[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bsub0:CAB15681.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ejtC.bssp"
#ERROR : Can't open dsspfile "1a5kC.bssp"
#ERROR : Can't open dsspfile "1e9yB.bssp"
#ERROR : Can't open dsspfile "1a5oC.bssp"
#ERROR : Can't open dsspfile "1ejsC.bssp"
#ERROR : Can't open dsspfile "1ejxC.bssp"
#ERROR : Can't open dsspfile "1ejwC.bssp"
#ERROR : Can't open dsspfile "1ejrC.bssp"
#ERROR : Can't open dsspfile "1ejuC.bssp"
#ERROR : Can't open dsspfile "1e9zB.bssp"
#ERROR : Can't open dsspfile "1a5lC.bssp"
#ERROR : Can't open dsspfile "1a5mC.bssp"
#ERROR : Can't open dsspfile "1a5nC.bssp"
#ERROR : Can't open dsspfile "3dc8B.bssp"
#ERROR : Can't open dsspfile "1dryA.bssp"
#ERROR : Can't open dsspfile "3dc8A.bssp"
#ERROR : Can't open dsspfile "3e74A.bssp"
#ERROR : Can't open dsspfile "3egjA.bssp"
#ERROR : Can't open dsspfile "1aq2A.bssp"
#ERROR : Can't open dsspfile "2bb0A.bssp"
#ERROR : Can't open dsspfile "3e74B.bssp"
#ERROR : Can't open dsspfile "3dugC.bssp"
#ERROR : Can't open dsspfile "2aqvB.bssp"
#ERROR : Can't open dsspfile "3e74C.bssp"
#ERROR : Can't open dsspfile "3be7B.bssp"
#ERROR : Can't open dsspfile "3be7C.bssp"
#ERROR : Can't open dsspfile "2aqoA.bssp"
#ERROR : Can't open dsspfile "3be7A.bssp"
#ERROR : Can't open dsspfile "3dugA.bssp"
#ERROR : Can't open dsspfile "3egjB.bssp"
#ERROR : Can't open dsspfile "2eg6B.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "2aqoB.bssp"
#ERROR : Can't open dsspfile "2aqvA.bssp"
#ERROR : Can't open dsspfile "3e0lA.bssp"
#ERROR : Can't open dsspfile "2amxB.bssp"
#ERROR : Can't open dsspfile "2a3lA.bssp"
#ERROR : Can't open dsspfile "2amxA.bssp"
#ERROR : Can't open dsspfile "3c86A.bssp"
#ERROR : Can't open dsspfile "2drhB.bssp"
#ERROR : Can't open dsspfile "3e2vA.bssp"
#ERROR : Can't open dsspfile "3e3hA.bssp"
#ERROR : Can't open dsspfile "3cjpA.bssp"
#ERROR : Can't open dsspfile "2d2gA.bssp"
#ERROR : Can't open dsspfile "1boiA.bssp"
#ERROR : Can't open dsspfile "1bf6A.bssp"
#ERROR : Can't open dsspfile "1cr5A.bssp"
#ERROR : Can't open dsspfile "3b8cA.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"

## Summary of PDB Search
:569
    e-121  61%  1ejtC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    e-120  62%  1a5kC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    e-119  58%  1e9yB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    e-119  62%  1a5oC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    e-119  61%  1ejsC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    e-118  61%  1ejxC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    e-117  61%  1ejwC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    e-115  61%  1ejrC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    e-114  61%  1ejuC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    e-114  59%  1e9zB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    e-113  60%  1a5lC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    e-110  62%  1a5mC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    e-107  61%  1a5nC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    4e-47  14%  3dc8B  [x.x.x] DIHYDROPYRIMIDINASE
    3e-45  16%  1dryA  [b.82.2] CLAVAMINATE SYNTHASE 1
    7e-45  15%  3dc8A  [x.x.x] DIHYDROPYRIMIDINASE
    4e-38  17%  3e74A  [x.x.x] ALLANTOINASE
    1e-37  13%  3egjA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-37  13%  1aq2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE
    2e-37  15%  2bb0A  [x.x.x] IMIDAZOLONEPROPIONASE
    2e-37  17%  3e74B  [x.x.x] ALLANTOINASE
    6e-37  16%  3dugC  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    1e-35  14%  2aqvB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    4e-35  18%  3e74C  [x.x.x] ALLANTOINASE
    7e-34  17%  3be7B  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    6e-33  17%  3be7C  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    9e-33  14%  2aqoA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    4e-32  15%  3be7A  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    5e-32  15%  3dugA  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    2e-31  13%  3egjB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    5e-31  11%  2eg6B  [x.x.x] DIHYDROOROTASE
    7e-31  15%  3d6nA  [x.x.x] DIHYDROOROTASE
    1e-30  17%  2aqoB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    4e-29  13%  2aqvA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    3e-26  10%  3e0lA  [x.x.x] GUANINE DEAMINASE
    5e-25  10%  2amxB  [x.x.x] ADENOSINE DEAMINASE
    7e-25  11%  2a3lA  [x.x.x] AMP DEAMINASE
    5e-23   9%  2amxA  [x.x.x] ADENOSINE DEAMINASE
    6e-23   8%  3c86A  [x.x.x] PHOSPHOTRIESTERASE
    2e-22  15%  2drhB  [x.x.x] 361AA LONG HYPOTHETICAL D-AMINOPEPTIDASE
    3e-21   9%  3e2vA  [x.x.x] 3'-5'-EXONUCLEASE
    7e-20  11%  3e3hA  [x.x.x] PARATHION HYDROLASE
    2e-13  11%  3cjpA  [x.x.x] PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY
    6e-13  10%  2d2gA  [x.x.x] PHOSPHOTRIESTERASE
    5e-08  21%  1boiA  [x.x.x] RHODANESE
    7e-06  10%  1bf6A  [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
    6e-05   7%  1cr5A  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    1e-04  26%  3b8cA  [x.x.x] ATPASE 2, PLASMA MEMBRANE-TYPE[MASQUE : MEMB(X) 205 /
    7e-04   9%  1dpmA  [c.1.9] PHOSPHOTRIESTERASE
:569

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
1ejtC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1a5kC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1e9yB           -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNN--PSKEELDLI
1a5oC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1ejsC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQG--QMLAADCVDLV
1ejxC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1ejwC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1ejrC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1ejuC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1e9zB           -KISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNN--PSKEELDLI
1a5lC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1a5mC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
1a5nC           -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM--LAADCVDLV
3dc8B           --------------------------------------------------------------------TV
1dryA           ----------------------------------------------------------------------
3dc8A           --------------------------------------------------------------------TV
3e74A           -----------------------------------------------------------------SFDLI
3egjA           -------------------------------------------------------------------MYA
1aq2A           -NVGEKGDVAVFFGLSGTGKTTLSTDPKRRLIGDDGVFNFEGGCYA-KTIKLSKEAEPEIYNAI-RRDAL
2bb0A           --------------------------------------------------------IGQLL--TMESSGP
3e74B           -----------------------------------------------------------------SFDLI
3dugC           -------------------------------------------------------------------DFL
2aqvB           -----------------------------------------------------------MIDYTAAGFTL
3e74C           -----------------------------------------------------------------SFDLI
3be7B           -------------------------------------------------------------------DFL
3be7C           -------------------------------------------------------------------DFL
2aqoA           -----------------------------------------------------------MIDYTAAGFTL
3be7A           -----------------------------------------------------------------SEDFL
3dugA           -------------------------------------------------------------------DFL
3egjB           -------------------------------------------------------------------MYA
2eg6B           ----------------------------------------------------------------------
3d6nA           -------------------------------------------------------------------KLI
2aqoB           -----------------------------------------------------------MIDYTAAGFTL
2aqvA           -----------------------------------------------------------MIDYTAAGFTL
3e0lA           -------------------------------------------------------------------AHI
2amxB           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
2amxA           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2drhB           LNRVAKRAIVGLARTGGY-AYNGSGDIAVAFSTANRIKHYEKEVIEIKALPDSVISPLFKATAE-AVEEA
3e2vA           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
3cjpA           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1boiA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
1cr5A           -------------------------------------------------------------------SYA
3b8cA           -----------------------------------------------KVLRDGKWSEQEAA------ILV
1dpmA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
1ejtC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNV--TIPIGAATEVIAAEGKIVTAGGIDTHIHW
1a5kC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1e9yB           ITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
1a5oC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNV--TIPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejsC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNV--TIPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejxC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNV--TIPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejwC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNV--TIPIGAATEVIAAEGKIVTAGGIDTHIHW
1ejrC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTI--PIGAATEVIAAEGKIVTAGGIDTHIHW
1ejuC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIP--IGAATEVIAAEGKIVTAGGIDTHIHW
1e9zB           ITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHF
1a5lC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVT--IPIGAATEVIAAEGKIVTAGGIDTHIHW
1a5mC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIP--IGAATEVIAAEGKIVTAGGIDTHIHW
1a5nC           LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIP--IGAATEVIAAEGKIVTAGGIDTHIHW
3dc8B           IKGGTIVTADLTYKADVKVEGGRIVEIGPNLSGA---------------ETLDATGCYVMPGGIDPHTHL
1dryA           ----------------------------------------------------------------------
3dc8A           IKGGTIVTADLTYKADVKVEGGRIVEIGPNLSGA---------------ETLDATGCYVMPGGIDPHTHL
3e74A           IKNGTVILENEARVVDIAVKGGKIAAIGQD---------------LGDAKEVDASGLVVSPGVDAHTHIG
3egjA           LTNCKIYTGNDLVKHAVIINGDKIEAVCPIESLP------------SEMNVVDLNGANLSPGFIDLQLNG
1aq2A           LENVTVIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLTADA-----------FGVLPPVSR
2bb0A           RAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEAD----------EIIDCSGRLVTPGLVDPHTHL
3e74B           IKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEV----------------DASGLVVSPGVDAHTHI
3dugC           IKSKGYLDIQTIIKADLLIRNGKIAEIGKINTK--------------DATVISIPDLILIPGLMDSHVHI
2aqvB           LQGAHLYAPEDRGICDVLVANGKIIAVASNIPSD----------IVPNCTVVDLSGQILCPGFIDQHVHL
3e74C           IKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVDASGL----------------VVSPGVDAHTHI
3be7B           IKSKGYLDIQTIIKADLLIRNGKIAEIGKINT--------------KDATVISIPDLILIPGLMDSHVHI
3be7C           IKSKGYLDIQTIIKADLLIRNGKIAEIGKINTK--------------DATVISIPDLILIPGLMDSHVHI
2aqoA           LQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVP----------NCTVVDLSGQILCPGFIDQHVHL
3be7A           IKSKGYLDIQTIIKADLLIRNGKIAEIGKINTK--------------DATVISIPDLILIPGLMDSHVHI
3dugA           IKSKGYLDIQTIIKADLLIRNGKIAEIGKINT--------------KDATVISIPDLILIPGLMDSHVHI
3egjB           LTNCKIYTGNDLVKHAVIINGDKIEAVCPIESL------------PSEMNVVDLNGANLSPGFIDLQLNG
2eg6B           -------------------------------------------------------QVLKIRRPDDWHLHL
3d6nA           VKNGYVIDPSQEGEFDILVENGKIKKIDKNILVP-------------EAEIIDAKGLIVCPGFIDIHVHL
2aqoB           LQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVP----------NCTVVDLSGQILCPGFIDQHVHL
2aqvA           LQGAHLYAPEDRGICDVLVANGKIIAVASNIPSD----------IVPNCTVVDLSGQILCPGFIDQHVHL
3e0lA           FRGTFVHSTWTRDHLLGVSDSGKIVFLEEASQQEKL---AKEWCFKPCEIRELSHHEFFMPGLVDTHIHA
2amxB           --------------EIKFLKKEDVQNIDLN----------------GMSKKERYEIWRRI-PKVELHCHL
2a3lA           ----------------------------------------------------------------------
2amxA           ----------GLVPRGSEIKFLKKE--------------DVQNIDLNGMSKKERYEIWRRIPKVELHCHL
3c86A           ---------------------------------------------GDLINTVRGPIPVSEAGFTLTHEHI
2drhB           IINSLL------EARTMDGRDNHVRALPKEELLRIMRRYG------------------------------
3e2vA           ---------------------------------------------------------------YDIGLNL
3e3hA           ---------------------------------------------GDRINTVRGPITISEAGFTLTHEHI
3cjpA           ----------------------------------------------------------------------
2d2gA           ---------------------------------------------GDLINTVRGPIPVSEAGFTLTHEHI
1boiA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
1cr5A           LANVAAVSPNDFPNNIIIIDNLFVFTTRHDIPPGTIGFNGNQGGWSLNQDVQAKAFDLFKYSGKQSYLGS
3b8cA           PGDIVSIKLGDIIPADARLLEGDPLKVDQSGESLPVTKHPGQEVF-SGSTCKQGEIEAVIATGVHTFF--
1dpmA           ----------------------------------------------ARINTVRGPITISEAGFTLTHEHI


                         +         .         .         .         .         *         .:210
query           ICPQQMEVXXXXXXXXXXXXXXXXXXXXXXXXCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
1ejtC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5kC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1e9yB           ISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLAD
1a5oC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejsC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejxC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejwC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejrC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1ejuC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1e9zB           ISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLAD
1a5lC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5mC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5nC           ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
3dc8B           EMPFMSSDDFESGTRAALAGGTTMVVDFALPSGQSLLEALTMWDNKSTRANCDYSFHMAITWWGEQVFNE
1dryA           ---------------------------------------LATALDTFNAEGSEDGHLLRGLPVE---ADA
3dc8A           EMPFMGTYSSDDFESGTRAALAGGTTMVVDFALPSLLEALTMWDNKSTRANCDYSFHMAITWWGEQVFNE
3e74A           YETGTRA---------AAKGGITTIEPLNQLPATVDRASIELKFDAAKGLTIDAAQLGGLVSYNIDRLHE
3egjA           CGGVMFEITAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQSLGLHLEGPYLNV
1aq2A           LTADQTQYHFLSGFTAKLAGTITEPTPTFSACFGALSLHPTQYAEVAQAYLVNTGWNGTGKRISIKDTRA
2bb0A           VFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAAEEELLQKAHFHLQRMLSYGTTTAEVKSGYGL
3e74B           SHWEGYETGTRAAAKGGITTIEPLNQLPATVDRASIELKFDAAKGKL---TIDAAQLGGLVSYNIDRLHE
3dugC           VGNDSKESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIERGVINGPTMLVSGPALG
2aqvB           IGGGG--EAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLA------KTRALNEEGISAWML
3e74C           YETGTRA---------AAKGGITTIEPLNQLPATVDRASIELKFDAAKGLTIDAAQLGGLVSYNIDRLHE
3be7B           VGNDSKG--------------EESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIER
3be7C           VGNDSKG--------------EESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIER
2aqoA           IGGGGQA--GPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGA---
3be7A           VGNDSKG--------------EESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIER
3dugA           VGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIERGVINGPT---MLVS
3egjB           CGGVMFEITAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQSLGLHLEGPDDTM
2eg6B           RDGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPATPLMTCYLTDSLDPNE--LER
3d6nA           RDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFS
2aqoB           IGGGGQA--GPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRAL-------------NEE
2aqvA           IGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLSRHPESLLAKTRALNEEGISAWMLTGAFHVPSRTITG
3e0lA           SQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDEVYTRVVRRTLKNGTTTACYFATIHTDSSLLERFVSE
2amxB           DLTFSAEFFLKWARKYNLQPNMSDDEILDHYLFTKEGKSLAEFIRKAISVSDLYRDYDFIEDLAKWAVIE
2a3lA           ----------------------------------------------------------------------
2amxA           DLTFSAEFFLKWARKYNLQPNMSDDEILDHYLFTKEGKSLAEFIRKAISVSDLYRDYDFIEDLAKWAVIE
3c86A           CGSSAGFLRAWPEFFGSRKALAEKAVRGLRHARAAGRAADVHIVAATGLWFDPPLSMRMRSVEELTQFFL
2drhB           ----------------------------------------------------------------------
3e2vA           TDPMFHGIYNGKQYHPADYVKLLERAAQRHVKTGSSIAESQSAIELVSSVKDLSPLKLYHTIGVHPCCVN
3e3hA           CGSGSRKALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHTGLWFDPPLSMRLRSVE
3cjpA           --------------------------------IDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLENDTNS
2d2gA           CGSSAGEKAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAADVHIVAATGLWFDPPLSMRMRSVE
1boiA           ----------------------------------------------------------------------
1bf6A           --------------------------------LDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQE
1cr5A           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
1dpmA           CGSGSRKALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHTGLWFDPPLSMRLRSVE


                         .         .         .         +         .         .         .:280
query           QVEAGAIGLKLHEDWGTTPSAIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAG
1ejtC           QVAAGVIGLI-QEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5kC           QVAAGVIGLEIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1e9yB           QIEAGAIGFI-HEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAG
1a5oC           QVAAGVIGLCIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejsC           QVAAGVIGLI-NEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejxC           QVAAGVIGLI-HEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejwC           QVAAGVIGLI-HEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejrC           QVAAGVIGLI-HEAWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1ejuC           QVAAGVIGLI-HEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1e9zB           QIEAGAIGFI-HEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAG
1a5lC           QVAAGVIGLCIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5mC           QVAAGVIGLAIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5nC           QVAAGVIGLAIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
3dc8B           METITFHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHVAQLQAKLLAEGNSGPEAHAYSRPAEVEGEA
1dryA           DLPTTPSSTPAPEDRSLLTMEAM-LGLVGRRLGLHTGYRELRSGTVYHDAHHLSSETSETLLEFHTEMAY
3dc8A           METITFHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHVAQLQAKLLAEGNSGPEAHAYSRPAEVEGEA
3e74A           LDEVGVVGFCFVRDV--NDWQFFKGAQKLGELGQPVLVHCDELGEEAKREGRVTAHDYVASRPVFTEVEA
3egjA           MKKGIHSVDFIRPSDDTMIDTICANSDVIAKVTLAVVSIGHTNATYSEARKSFESGITFATHLFNAMTPM
1aq2A           IIDAILNGSLDNAETFTLPMFNLAIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNF--DKYT
2bb0A           EKETELKQLRVAKKLHDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTV
3e74B           LDEVGVVGFCFVRDV--NDWQFFKGAQKLGELGQPVLVHCENLGEEAKREGRVTAHDYVASRPVFTEVEA
3dugC           ITGGHCDHNLLPPEFNYSS------EGVVDSPWEARKMVRKNRKYGADLIFCATGGVMSRNTDVNAKQFT
2aqvB           TGAFHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGD
3e74C           LDEVGVVGFCFVRDV--NDWQFFKGAQKLGELGQPVLVHCENLGEEAKREGRVTAHDYVASRPVFTEVEA
3be7B           GVINGPTMLVSGPALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIKFCATGGVMS
3be7C           GVINGPTMLVSGPALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIKFCATGGVMS
2aqoA           ---YHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGD
3be7A           GVINGPTMLVSGPALGITGGHCDHNLLPPEFNYSPWEARKMVRKNRKYGADLIKFCATGGVMSRNTDVNA
3dugA           GPALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIFCATGGVMSRNTDVNAK-QFT
3egjB           IDTICANSDVIAKVTLAPENNKPEHIEKLVKAGIVVSIGHTNATYSEARK-SFESGITFATHLFNAMTPM
2eg6B           GFNEGVFTAALYANHGVTSVAIMPVLERMEKIGMPLLVHGEVTHADIDIFDREARFIESVMEPLRQRLTA
3d6nA           LKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDAYGVINEGEVSALLGLSSRAPEAEEIQ
2aqoB           GISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLGGKPGVT
2aqvA           S---------VEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKA
3e0lA           MLQKNYSRVKPTPGNGVSETLMGELGNIAKTRDLHIQSH---ISENRDEVEAVKNLYPSYKNYTSVYDKN
2amxB           KYKEGVVLMEFRYSPTFVSSSYGLDVELIHKAFIKGIKNLLNNKIHVALICISDKHSGDFAIKHKHDFVG
2a3lA           ------------------------LRESKGMTTITLRPHSGEAGDIDHLAA-TFLTCHS-IAHGI----N
2amxA           KYKEGVVLMEFRYSPTFVSSSYGLDVELIHKAFIKGIKNATELLNNKIHVALICISDTGHAAASIKHSGD
3c86A           REIQHGIEATTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAAIFESEGLSPSRVCIGHSD
2drhB           ----------------------------------------------------------------------
3e2vA           EFAEAYNESLYAKVISNPSFAQGKLKELYDLMNQQAKPHDTSFRSIG--EIGLDYDRFHYSSKEMQKVFF
3e3hA           ELTQEDTGIRAGIIVATTGKVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSD
3cjpA           YIEENIVNNKLTPASGQIKSLKPIFKYSMDSGSLPIWIHAFNPLVLQDIKEIAELCKAFPKVPVILGHMG
2d2gA           ELTQFFTGIRAGIIKVATTGKATPFARASLATGVPVTTHTSASQRDGEQQAAIFESEGLSPSRVCIGHSD
1boiA           ----------------------------------------------------------------------
1bf6A           MVDEAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDL
1cr5A           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
1dpmA           EYGIEDTGIRAGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSD


                         .         *         .         .         .         .         +:350
query           GGHAPDIMKLASYANILPSSTTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDI
1ejtC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1a5kC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1e9yB           GGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHKDKSIKEDVQFADSRIRPQTIAAEDT
1a5oC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1ejsC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1ejxC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCVAF----------AESRIRRETIAAEDV
1ejwC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1ejrC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMAFAE-------------SRIRRETIAAEDV
1ejuC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMAFAES-------------RIRRETIAAEDV
1e9zB           GGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDT
1a5lC           GGHAPDIITACAHPNILPSSTNPTLPY------------------------------TLNTRETIAAEDV
1a5mC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1a5nC           GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMAFAESR---------------IRRETIAAEDV
3dc8B           ANRAIMIADMAGCPVYIVHTSCEQAHEAIRRARAQHLTLDETEYFDKDWDHAARRVMSRNKLHQDSLWAG
1dryA           HRLQPNYVMLACSRAD-HERTAATLVASVRKALPLLDERTRARLLDRRMPCCVDVAFRGIAQVKPADDPF
3dc8A           ANRAIMIADMAGAHEAIRRARAKGMRVFGEPLIQHLTLDETEFDKDWDHAARRVMSPPFRNKLHQDSLWA
3e74A           IRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEGQDITCCPHYFVLDTDQFEEIGTLIRDLENQKGWE
3egjA           VGREPGVVGAIYDTPEVYAGII---------ADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGA--EMD
1aq2A           DTPAGAALV-------------------------------------------------------------
2bb0A           SQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTF
3e74B           IRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEGQDITCESHYFVLDTDQFEEIGTLIRDLENQKGWE
3dugC           LEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASFIDDETIDMAIK-NNTVLSMDIFVSDY
2aqvB           SKKALQPIYDLLENCDVP---ISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAV
3e74C           IRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEEIGIRDLENQKGWE
3be7B           RNTDVNIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASFIDDETIDMA-IKNNTVLSMDIFVSDY
3be7C           RNTDVNIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASFIDDETIDMAI-KNNTVLSMDIFVSDY
2aqoA           SKKALQPIYLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDIT-----SSIDEPVAPAEGIARAV
3be7A           KQFTLEIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYI
3dugA           LEEMKAIVDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASFIDDETIDM-AIKNNTVLSMDIFVSDY
3egjB           VGREPG------VVGAIYDTPEVYAGIIADGFHVDYANIRIAHKIKGEKLVLVTDATA-----PAGAEMD
2eg6B           L---KVVFEHITTKDAADYVRDGNERLAATITPQHLMFNRNHMLVGGVRPHLYCLPILKRNIHQQALREL
3d6nA           IARDGILAQRTGGVHIQHVSTKLSLEIIEFFKEKGVKITCEVNNHLLFTEREVLNSGANAKKEDRLALIE
2aqoB           VFHMGDSKKALQPIYDLLENCDVPISKLLPTHNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAV
2aqvA           LQPIYDLLENCDVPISKLLP-------THVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEARAVQA
3e0lA           NLLTNKTV------------MAHGCYLSAEELNVFHERGASIAHCP---NSNLSLSSGFLNVL------E
2amxB           FDHGGREIDLKDHKDVYHSVRDHGLHLTVHAGEDATLPNLNTLYTAINILNVERIGHGIRVSESDELIEL
2a3lA           LRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFPVFFLRGLNVSLSTD------------------
2amxA           FAIKHKHDFVGFDHGGREIDLKDHKDVYHSVRDHGLHLTVHAGEDATLPNLNTLYTAINILNESDELIEL
3c86A           DTDDLSYLTGLALVGLDRMPYSAIGLEGNASALALFGTRSWQTRALLIKALIDRGYKDRILVSHDWLFGF
2drhB           ----------------------------------------------------------------------
3e2vA           EEQLKISCLNDKLSSYACDDFVQILERFVVGFTDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAID
3e3hA           DTDDLSYLTALAARG---------YLIGLDRIPFSAIGLEDNASASALLGIRSWQTRALLIKALIDQGYM
3cjpA           GSNWMTAVELAKIQNLYLDTSAYFSTFVLKIVINEPLKCIFGTDMPFGDLQLSAIKKMSNDSYVANA--V
2d2gA           DTDDLSYLTGLAARGYLV-GLDRMPYSAIGLEGNASALALFGTRSWQTRALLIKALIDRGYKDRILVSDW
1boiA           ----------------------------------------------------------------------
1bf6A           KDNLDNILKMIDLGAYVQFDTIGKNSYPDEKRIAMLHALRDRGLLN------------------------
1cr5A           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
1dpmA           DTDDLSYLTALAARG-YLIGLDHIPHSAIGLEDNASASALLGIRSWQTRALLIKA---------------


                         .         .         .         .         *         .         .:420
query           LHDIGAISMTSSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
1ejtC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1a5kC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1e9yB           LHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGNDNFRIKRYLSKYTINPAIAHGIS
1a5oC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejsC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejxC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejwC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEEGDNDNFRVKRYIAKYTINPALTHGIA
1ejrC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1ejuC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDDNFRVKRYIAKYTINPALTHGIA
1e9zB           LHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGNDNFRIKRYLSKYTINPAIAHGIS
1a5lC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNNFRVKRYIAKYTINPALTHGIA
1a5mC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
1a5nC           LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGNDNFRVKRYIAKYTINPALTHGIA
3dc8B           LASGSLQVVATDHTTEQKRFGVGDFTRIPNGTGGLEDRMPMLWTYGTGRITMNEFVAVTSTNIAKILNIY
1dryA           LGYDRELLEDPADKEAVAALSKA---LDEVTEAVYLEPGDLL---IVDNFRTTHARTPFSPRWDGKDRWL
3dc8A           GLASGSLQVVATDTTEQKRFGVGDFTRIPNGTGGLEDRMPMLWTYGTGRITMNEFVAVTSTNIAKILNIY
3e74A           KLFNGEIDCLVSDHSPCPPEKAGNIKAWGGIAGLQSCDVFD----EAVQKRGSLPFGKLATNAADIFGLQ
3egjA           YFIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEH-------VGIALDEALRMATLYPAKAIGVD
1aq2A           ----------------------------------------------------------------------
2bb0A           YLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALH-LKMTAEEIWHAVTVNAAYAIGKG
3e74B           KLFNGEIDCLVSDHSPCPPEKAGNIKAWGGIAGLQSCDVFDE----AVQKRGSLPFGKLATNAADIFGL-
3dugC           ILGEGAKAGIREESLNKERLVGKKQRENFMNAHRRGAIITFGTDAGIFDMTPLEAIQASTIKTATLFGI-
2aqvB           QAGIPLARVTLSSDGNGSVAG--FETLLETVQVLVKDYD----------FSISDALRPLTSSVAGFLNLT
3e74C           KLFNGEIDCLVSDHSPCPPEKAGNIKAWGGIAGLQSCDVFD----EAVQKRGSLPFGKLATNAADIFGL-
3be7B           ILGEGAKAGIREESLNKERVGKKQRENFMNAHRRGAIITFGTDAGIFDHMTPLEAIQASTIKTATLFGI-
3be7C           ILGEGAKAGIREESLNKERLGKKQRENFMNAHRRGAIITFGTDAGIFDHMTPLEAIQASTIKTATLFGI-
2aqoA           QAGIPLARVTLSSDGNGSQIGVAGFETLLETVQVLVKDYDF---------SISDALRPLTSSVAGFLNLT
3be7A           LGEGAKAGIREESLNKERLVGKKQRENFMNAHRRGAIITFGTDAGIEWGMTPLEAIQASTIKTATLFGI-
3dugA           ILGEGAKAGIREESLNKERLVGKKQRENFMNAHRRGAIITFGTDAGEWGMTPLEAIQASTIKTATLFGI-
3egjB           YFIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVE-------HVGIALDEALRMATLYPAKAIGVD
2eg6B           VASGFNRVFLGTDS-APHARHRKESSCGCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLP
3d6nA           GVKRGIIDCFATDHAPHQTFEKELVEFAMPGIIGLQTALPSALEYRKGIISLKKLIEMFTINPARIIG--
2aqoB           QAGIPLARVTLSSDGNGSVAGF--ETLLETVQVLVKDYD----------FSISDALRPLTSSVAGFLNL-
2aqvA           GIPLARVTLSSDGNGGVAGFETLLETVQVLVKDY--------------DFSISDALRPLTSSVAGFLNLT
3e0lA           VLKHEVKIGLGTDVAGG-----YSYSMLDAIRRAVMVSNILLINKVEKSLTLKEVFRLATLGGSQALGLD
2amxB           VKKKDILLEVCPIS--NLLLNNVKSMDTHPIRKLYDAGVKVSVNSDDPGMFTLEEFMIMNNWAFEKSFVS
2a3lA           --DPLQIHLTKEPLVEEYSIAASVWKLSACDLCE------------------------IARNSVYQSGFS
2amxA           VKKKDILLEVCPIS--NLLLNNVKSMDTHPIRKLYDAGVKVSVNSDDPGMFLLEEFMIMNNWAFEKSFVS
3c86A           SSYVTNIMDVMDRINPDG------MAFVPLRVIPFLREK---------GVPPETLAGVTVANPARFLSPT
2drhB           ----------------------------------------------------------------------
3e2vA           LQNLSPNIFIGVNGCSLR-----TEENLAVVKQIPTERLLLETDAPWEIKRTHASFQYLAKYQEVRDFEY
3e3hA           KQILVSNDWLFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLR--EKGVPQETLAGITVTNPARFLSPT
3cjpA           LGD-------------------------------------------------------------------
2d2gA           LFGFSSYVTNIMDVMDRINPDGMAFVPLRVIPFLREK-----------GVPPETLAGVTVANPARFLSPT
1boiA           -----------AESVRAGKVGPVLDASWYSPGTREARKRHVPGASFFDIEECRDKASPYEVMLPSEAGFA
1bf6A           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYASYGKANRSTS
1ejtC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5kC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1e9yB           EYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDAN
1a5oC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejsC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejxC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejwC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejrC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1ejuC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1e9zB           EYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDAN
1a5lC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5mC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
1a5nC           HEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCR
3dc8B           PKKGAILVGADADLVVWDPKRSKTLPRFTLTRGVVS-IEEGTVKTQEGHGEFV-RRDPFPAVSTALSTWK
1dryA           HRIRTDRNGQLSGGERADVVAFTPR---------------------------------------------
3dc8A           PKKGAILVGADADLVVWDPKRSKTLPRFTLTRGVVS-IEEGTVKTQEGHGEFV-RRDPFPAVSTALSTWK
3e74A           Q-KGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVG-----------------------------
3egjA           EKLGRIKKGMIANLTVFDRDF---NVKATVVNGQYEQ---------------------------------
1aq2A           ----------------------------------------------------------------------
2bb0A           EEAGQLKAGRSADLVIWQAPNYMYHVHQVMKNGTIVVNR-------------------------------
3e74B           QQKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVG-----------------------------
3dugC           ENIGQIKEGFDADIVGVIENPLLEEVAFVMKEGKVY----------------------------------
2aqvB           G-KGEILPGNDADLLVMTPEL---RIEQVYARGKLM----------------------------------
3e74C           QQKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVG-----------------------------
3be7B           ENIGQIKEGFDADIVGVIENPLLEEVAFVMKEGKVY----------------------------------
3be7C           ENIGQIKEGFDADIVGVIENPLLEEVAFVMKEGKVY----------------------------------
2aqoA           G-KGEILPGNDADLLVMTPEL---RIEQVYARGKLM----------------------------------
3be7A           ENIGQIKEGFDADIVGVIENPLLEEVAFVMKEGKVY----------------------------------
3dugA           ENIGQIKEGFDADIVGVIENPLLEEVAFVMKEGKVY----------------------------------
3egjB           EKLGRIKKGMIANLTVFDRDF---NVKATVVNGQYEQ---------------------------------
2eg6B           VNDTFIELVREEQQV-------------------------------------------------------
3d6nA           VDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWG-----------------------------
2aqoB           TGKGEILPGNDADLLVMTPEL---RIEQVYARGKLM----------------------------------
2aqvA           G-KGEILPGNDADLLVMTPEL---RIEQVYARGKLM----------------------------------
3e0lA           GEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI---------------------------------
2amxB           DDVKSELKALY-----------------------------------------------------------
2a3lA           HALKSHWIGKDYYKRGPDGNDIHKTNVPHIRVEFRDTIWKEEMQQVYLGKAVISDE--------------
2amxA           DDVKSELKALY-----------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
3e2vA           PAFKSVKKNKLADKLNAEE---------------------------------------------------
3e3hA           L---------------------------------------------------------------------
3cjpA           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1boiA           DYVGSLGISNDTHVVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKAT-----------
1bf6A           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDPKTYQVFADGEELSCQPVDYV
1ejtC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5kC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1e9yB           ITFVSQAAYDKGIKEELGLERQVLPVKNCRNVTKKDMQFNNTTAHIEVNPETYHVFVDGKEVTSKPANKV
1a5oC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejsC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejxC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejwC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejrC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1ejuC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1e9zB           ITFVSQAAYDKGIKEELGLERQVLPVKNCRNVTKKDMQFNNTTAHIEVNPETYHVFVDGKEVTSKPANKV
1a5lC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5mC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5nC           LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
3dc8B           EVTAPRAVQR------------------------------------------------------------
1dryA           ----------------------------------------------------------------------
3dc8A           EVTAPRAVQRSGIPAS------------------------------------------------------
3e74A           ----------------------------------------------------------------------
3egjA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
2aqvB           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
3egjB           ----------------------------------------------------------------------
2eg6B           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
3e0lA           ----------------------------------------------------------------------
2amxB           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
2amxA           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
3e2vA           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
3cjpA           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1boiA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PLGQRYFLF
1ejtC           PMAQRYFLF
1a5kC           PMAQRYFLF
1e9yB           SLAQLFSIF
1a5oC           PMAQRYFLF
1ejsC           PMAQRYFLF
1ejxC           PMAQRYFLF
1ejwC           PMAQRYFLF
1ejrC           PMAQRYFLF
1ejuC           PMAQRYFLF
1e9zB           SLAQLFSIF
1a5lC           PMAQRYFLF
1a5mC           PMAQRYFLF
1a5nC           PMAQRYFLF
3dc8B           ---------
1dryA           ---------
3dc8A           ---------
3e74A           ---------
3egjA           ---------
1aq2A           ---------
2bb0A           ---------
3e74B           ---------
3dugC           ---------
2aqvB           ---------
3e74C           ---------
3be7B           ---------
3be7C           ---------
2aqoA           ---------
3be7A           ---------
3dugA           ---------
3egjB           ---------
2eg6B           ---------
3d6nA           ---------
2aqoB           ---------
2aqvA           ---------
3e0lA           ---------
2amxB           ---------
2a3lA           ---------
2amxA           ---------
3c86A           ---------
2drhB           ---------
3e2vA           ---------
3e3hA           ---------
3cjpA           ---------
2d2gA           ---------
1boiA           ---------
1bf6A           ---------
1cr5A           ---------
3b8cA           ---------
1dpmA           ---------