[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB11952.2

[Show Plain Result]


## Summary of Sequence Search
    1::483
    1::76      1e-07  34%   81 aa  PF07949 YbbR "YbbR-like protein"
    1::483

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07949         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07949         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07949         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxVPFKIERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDG
PF07949         --------------------------VPVKLQTTGTLADGYTVSSITVSPVSVTVSGPESILDKIKAVKA


                         .         *         .         .         .         .         +:350
query           VSLDLSKINKDSDIEADIPLPDGVKKISPSKVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07949         TAVDLSGLSETVTLTVELLPPDGNGTVLPSTV--------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07949         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07949         ---------------------------------------------------------------