLLDIGGNTGKWATQCVQYNK
3dtnA           -------EIKRKFDAVSGKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLME-KY
2e58B           --QEIADTADGSKTLIHKTYGEPYHSQTAGAIRESLSRILEKAKERKVIRILDVGFGLGYNLAVALKHLW
2an3A           ----PRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQ---TFATGEVSGRTLIDIGSGPTVYQLLSACSHF
3bwbB           ----------------------------------------------------------------------
2e58A           --QEIADTADGSKTLIHKTYGEPYHSQTAGAIRESLSRILEKAKERKVIRILDVGFGLGYNLAVALKHLW
3bwcA           ----------------------------------------------------------------------
1d2gA           LGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGF
3c6mC           -EDSPYQNILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVL--ILGGGDGGILCEIVKL
3c3pB           -------RIGAYLDGLLPEADPVVAAEQIARERQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAIS
2br5C           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDPDTQAV--YHDMLWELRPRTIVELGVYNGGSLAWFRDLTG
3bwcB           ----------------------------------------------------------------------
3e05H           ----------------------------LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
1bhjA           LGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGF
3dtnB           -----------------GKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLMEKYP
2bm8K           --DRWAEAPRDLGYSDFSPYQWRGLRMLKD--PDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3bgvD           -------------------------IFYLRNFNNWMKSVLIEFLEKVRQKDITVLCGKGGDLLKWKKGRI
3e05G           ----------------------------LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
2bm9B           --DRWAEAPRDLGYSDFSPYQWRGLRMLKD--PDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
2br4A           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDPD--TQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3c6mD           -EDSPYQNILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKP
1eizA           -------------------------------WFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIG
2ckdA           ----------------------------QAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTG
3d2lC           ------------YEQFAYVYDELQD----VPYPEWVAWVLE--QVEPGKRIADIGCGTGTATLLLADHYE
2ejuA           -------EVQEGKAK-ILIPKADSPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFALETP
3c6mA           -EDSPYQNILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVL--ILGGGDGGILCEIVKL
2aotB           ------VESFRRFLNHSTEHQCMQEFMDKKLPGIIGR----IGDTKSEIKILSIGGGAGEIDLQILSKVQ
2b9eA           ----------------------------LILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLK
1dl5A           -------LSYVYEDIVLVSYDDGEEYSTSSQPSLMA-LFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVG
1dl5B           --------SYVYEDIVLVSYDDGEEYSTSSQPSLMA-LFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVG
2as0A           ----EKYRTIIQEGRAKFIVDRGQKTGFFLDQRENRL--ALEKWVQPGDRVLDVFTYTGGFAIHAAIAG-
3e05D           ----------------------------LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
2br5A           --DRWAEAPRDLGYSDFSPYQWRG--LRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
1aqjB           ----------------------------------VVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG
2aztA           -----EGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVE---
2cl5A           -----PQSVLEAIDTYCTQKEWAMNV-----GDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQ
3c6kB           -EDSPYQNILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKP
1e50C           ----------------------------------------------------------------------
2aztB           -----EGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGF
3egiA           --------GSRLFSRFDDGIKLDREGFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTG-
3egiB           --------GSRLFSRFDDGIKLDREGFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALT--
1cmvB           ---------DGLFCLGCVTSPRFLEIVR-RASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSKHVAL
3cjtC           -----------------WEGAEIPLVIEPGTGHAETTRLALARHLRPGDKVLDLGTGSGVLAIAAEK---
2br4F           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDPD--TQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3e05A           ----------------------------LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
3eeyB           ----------------------------TIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVG
2bh2A           ----SGEMPWYDSNGLRLTFSPRDFIQVNGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLAT---
1aqiA           -------------------------------PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG
3cggA           ------------NPAHSENYAQRWRNLAAAGNDIY-GEARLIDAAPRGAKILDAGCGQGRIGGYLSK---
2br3B           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDPD--TQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3dr5A           --------------------------------------------------AIAITPAAGLVGLYILNGLA
2admA           -------------------------------PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG
2cl5B           MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVIREYSPSLVLELGAYCGYSAVRMARLLQ
2b78A           ------EQFLILENGISYNVFLNDGLMTGIFLDQRQVRNELINGSAAGKTVLNLFSYTAAFSV--AAAMG
2aouB           -DHGKYVESFRRFLNHSTEHQCMQEFM----DKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQ
2b3tA           ---------------------------------------------EQPCRILDLGTGTGAIALALASERP
3e23A           -----------AFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGAGYQAEALA----
2avnA           -----KLRSWEFYDRIARAYDSYETPKWKLYHRLIGSFLEEY--LKNPCRVLDLGGGTGKWSLFLQE---
2avdA           -PPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTLARLIQAKKALDLGTFTGYSALALALALP
3b3gA           ----------------LSQQQNM--MQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGA
3dulA           ------------TLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLS
2dpmA           ------------LKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFN
2br3D           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDP--DTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDIMG
3dulB           ------------TLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLS
3egeA           ---------------------------TRVPDIRIVNAIINLLNLPKGSVIADIGAGTGGYSVALAN---
2bt8A           ----------------------------------SVADGVVSLDMDPYFCSQRVSLTSYSAEAQLMQFRG
3a17D           WMQASGELRVIAGDPAVGGRVVVRGHDNIALIRSGQD--WADAEADERSLYLDEILPTLQSGMDFLRDNG
3ckkA           ---------------------------------PEEMDWSELYPEFAQVEFADIGCGYGGLLVELSP-LF
3eeyI           ----------------------------TIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVG
3bwyA           ----NAQSVLEAIDTYCEQKEWAMNV-----GDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLS
2bzgA           -------------------VNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEKWFADRGHS
3cvoA           ---------------------------------------------------LEYGSGGSTVVAAELPGK-
3duwA           ------------TLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLS
2bm8A           -----------------LGYSDFSPYQWRGLRMLKDPDTQAVYWELRPRTIVELGVYNGGSLAWFRDLTK
3c6mB           -EDSPYQNI-----KILHSKQFGNILIAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKP
2bm8B           --DRWAEAPRDLGYSDFSPYQWRGLRMLKD--PDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
2cwwA           LPLYVRPLLGEVPERVQVQEGRVRYLVDLGAYLDQRENRLYME-RFRGERALDVFSYAGGFALHLAL---
2br3A           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDPD--TQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3cbgA           ----------------------------MQISPEQAQFLGLLISLTGAKQVLEIGVFRGYSALAMALQLP
1admA           -------------------------------PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG
3dh0A           -----------FDPSKIKKLDDPSRL-----ELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVG
3b89A           -------------------KALSLHASTKERLAELDTLYDFIFSAETPRRVLDIACGLNPLALYERGI--
3eeyA           ----------------------------TIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVG
3cc8A           ------------------------------------NPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGT
1cmoA           ----------------------------------------------------------------------
3bt7A           ----PVAGKEMIYRQVENSFTQPNAAMN-----IQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFD
3bwmA           ------QSVLEAIDTYCEQKEWAMNV-----GDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLS
3cjrA           -------------------------------------------HLRPGDKVLDLGTGSGVLAIAAEKLGG
3egiD           -----------LGSRLFSRFDDGREWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFA----
3d2lA           --------------QFAYVYDELQDVP----YPEWVAWVLE--QVEPGKRIADIGCGTGTATLLLADHYE
3cjqD           -------------------------------------------HLRPGDKVLDLGTGSGVLAIAAEKLGG
2bm8G           --DRWAEAPRDLGYSDFSPYQWRGLRMLKDPD--TQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3dh0B           ---------HKFDPSKIKKLDDPSRL-----ELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVG
1d2hA           ---------------------------------EYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGF
2bh2B           ETVSGEMPWYDSNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAA
2ckdB           --------------------EHMRS--YQAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTG
2cwwB           -----EVPERVQVQEGRVRYLVDLRAGQKTGAYLDQRENRLYMERFRGERALDVFSYAGGFALHLALGFR
3dxxA           ---------------------------------------------REAPVTLEIGFGMGASLVAMAK-DR
2aotA           -LFSDHGKYVESFRRFLNHSTEHQCMQEFM-DKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQ
2br5F           -------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTK
3cc2M           ----GDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGS
3a27A           ----KETETIHKEYGCLFKLDVAKIMWS---QGNIEERKRMAFISNENEVVVDMFAGIGYFTIPLAKYSK
3dxyA           ---------------------------------------------REAPVTLEIGFGMGASLVAMAKDRP
3dmfA           ------------------------------------------PEGVRGRQVLDLGAGYGALTLPLARMGA
1af7A           -------------NQNSAEWQAFINALTTNLTAFFREAHHHARRRHGEYRVWSAAASTGEEPYSIAITLA
1aqjA           -------------------------------PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG
1e50E           ----------------------------------------------------------------------
3e05E           ----------------------------LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP
1eaoA           ----------------------------------------------------------------------
3ccfB           -------------------------------VWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQSG-
3dxzA           -------------------LENYWPVMGVEFSEDMLD--FPALFGREAPVTLEIGFGMGASLVAMAKD-R
3eeyG           ----------------------------TIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVG
1co1A           ----------------------------------------------------------------------
3cjtA           -------------------------------------------HLRPGDKVLDLGTGSGVLAIAAEKLGG
3a15B           --QASGELRVIAGDPAVGGRVVVRGHDNIALIRSGQDWAD--AEADERSLYLDEILPTLQSGMDFLRDNG
3eeyC           ----------------------------TIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVG
3dliA           -------------------YFLFEEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKE---
1eg2A           ----KGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGR
1e50Q           ----------------------------------------------------------------------
3a25A           --------------------------------------------AKPDELVVDMFAGIGHLSLPIAVYGK
3c0kA           ----LPPALLPIEEHGKLLVD-IQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALG---
3eeyF           ----------------------------TIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVG
3a17B           -----GELRVIAGDPAVGGRVVVRGHDNIALIRSGQDWAD--AEADERSLYLDEILPTLQSGMDFLR---
3cjqA           -------------------------------------------HLRPGDKVLDLGTGSGVLAIAAEKLGG
3e05F           ----------------------------LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASN-LM
1e50A           ----------------------------------------------------------------------
3cjqG           -------------------------------------------HLRPGDKVLDLGTGSGVLAIAAEK---
2d16B           -------------------------------VEVIIGQGNFSIFTVDDLARALLTAVPGIKFGIAMNEAK
1bc5A           -------EANQNSAEWQAFINALNLTAFFREAHHFPILAEHARRRHGEYRVWSAAASTGEEPYSIAITLA
2ar0B           ----------------------------YFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVK
2br5E           -----------------LGYSDFSPYQWRGLRMLKDPDTQAVYWELRPRTIVELGVYNGGSLAWFRDLTK
3cjtG           -------------------------------------------HLRPGDKVLDLGTGSGVLAIAAEK---
2ekmA           ----------------------------------VIIGQSHFIKTVEDLYETLASSSPHLKFGIAFCEAS
1booA           PPNLLQISNSESNGQYLANCKLMGIKAHPARFPAKLPEFFIRMLTEPDDLVVDIFGGSNTTGLVAERESR
3douA           ---------------------------------KLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNS---
2d16A           -------------------------------VEVIIGQGNFSIFTVDDLARALLTAVPGIKFGIAMN-EA
1eanA           ----------------------------------------------------------------------
1dctA           -------------------------------------------------NLISLFSGAGGLDLGFQKAGF
3c6kC           --------------------------------------MGSGKEDYTGKDVLIL--GGGDGGILCEIVKL
3c6kD           -EDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGKEDYTGKDVLIL--GGGDGGILCEIVKL
2ar0A           ----------------------------YFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVK


                         .         .         *         .         .         .         .:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
3dp7A           EVEV--TIVDLPQQLEMMRKQTAGLSGSEHGHGANLLDRDVPFPTGFDAVWMSQFLDCFSEVISILTRVA
3bkwA           SYV---LGLDLSEKLARARAAGPD---TGITYERADLDKLHLPQDSFDLAYSSLALHYVEDVARLFRTVH
2e5wA           KVIEISYIGIDGGILEKMLSDKHEKGKLIIGDGVKFIEENSGFDVIIVDSTDPVGPAEMLFSEEFYKNAY
2aowA           --AQYPGVCINNEVVEPSAEQIAKYKELVAKISNQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFH
3bgvA           --NKLVCTDIADVSVKQCQQRYEDMKNRRDSSKELLIDKFRDPQMCFDICSCQFVCHSYEQADMMLRNAC
2b25B           SQGRVISFEVRKDHHDLAKKNYKHWRDSKLSHVEEWPDNVDFIHKDISGATFDAVALDMLNPHVTLPVFY
2b25A           SQGRVISFEVRKDHHDLAKKNYKHWRDSWLSHVEEWPDNVDFIHKDISGATFDAVALDMLNPHVTLPVFY
3e05B           NGRIF-ALERNPQYLGFIRDNLKKFV---ARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVD
3bzbB           DQVV--ATDYPDPEILNSLESASPKVVPYRWGDSPDSLQRCTGLQRFQVVLLADLLSFHQAHDALLRSVK
3bxoA           D---TAGLELSEDMLTHARKRLPDATLHQGD--MRDFRLGRKFSAVVSMFSSVGYLKTTEELGAAVASFA
3busA           --VRVTGISISRPQVNQANARATAAGLANRVTFSYADADLPFEDASFDAVWALESLHHPDRG--RALREA
3c3yA           DDGKITAIDFDREAYEIGLPFIRKAGVEHKINFILALDNLLQGQESEGSYDFGFVDADKPNYIKYHERLM
3bkwB           SYVLG------LDLSEKLARARAAGPDTGITYERADLDKLHLPQDSFDLAYSSLALHYVEDVARLFRTVH
3bgvC           RINKLVCTDIADVSVKQCQQRYEDMKNRRDSSKELLIDKFRDPQMCFDICSCQFVCESYEQADMMLRNAC
3bgvB           --NKLVCTDIADVSVKQCQQRYEDMKNRSAEFITADSSKELLIDKFRCQFVCHYSFESYEQADMMLRNAC
3cggB           ---DVLGTDLDPILIDYAKQDFPEARWVVGD---LSVDQISETDFDLIVSAGNVGFLAEDGREPALANIH
3busB           VR--VTGISISRPQVNQANARATAAGLANRVTFSYADADLPFEDASFDAVWALESLHHPDRG--RALREA
3dlcA           F--SIRALDFSKHNEIALKNIADANLNDRIQIVQGDVHNIPIEDNYADLIVSRGSVFFWEDVATAFREIY
3c3pC           I-SSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAGQRDIDIL-----FDCDVFNGADVLERN
1dusA           --VKSTTADINRRAIKLAKENIKLNNLDYDIRVVHSDLYENVKDRKYNIITNPPIRAGKEVLHRIIEEGK
3bzbA           D-QVVATDYPDPEILNSLESNIREHTAAYRWGDSPDSLQRCTGLQRFQVVLLADLLSFHQAHDALLRSVK
3e8sA           --IEAVGVDGDRTLVDAARAAGAGEVH--LASYAQLAEAKVPVGKDYDLICANFA--LLHQDIIELLSAR
2e5wB           VEESAKYIGIDGGILEKMLSDKHEKGKLI----IGDGVKFIEENSGFDVIIVDS----MLFSEEFYKNAY
2a14A           Q--DITLSDFTDRNREELEKWLKKEPGADWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGN
3e05C           NGRIF-ALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEE---IIDAVD
2dulA           -AEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMAEFGSPMEFLDTAL
3bgdA           T---VVGVEISEIGIREFFAEQNLSYTPLAEIAGAKVFKPRANIGKFDRIWDRGALVAINDHDRYADIIL
3c3pA           ISSRV-VIDPDRDNVEHARRLHDNGLIDRVE-----LQVGDPLGIAAGQRDIDILFDCDVFNGADVLERN
2br5D           IM--GIDCQVIGIDRDLSRCQIPASDMENITLHQGDCTFEHLREMAHPLIFIDNAHANTFN--IMKWAVD
3b3fA           R---KIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNMLESYLHAK
2e58D           EVNRVEIISFEKELLKEFPILPEPYREIEFLLERVPEYEGERLSLKVLLDAFSPYKNPELWTLDFLSLIK
3ccfA           EVL---GTDNAATIEKARQNYPHL--------HFDVADARNFRVDKPLDAVFSNALHWVKEPEAAIASIH
3c6kA           KPKMVTMVEIDQMVIDGCKKYMRKLKGDCYQVLIEDCIPYAKEGREFDYVINDLTAVPISFLRLILDLSM
2an4B           --EDITMTDFLEVNRQELGRWLQEEPGAKERQLRARVKRVLPIDVHADALVSAFCLEAVSPDLAALDHIT
3bwbA           --EHCDLVDIDGEVEQSKQHFPQISRSLRATVRVGDGLAFVRQTPDNTYDVVIIDTASKLFGEAFYKDVL
3b5iA           KHFTAFFSDLPSNDFNTLFQLLPPNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLHWLSQVPESVTDRR
2an4A           E--DITMTDFLEVNRQELGRWLQEEPGAKERQLRARVKRVLPIDVHADALVSAFCLEAVSPDLRALDHIT
2cmgA           H---IDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQL-LDLDIKKYDLI---FCLQEPDIHRIDGLK
2an3B           E--DITMTDFLEVNRQELGRWLQEEPGAKERQLRARVKRVLPIDVHADALVSAFVSPDLASFQRALDHIT
2b2cA           V-EKVTMCEIDEMVIDVAKKFLPGMSCGFLDLFCGDGFEFKNHKNEFDVII---------TDSSYYELLR
3e7pA           GKITG-IDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWS-EGAIYNIGFERGLKEWR
3b5iB           RTIDFFHSAFSLHWLSQVPESVTDRRS------AAYNRGRVFIHGAGEKTTTAYKRQFQADLAEFLRARA
3bkxA           SSGHVTGIDIASPDYGAPLTLGQAWNHLVHFNTNLSDDLGPIADQHFDRVVLAHSLWYFASANALALLFK
2br3F           IMGQVIGIDRDLSRCQIPASDMENITL-HQGDCSDLTTFEHLREMAHPLIFIDDAHANTFN--IMKWAVD
3dp7B           EVE-VTIVDLPQQLEMMRKQTAGLSGSERIHGHGANLLDRDVPFPTGFDVWMSQFLDCFSEEISILTRVA
3dtnA           PEATFTLVDMSEKMLEIAKNRFRGNLKVKY---IEADYSKYDFEEKYDMVVSALSIHHLEDKKELYKRSY
2e58B           EVNRVEIISFEKELLKEFPILPEPYREIHEFLLERVPEYEGERLSLKVLLGDARKRIPELWTLDFLSLIK
2an3A           E--DITMTDFLEVNRQELGRWLQEEPGANWSMYSQHACLIEGKGECADALVLEAVSPDLASFQRALDHIT
3bwbB           --EHCDLVDIDGEVEQSKQHFPQISRSLAATVRVGDGLAFVTPDNTYDVVIIDTTDPAGLFGEAFYKDVL
2e58A           EVNRVEIISFEKELLKEFPILPEPYREIHEFLLERVPEYEGERLSLKVLLGDAPYKNPELWTLDFLSLIK
3bwcA           --EHCDLVDIDGEVEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTFGEAFYKDVL
1d2gA           SVTSV---DASDKMLKYALKERWNRRKEPAFDKWVIEEAVPAGDGFDAVICLGNSFAHLPDSKLALKNIA
3c6mC           KPKMVTMVEIDQMVIDGCKKYKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTLRLILDLSM
3c3pB           I-SSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAGQRDIDIL-----FDCDVFNGADVLERN
2br5C           IDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFE-HLREMAHPLIFIDNAHANTFNI--MKWAVD
3bwcB           --EHCDLVDIDGEVEQSKQHFPQISRSLAATVRVGDGLAFVRQTPDNTYDVV------IIDTEAFYKDVL
3e05H           N-GRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEE---IIDAVD
1bhjA           S---VTSVDASDKMLKYALKERWNRRKEPAFDKWVIDKDVPAGDGFDAVICLGNSFAHLPDHRLALKNIA
3dtnB           E-ATFTLVDMSEKMLEIAKNRFRGNLKVKYI-EADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSY
2bm8K           IMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVD
3bgvD           --NKLVCTDIADVSVKQCQQRYEDEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEMLRNAC
3e05G           NGRIF-ALERNPQYL---GFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVD
2bm9B           IMGIDCGIDRDLSRCQIPASDMENITL-HQGDCSDLTTFEHLREMAHPLIFIDNAHANTFN--IMKWAVD
2br4A           IMGQVIGIDRDLSRCQIPASDMENITLHQGDC-SDLTTFEHLREMAHPLIFIDDAHANTFNIM--KWAVD
3c6mD           --KMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQYAKEGREFDYVINDLTAVPISTSRLILDLSM
1eizA           GKGRIIACDLLPMDPIVGVDFLQGDFRDERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCR
2ckdA           --TTVYEIDQPKVLAYKSTTLAEHGVTPTADRRALRSAGFDPSARTAWLAEGLLMYLPATAQDGLFTEIG
3d2lC           VTG---VDLSEELEIAQEKAETNRHVDFWVQ--DRELELPEPVDAITILCDSLNYLQTEADVKQTFDSAA
2ejuA           -AEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTIVIHRYFHFIDLDPFGSPMEFLDTAL
3c6mA           KPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYRYAKEGREFDYVINDLTAVPISFLRLILDLSM
2aotB           AQYPG-VINNEVVEPSAEQIAKYKELVAKTSNLEQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFH
2b9eA           NQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAHEVHYILLDPSCSGVRLHALAGFQQRALCHA
1dl5A           EKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYYGVPEFSPYDVIFV------TVGVDEVPETWF
1dl5B           EKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPE------TWF
2as0A           -ADEVIGIDKSPRAIETAKENAKLNGVEDRKGSAFEEEKLQKKGEKFDIVVLDPLKAGLRAYFNVNFAGL
3e05D           N---GRIFALERNPQYLGFIRDNLKKF-VARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVD
2br5A           IMGQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFE-HLREMAHPLIFIDNAHANTFNI--MKWAVD
1aqjB           TGYRFVGVEIDPKALDLPPWAEGILADFDLILGNPPYGIVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAV
2aztA           EGFSVTSVDASDKMLKYALKERWFDKWVIEEANWMTLDKDVPQEGGFDAVICLGCKGDQSEHRLALKNIA
2cl5A           PGARLLTMEMNPDYAAITQQMLNFATILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKC
3c6kB           --KMVTMVEIDQMVIDGCKKYMRKLKGDCYQVLIEDCIPVAKEGREFDYVINDLTAVPISTLRLILDLSM
1e50C           --------------------------------VLADHPGELVRTDSPNFLCSVLPTHWRCTLPIAFKVVA
2aztB           S---VTSVDASDKMLKYALKERWNRRHEPAFDKWVILDKDVPQEGGFDAVICLGNSFAHLPDCLALKNIA
3egiA           ---RVIAIDIDPVKIALARNNAEVYGIADIEFICGDFLLLASFLKADVVFLSPPWATAETFDIRTSPDGF
3egiB           --GRVIAIDIDPVKIALARNNAEVGIADKIEFICGDFLLLASFLKADVVFKITNNIVYFLPRNADIDQVA
1cmvB           CSVRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRGDPFRSDSYGLLGNSVDALYIR------ERL
3cjtC           LGGKALGVDIDPMVLPQAEANAKRNGVRPRFLEGSLEAALPFGPFDLLVA-----NLYAELHAALAPRYR
2br4F           IMGIDC--QVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHTFNIMKWAVD
3e05A           N---GRIFALERNPQYLGFIRDNLKKF-VARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVD
3eeyB           ENGRVFGFDIQDKAIANTTKKLTDLNLIRVTLIKDGHQNMDYIDCPVKAVMFNLGYSISTRPETTIQALS
2bh2A           QAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLDPARAGAAGVMQQII
1aqiA           TGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDNPPYGIVKAVKDLYKKAFSTWKLYGAFLEKAV
3cggA           QGHDVLGTDLDPILIDYAKQDFPEARWVVGDLSVDQISETDFDLIVSAGNVGFL---AEDGREPALANIH
2br3B           IMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLFEHLREMAHPLIFIDDAHANTFN--IMKWAVD
3dr5A           DNTTLTCIDPESEHQRQAKALFREAGYSPSRVRFRPLDVSRLANDSYQLVFGQVSPDLKALVDAAWPLLR
2admA           TGYRFVGVEIDPKALDLPPWAEGI-LADFLLWEPGEAFDLILGNPPYGIVGVFKAVKDLYKYGAFLEKAV
2cl5B           PGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGAQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKC
2b78A           GAMATTSVDLAKRSRALSLAHFEANHLDVVMDVFDYFKYARRHHLTYDIIIIDPPSFEVKDYHKLIRQGL
2aouB           AQYEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFH
2b3tA           D-CEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQ-SDWFSALAGQQFAMIVSNPPYIDEQDPHLQQGDVR
3e23A           AGFDVDATDGSPELAAEASRRLGRPVR------TLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIW
2avnA           RGFEVVLVDPSKELEVAREK------GVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIR
2avdA           ADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLDELLAAGEAGTFDVAVVDADKENCSAYY---ERCL
3b3gA           R---KIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNMLESYLHAK
3dulA           SGGRVVTLEASEKHADIARSNIERANLNDRVEVRALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWAL
2dpmA           ---VPYGRYKNPKIVDEELISAISVYINNNQLKVGDFEKAIVDVRTGDFVYFDPPYIPLFDQVRLRDAFK
2br3D           IDCQVIGIDRDLSRCQIPASDMENITL-HQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNI--MKWAVD
3dulB           SGGRVVTLEASEKHADIARSNIERANLNRVEVRTGLALDSLQQIENEKYFDFIFIDADKQNNPAYFEWAL
3egeA           QGLFVYAVEPSIVR-------QQAVVHPQVEWFTGYAENLALPDKSVDGVISILAIHHFSH-LEKSFQEQ
2bt8A           TNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVTSNVVLLTRLVPSAGFQAASFPVDVSFTRDSATSRVF
3a17D           PAV---GCYSNRFVRNIDIDGNFLDLSYNIGHWASLLERWSESHPTHLRIFTTFFRVAAGLSKLRLYHEV
3ckkA           PDTLILGLEIRVKVSDYVQDRIRALRGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDSPTLLAEYA
3eeyI           ENGRVFGFDIQDKAIANTTKKLTDLNLIRVTLIKDGHQNMKYIDCPVKAVMFNLGYLPSTRPETTIQALS
3bwyA           PGARLITIEINPDCAAITQRMVDFATLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEEC
2bzgA           VVGVEISELGIQETEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDIWDRGALVAINPGDRKCYADTF
3cvoA           ---HVTSVESDRAWARKAWLAANPPAEGDWGHPVSDAKWRSYPDYPLAVWRTEGLVDGRFRVGCALATAF
3duwA           SGGRVVTLEASEKHADIARSNIERANLNDRVEVRTLALDSLQQIENEKYEPFDFIFIDADNNPAYFEWAL
2bm8A           IMGIDCGIDRDLSRCQIPASDMENITLHQGDC-SDLTTFEHLREMAHPLIFIDNAHANTFNI--MKWAVD
3c6mB           K--MVTMVEIDQMVIDGCKKYMRKLKGDCYQVLIEDCIRYAKEGREFDYVINDLTAVPISTLRLILDLSM
2bm8B           IMGIDCQVIGIDRDLCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFN--IMKWAVD
2cwwA           GFREVVAVDSSAEALRRAEENARLNGLGNRLEKEGERFDLVVLDPPAFAKGKKDVERAYRAYKEVNLRAI
2br3A           IMGQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFE-HLREMAHPLIFIDDAHANTFN--IMKWAVD
3cbgA           PDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGPAEQLTQGKPLPEFDLIFIDADKRNYPRYYEIGL
1admA           TGYRFVGVEIDPKAL---DLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVGEAPIHVFKAVKDLYKKA
3dh0A           EKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELK
3b89A           --ASVWGCDIHQGLGDVITPFAREKDWDFTF--ALQDVLCAPPAEAGDLALIFKLLPLLERQAGSAALLQ
3eeyA           ENGRVFGFDIQDKAIANTTKKLTDLNLDRVTLIKDGHQNMKYIDCPVKAVMFNLGYLPSTRPETTIQALS
3cc8A           RVSGIEAFPEAAEQAKEKLDHVV----------LGDIETDPYEEEQFDCVIFGDVLEHLFDPWAVIEKVK
1cmoA           --------------------------------VLADHPGELVRTDSPNFLCSVTHWRSNKTLPIAFKVVA
3bt7A           RVLAT---EIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKSPRSGLDSETE
3bwmA           PGARLITIEINPDCAAITQRMVDFAGVKDKVTDIIPQLKKKYDVDTLDMVFL-DHWKDRYLPDTLLLEEC
3cjrA           K---ALGVDIDPMVLPQAEANAKRNGVRPRFLEG--SLEAALPFGPFDLLVANLYAELHAA---LAPRYR
3egiD           LTGRVIAIDIDPVKIALARNNAEVYGIAKIEFICGDFLLLASFLKTFDIRKITNNIVYFLPRNADIDQVA
3d2lA           VTGVDLSEELEIAQ-----EKAETNRHVDFWVQDRELELPEPVDAITILCDSLNYLQTEADVKQTFDSAA
3cjqD           K---ALGVDIDPMVLPQAEANAKRNGV--RPRFLEGSLEAALPFGPFDLLVANLYAELHAA---LAPRYR
2bm8G           IMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVD
3dh0B           EKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELK
1d2hA           SVTSV---DASDKMLKYALKERWNRRKEPAFDKWVIEEADAVICLGNSFAHLPDSKGDQSEHRLALKNIA
2bh2B           S---VVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGDKVLLDPARAGAAGVMQQII
2ckdB           TTVYEIDTLAEHGVTPTADRREVPIDLRQDWPPALRSAGFDPSARTAWLAEGLLMYLPATAQDGLFTEIG
2cwwB           E---VVAVDSSAEALRRAEENARAFDLLRRLEKEGERFDLVVLDPPAFAKGKKDVERAYRAYKEVNLRAI
3dxxA           PEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVMIPDNSLRMVQLFFHNKRRIVQVPFAELVK
2aotA           AQ--YPGVCINNEVVEPSAEQIAFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFH
2br5F           IMG--IDCQVIGIDRDLSRCQIPASDMENITLHQGDC---HLREMAHPLIFIDNAHANTFNIMK--WAVD
3cc2M           KRQGVTRITRRKDIQRVAEERASRTFP-NLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNGLTGAGRRN
3a27A           PKLVYA-IEKNPTAYHYLCENIKLNKLNNVIPILADNRDVELKDVADRVIMG-----YVHKTHKFLDKTF
3dxyA           EQDFL-GIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVMIPDNSLRMVQLFFHNKRRIVQVPFAELVK
3dmfA           E---VVGVEDDLASVLSLQKGLEANALKAQALHSDVDEALTEEARFDNPPFHVGGAVILDVAQAFVNVAA
1af7A           DAWKVFASDIDTEVLEKARSGIYRLSENYVEFSSVNLLEKQYNVPPFDAIFCRNVMIYFTTQEDILRRFV
1aqjA           TGYRFVGVEIDPKALDLPPWAEGILAD-FLLWEPGEAFDLILGNPPYGIVAVKDLYKKAFSYGAFLEKAV
1e50E           ------------------------------------HPGELVRTDSPNFLCSVLPTHWRCTLPIAFKVVA
3e05E           NGRIFALERNPQYLGFIRDNLKKFVARNV----TLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVD
1eaoA           -----------------------------MVEVLADHPGELVRTDSPNFLSSPTHWRSNKTLPIAFKVVA
3ccfB           --AEVLGTDNAATI--------EKARQNYPHLHFDVADARNFRVDKPLDAVFSNALHWVKEPEAAIASIH
3dxzA           PEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDALHKMIPDNSLRMVQLFFPDPWHKAQVPFAELVK
3eeyG           ENGRVFGFDIQDKAIANTTKKLTDNLIDRVTLIKDGHQNMKYIDCPVKAVMFNLGTRPETTIQALSKAME
1co1A           --------------------------------------ELVRTD-SPNFLCSVLPTHWRKTLPIAFKVVA
3cjtA           K---ALGVDIDPMVLPQAEANAKRNGVRPRFLEGS--LEAALPFGPFDLLVANLYAELHAALA---PRYR
3a15B           P---AVGCYSNRFVRNIDIDGNFLDLSYNIGHWASLDQLWSESHPTHLRIFTTFFRVAAGLSKLRLYHEV
3eeyC           ENGRVFGFDIQDKAIANTTKKLTDLNLIRVTLIKDGHQNMKYIDCPVKAVMFNLGYSISTRPETTIQALS
3dliA           EGIESIGVDINEDM----IKFCEGKFNVVKSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCY
1eg2A           N---SICTDAAPVFKEYYQKQLTFLRS--YEIVEGAANFGAALQ--------------------------
1e50Q           -------------------------------------------TDSPNFLCSVLPTHWRKTLPIAFKVVA
3a25A           --AKVIAIEKDPYTFKFLVENIHLKVEDRMSAYNMDNRDFPG-ENIADRILMG----YVVRTHEFIPKAL
3c0kA           GCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTKFDVIVDPPKFLGACRGYKDINLAI
3eeyF           ENGRVFGFDIQDKAIANTTKKLTDLNLIRVTLIKDGHQNMKYIDCPVKAVMFNLGYSISTRPETTIQALS
3a17B           DNGPAVGCYSNRFVRNIDIDGNFLDLSYNIGHWASLDQLRWSESHPTHLRIFTTFFRVAALSKLRLYHEV
3cjqA           K---ALGVDIDPMVLPQ--AEANAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALA---PRYR
3e05F           PNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGG---SGGMLEEIIDAVD
1e50A           -----------------------------------------VRTDSPNFLCSVLPTHWRKTLPIAFKVVA
3cjqG           LGGKALGVDIDPMVLPQAEANAKRNGVRPRF--LEGSLEAALPFGPFDLLVANLYAELHA---ALAPRYR
2d16B           -PQLTRYTGNDPELEALAAKNAVKIGAGHVFVILMKNIKNHPAVAMIYGASENPFQVIVAGKAANKIETD
1bc5A           DAWKVFASDIDTEVLEKGLVRVRQELANYVEFSSVNLLEKQYNVPGPDAIFCRNVMIYFDKQEDILRRFV
2ar0B           SQRAFIGLELVPGTRRLALNCLLHDIEGNLDHGGAIRLGNTENLPKAHIVITRTFVHPTSNKQLCFQHII
2br5E           IMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVD
3cjtG           LGGKALGVDIDPMVLPQAEANAKRNGVRPRF--LEGSLEAALPFGPFDLLVANLYAELHAALA---PRYR
2ekmA           GKRLIRWDGNDEELIKLAQQTALKGAGHTFVIYIKNGIKNVEEVVRIFAATANPLQVLVAETTPLGIETE
1booA           ---KWISFEMKPEYVAASAFRFLDNNISEEKI--TDIYNRILNGESLDLNSI------------------
3douA           LARKIISIDLQEEEIAGVRFIRCDIF----KETIFDDIDRALREEGIESGIPSRDHAVSYQIGQRVEIAV
2d16A           KPQLTRYTGNDPELEALAAKNAVKIGAGHVFVILLNTIKNHPAVAMIYGASENPFQVIVAGKAANKIETD
1eanA           -----------------------------------------VRTDSPNFLSSVLPTHWRSNLPIAFKVVA
1dctA           R--IICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFIIGGPPCQSWSEGGSLRGIDDPRGKLFYEYI
3c6kC           KPKMVTMVEIDQMVIDGCKKYMRKLDNDCYQVLIEDCIPYAKEGREFDYVINDLTAVPISTLRLILDLSM
3c6kD           KPKMVTMVEIDQMVIDGCKKYMRKDVLDCYQVLIEDCIPYAKEGREFDYVINDLTAVPISTLRLILDLSM
2ar0A           IHRAFIGLELVPGTRRLALNCLLHDIEGNLDHGGAIRLGNTLGSDGENLPKAHIVATNPPFG--------


                         +         .         .         .         .         *         .:210
query           RVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEE
3dp7A           QSIGKDSKVYIMETLWDRQRYETASYCLTQI-------------SLYFTAMANGNSKMFHSDDLIRCIEN
3bkwA           QALSPGGHFVFSTEHPIYAPARPGWAIDAEGRRTWPIDRYLVEGPRKTDWLAKGVVKHRTVGTTLNALIR
2e5wA           RALNDPGIYVTQAGSVYLFTDEFLTAYRKMRKVFDKVYFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKK
2aowA           SLLGTNAKMLIIVVSGSSGWDKLWKKYGSR-------------------FPQDDLCQYITSDDLTQMLDN
3bgvA           ERLSPGGYFIGTTPNSFEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKK
2b25B           PHLKHGGVCAVYVVNITQVIELLDGIRTCELA---------LSCEKISEVIVRDWLVCLVARPVHWQPGH
2b25A           PHLKHGGVCAVYVVNITQVIELLDGIRTCELALSCE---------KISEVIVRDWLVCLVARPVHWQPGH
3e05B           RRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVE---------------------VACVNVAKTKGLTEY
3bzbB           LLALPANDPTAVALVTFTHHRPHLAERDLA-----------------FFRLVNADGALIAEPWLSPLQQV
3bxoA           EHLEPGGVVVVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVKGVRHFSDVHLITLFHQAEYEAAFTA
3busA           RVLRPGGTVAIADFVLLAPVEGAKKEAVDAFRAGGGVLSLGGIDVRQAELVVTSTVDISAQARPSLVKTA
3c3yA           KLVKVGGIVAYDNTLWGGTVAQPESEVPDFMKENREAVIELNKLLAADPRIEIVHLPL-----------G
3bkwB           QALSPGGHFVFSTEHPIYAPARPGWA--IGRRTWPIDRYLVEGPRKTDWLAKGVVKHHRTVGTTLNALIR
3bgvC           ERLSPGGYFIGTTPNSFELIRRLEASIYTVKFQKKGDYPLFGCKYDFNLEGVDVPEFLVYFPLLNEMAKK
3bgvB           ERLSPGGYFIGTTPNSFELIRRLEGNEIYTVKFQKKGDYPLFGCKYDFNLEVDVPEFLVYFPLLNEMAKK
3cggB           RALGADGRAVIGFGAGRGWVFGDFLEV--------------------AERVGLELENAFESWDLKPFVQG
3busB           RVLRPGGTVAIAD------------------FVLLAPVEGAKKEAVDAFRAGGGVLSLGGIDEYESDVRQ
3dlcA           RILKSGGKTYIGGGFGNKEL--------------RDSISAEIRKNPDWKEFNRKNISQENVERFQNVLDE
3c3pC           RCLAKNALLIAVNALRRGLREFNHHLSRRRDFFTTIV---------------------------------
1dusA           ELLKDNGEIWVVIQTKQGAKSLAKYKDVFGNVETVTIKGGY-----------------------------
3bzbA           LLALPANDPTAVALVTFTHDLAFFRLVNAD-------------------------GALIAEPWLSPLVHR
3e8sA           TLLVPGGALVIQT------------LHPWSVADGDYQDGWREESFAGFAGDWQPPWYFR-TLASWLNALD
2e5wB           RALNDPGIYVTQAGSVYLFTDEFLTAYRKMRKVFDYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKK
2a14A           PLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKLRLPSYMVGKREFSCVALEKGEVEQAVLD
3e05C           RRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKGTEYKMFESHNPVYI-----------
2dulA           RSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPLRGELCHEVGILVGVIARYAAKYDLGIDVILAYYK
3bgdA           SLLRKEFQYLVAVLSYDPTKHAGPPFYVPSAELKRLFGT------------KCSMQCLEEVDALEERHKA
3c3pA           RCLAKNALLIAVNALRRGALREFNHHLSRRRDFFTTI---------------------------------
2br5D           HLLEEGDYFIIEDMIPYAFRDVLSMDMLYANASSQLDRGVLRR---------------------------
3b3fA           KYLKPSGNMFPTIGDVHLAP--------------FTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVD
2e58D           ERIDEKGYWVSYSSS------------------LSVRKSLLTLGFKVGSSREIGRKRKGTVASLKAPVPP
3ccfA           QALKSGGRFVAEFGGKGNIKYILEALYNALETLGI------------HNPQALNPWYFPSIGEYVNILEK
3c6kA           KVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLY-------------------CPVEFSKEIVCVPSYLEL
2an4B           TLLRPGGHLLLIGALEES----WYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDD
3bwbA           RILKPDGICCNQGWLDLELIEKSRFIRETGFASVQYALHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVED
3b5iA           SAAYNRGAMFLVCLGRTSVDPTDQGGLLFGTHFQDAWDDLVREGLAEKRDGFNIPVYAPSLQDFKEVVDA
2an4A           TLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREAL----VRSGYKVRDLRTYIMPAHLQTGVDD
2cmgA           RMLKEDGVFISVAKHPLLEHVSMQNALKNMGGVFSVAMPFPLRILSNKGYIYASFKTHPLKDLMTPKIEA
2an3B           TLLRPGGHLLLIGALEES----WYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDD
2b2cA           DALKEDGILSSQGESVWLIAHLVAFNRKIFPAVTYAQSIVSTYPSGSMGYLICAKNANRDVTTPARTLTA
3e7pA           NYLKPGGYLAVSESVWFTDQRPAEI----------------------HDFWMSAYTEIDTVPNKVAQIQK
3b5iB           AEVKRGGAMFLVCLGRTSVDPTDQGGAGLLFGTHFQDAWDDGLVAAEKRDGFNIPVYAPSLQDFKEVVDA
3bkxA           NAAVCDHVDVAEW------------SQPTALDQIGHLQAAIQGLLYAIAPDVANIRTLITPDTLAQIAHD
2br3F           HLLEEGDYFIIEDYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVLRRV---------------
3dp7B           QSIGKDSKVYIMETLWDRQRYETASYCLTQIS-------------LYFTAMANGNSKMFHSDDLIRCIEN
3dtnA           SILKESGIFINADLVHGETAFIENLNKTIWRQYVENSGLTE------EEIAAGYLDKDIEMNQQLNWLKE
2e58B           ERIDEKGYWVSYSSS------------------LSVRKSLLTLGFKVGSSREIGRKRKGTVASLKAPVPP
2an3A           TLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREAL----VRSGYKVRDLRTYIMPAHLQTGVDD
3bwbB           RILKPDGICCNQGWLDLELIEKSRFIRETGFASVQYALHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVED
2e58A           ERIDEKGYWVSYSSS----LSVRKSLLTLGFKVGSSREIRKGTVASLKAPVP-----PEENEVRKLVLSP
3bwcA           RILKPDGICCNQGWLDLELIEKSRFIRETGFASVQYALHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVED
1d2gA           SMVRPGGLLVIDH----------KNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYT
3c6mC           KVLKQDGKYFTQGNCVNLTEALSLY-------------------EEQLGRLYCPVEFSKEIVCVPSYLEL
3c3pB           RCLAKNALLIAVNALRREFNHHLSRRRDFFTTIVP-----------------------------------
2br5C           HLLEEGDYFIIEDMIYRYAPQLFSEYLGAFRDVLSMDMLYANASS-------------------------
3bwcB           RILKPDGICCNQGESILELIEKSRFIRETGFASVQYALHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVED
3e05H           RRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACV-----------------NVAKTKGEYKMFESH
1bhjA           SMVRPGGLLVIDHRN----------YDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYT
3dtnB           SILKESGIFINADLVHGETAFIENLNKTIWRQYVENSGLTEEEIAAGYE--RSKLDKDIEMNQQLNWLKE
2bm8K           HLLEEGDYFIIEDMIPYWYRYAPQLF------------------SEYLGAFRDVLSMDMLYANASSQLDR
3bgvD           ERLSPGGYFIGTTPNSFELIRRLEANEIYTVKFQKKGDYPLFGCKYDFNLEVDVPEFLVYFPLLNEMAKK
3e05G           RRLKSEGVIVLNAVTLDTLTKAVEFL------------------EDHGYMVEVACVN---VAKTKGLTEY
2bm9B           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLG------------------AFRDVLSMDMLYANASSQLDR
2br4A           HLLEEGDYFIIEDYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVLRRV---------------
3c6mD           KVLKQDGKYFTQGNCVNLTEALSLY-------------------EEQLGRLYCPVEFSKEIVCVPSYLEL
1eizA           DVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKV-KVRKPDSSRARSREVYIVAT----------------
2ckdA           GLSAVGSRIAVETSPLHGDEWREQMQLRFRRVSDALGFEQ-------AVDVQELIYHDENRAVVADWLNR
3d2lC           RLLTDGGKLLFDVHSPYKETLFNGKTYATHAEVVHELTFFIEGEDGRYDRVDETHHQTYPPEQYITWLRE
2ejuA           RSAKRRGILGVTATDGAPLCGPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILAYYK
3c6mA           KVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLY-------------------CPVEFSKEIVCVPSYLEL
2aotB           SLLGTNAKMLIIVVSGSSGWDKLWKKYGSR-------------------FPQDDLCQYITSDDLTQMLDN
2b9eA           LTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFLPAWPHRGLSTFPGAEHCLRASPETTLSSGFF-V
1dl5A           TQLKEGGRVIVPILSRRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLFPFNREILLVRS
1dl5B           TQLKEGGRVIVPILSRRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLFPFNREILLVRS
2as0A           NLVKDGGILVTCS------CSQHVDLQ--FKDIIAAGAKAFLKLEPYRTQAPDHPILSKDTEYLKCLF--
3e05D           RRLKSEGVIVLNAVTLDTLTKAVEFL------------------EDHGYMVEVACVN---VAKTKGLTEY
2br5A           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGA-FRDVLSMDMLYANASSQLDR-----------------
1aqjB           RLLKPGGVLVFVVPATLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESE
2aztA           SMVRAGGLLVIDNRN----------YDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYT
2cl5A           GLLRKGTVLLADNVIVPGTPDFLAYV------------------RGSSSFECTHYSSYLEYMKVVDGLEK
3c6kB           KVLKQDGKYFTQGNCVNLTEALSLY-------------------EEQLGRLYCPVEFSKEIVCVPSYLEL
1e50C           LGDVPDGTLVTVMAGNDENYSLRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
2aztB           SMVRAGGLLVIDNRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQGLSKFRL-
3egiA           EIFRLSKKITNNIVYFLPRNADIDQVASLAGPG----GQVEIEQNFLNNKLKTITAYFG-----------
3egiB           SLAGPGGQVEIEQNFLNN----------------------------------------------------
1cmvB           PKLRYDKQLVGVTERESYV---------------------------------------------------
3cjtC           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAA--------------------------------
2br4F           HLLEEGDYFIIEDMIPYWYRYAPQEYLGAFRDVLSMDMLYANASSQLDRGVLRR----------------
3e05A           RRLKSEGVIVLNAVTLDTLTKAVEFLEDHGY------------------MVEVACVNVAKTKEYKMFESH
3eeyB           KAME------------------------------------------------------------------
2bh2A           KLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLD------MFPHTGHLESMVLF------------
1aqiA           RLLKPGGVLVFVVPATWLVLEDFAEFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESE
3cggA           RALGADGRAVIGFGAGRGWVFGDFLEV--------------------AERVGLELENAFESWDLKPFVQG
2br3B           HLLEEGDYFIIEDMIPYWYRYAPQLYLGAFRDVLSMDMLYANASSQLDRGVLRRV---------------
3dr5A           R----GGALV------------------------------------------------------------
2admA           RLLKPGGVLVFVVWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESE
2cl5B           GLLRKGTVLLADNVIVPGTPDFLAYV------------------RGSSSFECTHYSSYLEYMKVVDGLEK
2b78A           EILSENGLIIASTNAANMT--------------VSQFKKQIEKGFGKQKHTYLDLQQLPSQDESSNYLKV
2aouB           SLLGTNAKMLIIVVSGSSGWDKLWKKYGSR-------------------FPQDDLCQYITSDDLTQMLDN
2b3tA           FEPLTALVAADSGMADIVHIIEQSRNAL-----------------VSGGFLLLEHG-WQQGEAVRQAFIL
3e23A           RALKPGGLFYASYKSGEGEG-RDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELA-----
2avnA           RVLVPDGLLIA---TVDNFYTFLQQIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAF-----KPEDLDSL
2avdA           QLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLL-------------------
3b3gA           KYLKPSGNMFPTIGDVHLAP--------------FTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVD
3dulA           KLSRPGTVIIGDNVVRIRR--FYELIAAEPRVSATAL---------------------------------
2dpmA           RLSDTGAYVMLSNSSSALVEELYKDF--NIHYVEGKISEIIVTNYEK-----------------------
2br3D           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQL--------------------
3dulB           KLSRPGTVIIGDNVVREGEVIIRRFYELIAAEPRVSATALQTVGSKGYDGFIAVVK--------------
3egeA           RIIRDGTIVLLTFDIRLAQRIWLYDYFPFLWEDALRFLPLQINLLQENTKRRVEAIPFLLPHDLSDLFAA
2bt8A           TITFPTGGDG------------------------------------------------------------
3a17D           SVFDAADQLYEYINCHPGTGMLRDA---------------------------------------------
3ckkA           YVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVP---------LEDLSEDPVVGHLGTSTEEGKKVLR
3eeyI           KAME------------------------------------------------------------------
3bwyA           GLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQS------------------FLEYREVVDGLEK
2bzgA           SLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKIC------------NIRCLEKVDAFEERHKS
3cvoA           SITRPVTLLFD------DYSQRRWQHQVEEFLGAPLIGRLAAFQVEPQPIPPGSLQLIR-----------
3duwA           KLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATALQT-----VGSKGYDGFI--
2bm8A           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLG------------------AFRDVLSMDMLYANASSQLDR
3c6mB           KVLKQDGKYFTQGNC-------------------VNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLEL
2bm8B           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLS------------------MDMLYANASSQLDR
2cwwA           KLLKEGGILATASSHHMTEPLFYAMVAEAAQDAHRLLRVVEKRGQPFD---HPVLLNHPETHYLKFAV--
2br3A           HLLEEGDYFIMIPYWYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVLRRV---------------
3cbgA           NLLRRGGLMVIDNVLWHGKVTEVDPQEAQTQVLQQFNRDLAQDERVRISVI-------------------
1admA           FSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVS
3dh0A           RVAKPFAYLAIIDWKKEERDKGPPPE------------------------------EVYSEWEVGLILED
3b89A           SLNTPRAVSFPTRSEANYAAWFEGGLPAEFEIEDKKTI------GTELIYLIK-----------------
3eeyA           KAME------------------------------------------------------------------
3cc8A           PYIKQNGVILASIPNVSHISVLAPLLAGNWTYTE-------------YGLLDKTHIRFFTFNELRFLKAG
1cmoA           LGDVPDGTLVTVMAGNDENYSAELRNA--------------------TAAMKNQVARFNDLRFVGRSGRG
3bt7A           KMVQAYPRILYISCNPE-----TLCKNLETLSQTHKVERLALFDQFPYTHHMQCGVLL------------
3bwmA           GLLRKGTVLLADNVICPGAPDFLAHV------------------RGSSCFECTHYQSFLEYREVVDGLEK
3cjrA           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
3egiD           SLAGPGGQVEIEQNFLNN----------------------------------------------------
3d2lA           RLLTDGGKLLFDVHSPYKETLFNGKTYATHAEVVHELTFFIEGEDGRYDRVDETHHQTYPPEQYITWLRE
3cjqD           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
2bm8G           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLG------------------AFRDVLSMDMLYANASSQLDR
3dh0B           RVAKPFAYLAIIDWKKEERDKGPPPE------------------------------EVYSEWEVGLILED
1d2hA           SMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYT----------
2bh2B           KLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLD------MFPHTGHLESMVLF------------
2ckdB           GLSAVGSRIAVETSPLHGDEWREQMQLRFRRVSDALGFEQ-------AVDVQELIYHDENRAVVADWLNR
2cwwB           KLLKEGGILATASSHHMTEPLFYAMVAEAAQDAHRLLRVVEKRGQPFD----------------------
3dxxA           SKLQLGGVFHMATDWEP-----------YAEHMLEVM-----SSIDGYKNLSESNDYVP-----------
2aotA           SLLGTNAKMLIIVVSGSSGWDKLWKKYGSR-------------------FPQDDLCQYITSDDLTQMLDN
2br5F           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSM-DMLYANASSQLDRG------------VLRR
3cc2M           RGLSGKGKGSE-----------------------------------------------------------
3a27A           EFLKDRGVIHYHETVAERPIERLKFYAEKNGYKLIDYEVRKIKKYAPGVWHVVVDAKFE-----------
3dxyA           SKLQLGGVFHMATDWEP-----------YAEHMLEVM-----SSIDGYKNLSESNDYVP-----------
3dmfA           ARLRPGGVFFLVSNPFLKYEPLLEEKFGAFQ---------------------------------------
1af7A           PLLKPDGLLFASENFSNLVREFSLRGQTVYA---------------------------------------
1aqjA           RLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSV--------------------------------
1e50E           LGDVPDGTLVTVMAGNDENYELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
3e05E           RRLKSEGVIVLNAVTLDTLTKAVEFL------------------EDHGYMVEVACVN---VAKTKGLTEY
1eaoA           LGDVPDGTLVTVMAGNDENYSAELRNA--------------------TAAMKNQVARFNDLRFVGRSGRG
3ccfB           QALKSGGRFVAEFGGKGNIKYILEALYNALET------------LGIHNPQALNPWYFPSIGEYVNILEK
3dxzA           SKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEGHGV------------
3eeyG           LLVTGGIITVVIYYGGDTGFEEKEKVLEFLK---------------------------------------
1co1A           LGDVPDGTLVTVMAGNDENYSLRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
3cjtA           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
3a15B           SVFDAADQLYEYINCHPGTGMLR-----------------------------------------------
3eeyC           KAME------------------------------------------------------------------
3dliA           SKMKYSSYIVIESPNPTS------------------------LYSLINFYIDPTHKKPVHPETLKFILEY
1eg2A           ----------------------------------------------------------------------
1e50Q           LGDVPDGTLVTVMAGNDENYSAELRNA--------------------TAAMKNQVARFNDLRFVGRSGRG
3a25A           SIAKDGAIIHYHNTV-PEKLMPREPFETFKRITKEYGYDV------------------------------
3c0kA           QLLNEGGILLTFSCSGLTSDLFQK----------------------------------------------
3eeyF           KAME------------------------------------------------------------------
3a17B           SVFDAADQLYEYINCHPGTGMLR-----------------------------------------------
3cjqA           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
3e05F           RRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEV-----------------------------------
1e50A           LGDVPDGTLVTVMAGNDENYSAELRNA--------------------TAAMKNQVARFNDLRFVGRSGRG
3cjqG           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
2d16B           EQKKERRELVE-----------------------------------------------------------
1bc5A           PLLKPDGLLFASENFSNLVREFSLRGQTVYA---------------------------------------
2ar0B           ETLHPGGRAAVVVPDNVLFEGGKGTDIRRDLDKCHLHTLRLPTGIFYAQGVKTNVLFFTKGTVANPNQDK
2br5E           HLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSM------------------DMLYANASSQLDR
3cjtG           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
2ekmA           ADIKERKELLR-----------------------------------------------------------
1booA           ----------------------------------------------------------------------
3douA           RYLRNGGNVLLKQFQGDDFIAIWRKNFSSYKISKPSSEIYIFFGFK------------------------
2d16A           EQKKERRELVE-----------------------------------------------------------
1eanA           LGDVPDGTLVTVMAGNDENYSAELRNA--------------------TAAMKNQVARFNDLRFVGRSGRG
1dctA           RILKQKKPIFFLAENVKGMMAQRHNKAVQE----------------------------------------
3c6kC           KVLKQDGKYFT----QGNCVNLTEALSLYEEQ----LGRLYVEFSKEIVC--------------------
3c6kD           KVLKQDG-KYFTQGNCVNLTEALSLYEEQLGRLYCPVE--FSKEI-------------------------
2ar0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGLKNVKYHSFTGGVAATHIGWK
3dp7A           AGLEVEEIQDNIGLGHSILQCRL
3bkwA           SGFAIEHVEEFCPTDAQITARPE
2e5wA           LGLEYYDPDKHETLFQMPR----
2aowA           LGLKYECYDLLSTMDISDC----
3bgvA           YNMKLVYKKTFLEFYEEKIKNNE
2b25B           TAFLVK-----------------
2b25A           TAFLVKLRK--------------
3e05B           KMFESHN----------------
3bzbB           HRWRLR-----------------
3bxoA           AGLRVEYLEGGPSGRGLFV----
3busA           EAFENARSQVEPFGAEGLDRIAT
3c3yA           DGITFCRRL--------------
3bkwB           SGFAIEHVEEFCPTDAQITARPE
3bgvC           YNMKLVYKKTFLEFYEEKIKNNE
3bgvB           YNMKLVYKKTFLEFYEEKIKNNE
3cggB           SEFLVAVF---------------
3busB           AELVVTSTVDISAQARPSLVKT-
3dlcA           IGISSYEIILGDEGFWIIISKTD
3c3pC           -----------------------
1dusA           -----------------------
3bzbA           WRLR-------------------
3e8sA           AGLRLVSLQEPQHPQSAVPQSLL
2e5wB           LGLEYYDPDKHETLFQMPR----
2a14A           AGFDIEQLLHSPQSYSVTNAAN-
3e05C           -----------------------
2dulA           DHYFRAFVKLKDGARKGDETLEK
3bgdA           WGLDYLFEKLY------------
3c3pA           -----------------------
2br5D           -----------------------
3b3fA           EYFRQPVVDTFDIRILMAKSVKY
2e58D           EENEVRKLVLSPFAVPRDEKLD-
3ccfA           QGFDVTYAALFNRPTTLAEGEF-
3c6kA           WVFYTVW----------------
2an4B           VK---------------------
3bwbA           PFAKDLKYYD-------------
3b5iA           NGSFAIDK---------------
2an4A           VK---------------------
2cmgA           LTSVRYYNEDIHRAAFALPKNLQ
2an3B           VK---------------------
2b2cA           EQIKALNLRFYNSEV---HKAA-
3e7pA           AGYIPVATFILPENCWIEH----
3b5iB           NGSFAIDKLVVY-----------
3bkxA           NTWTYTAGTIVEDPTLDDAHWE-
2br3F           -----------------------
3dp7B           AGLEVEEIQDNIGLGHSILQCRL
3dtnA           AGFRDVSCIYKYYQFAV------
2e58B           EENEVRKLVLSPFAVPRDEKLDK
2an3A           VK---------------------
3bwbB           PFAKDLKYYD-------------
2e58A           FAVPRD--EKLDKEPLEILIDYL
3bwcA           PFAKDLKYYDSE-----------
1d2gA           VQVPGAGRDGA------------
3c6mC           WVFYTVKAK--------------
3c3pB           -----------------------
2br5C           -----------------------
3bwcB           PFAKDLKYYD-------------
3e05H           NPVYIITAW--------------
1bhjA           VQVPGAGRDGA------------
3dtnB           AGFRDVSCIYKYYQF-AVMFGRK
2bm8K           GVLRRV-----------------
3bgvD           YNMKLVYKKTFLEFYEEKIKNNE
3e05G           KMFESHN----------------
2bm9B           GVLRRV-----------------
2br4A           -----------------------
3c6mD           WVFYTVW----------------
1eizA           -----------------------
2ckdA           HGWRATAQSAPDEMRRVGR----
3d2lC           AGFRVCAVTGDFKSDAPTETAER
2ejuA           DHYFRAFVKLKDGARKGDETLEK
3c6mA           WVFYTVW----------------
2aotB           LGLKYECYDLLSTMDISDCFID-
2b9eA           AVIERV-----------------
1dl5A           HIFVELVDLLTRRLTEIDGTFYY
1dl5B           HIFVELVDLLTRRLTEIDGTFY-
2as0A           -----------------------
3e05D           KMFESHN----------------
2br5A           -----------------------
1aqjB           SGFTPILWAEY------------
2aztA           VGLSKFRLSYYPHCLASFTELLQ
2cl5A           AIYQG------------------
3c6kB           WVF--------------------
1e50C           IKITVDGP---------------
2aztB           -----------------------
3egiA           -----------------------
3egiB           -----------------------
1cmvB           -----------------------
3cjtC           -----------------------
2br4F           -----------------------
3e05A           NPVYIIT----------------
3eeyB           -----------------------
2bh2A           -----------------------
1aqiA           SGFTPILWAEYPHWEGEIIRFET
3cggA           SEFLVAVF---------------
2br3B           -----------------------
3dr5A           -----------------------
2admA           SGFTPILWAEYPHWEGEIIRFET
2cl5B           AIYQ-------------------
2b78A           FTIK-------------------
2aouB           LGLKYECYDLLSTMDISDCFID-
2b3tA           AGYHDVETCRDYGDNERVTLG--
3e23A           -----------------------
2avnA           EGFETVDIRGIG-----------
2avdA           -----------------------
3b3gA           EYFRQPVVDTFDIRILMAKSVK-
3dulA           -----------------------
2dpmA           -----------------------
2br3D           -----------------------
3dulB           -----------------------
3egeA           AAWRRPELY--------------
2bt8A           -----------------------
3a17D           -----------------------
3ckkA           NGGKNAIFRRIQDPV--------
3eeyI           -----------------------
3bwyA           AIYKG------------------
2bzgA           WGIDCLFEKLY------------
3cvoA           -----------------------
3duwA           -----------------------
2bm8A           GVLRRV-----------------
3c6mB           WVF--------------------
2bm8B           GVLRRV-----------------
2cwwA           -----------------------
2br3A           -----------------------
3cbgA           -----------------------
1admA           AVVIRFQKS--------------
3dh0A           AGIRVGRVVEVGKYCFGVY----
3b89A           -----------------------
3eeyA           -----------------------
3cc8A           YSISKVDRVYVDHKYEPLIEELY
1cmoA           KSFTLTITVFTNPPQVATYHRA-
3bt7A           -----------------------
3bwmA           AIYKG------------------
3cjrA           -----------------------
3egiD           -----------------------
3d2lA           AGFRVCAVT--------------
3cjqD           -----------------------
2bm8G           GVLRRV-----------------
3dh0B           AGIRVGRVVEVGKYCFGVYAMI-
1d2hA           -----------------------
2bh2B           -----------------------
2ckdB           HGWRATAQSAPDEMRRVGR----
2cwwB           -----------------------
3dxxA           -----------------------
2aotA           LGLKYEYDLLSTMDISDCFIDGN
2br5F           VA---------------------
3cc2M           -----------------------
3a27A           -----------------------
3dxyA           -----------------------
3dmfA           -----------------------
1af7A           -----------------------
1aqjA           -----------------------
1e50E           IKI--------------------
3e05E           KMFESHN----------------
1eaoA           KSFTLTIVFTNPPQVATYHRAIK
3ccfB           QGFDVTYAALFNRPTTLAEGEF-
3dxzA           -----------------------
3eeyG           -----------------------
1co1A           IKI--------------------
3cjtA           -----------------------
3a15B           -----------------------
3eeyC           -----------------------
3dliA           LGFRDVKIEFFEECEELTKLAK-
1eg2A           -----------------------
1e50Q           KSFTLTITVFTNPPQVATYHRA-
3a25A           -----------------------
3c0kA           -----------------------
3eeyF           -----------------------
3a17B           -----------------------
3cjqA           -----------------------
3e05F           -----------------------
1e50A           KSFTLTITVFTNPPQVATYHRA-
3cjqG           -----------------------
2d16B           -----------------------
1bc5A           -----------------------
2ar0B           NCTDDVW----------------
2br5E           GVLRRV-----------------
3cjtG           -----------------------
2ekmA           -----------------------
1booA           -----------------------
3douA           -----------------------
2d16A           -----------------------
1eanA           KSFTLTITVFTNPPQVAT-----
1dctA           -----------------------
3c6kC           -----------------------
3c6kD           -----------------------
2ar0A           -----------------------