[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB12237.1

[Show Plain Result]


## Summary of Sequence Search
    1::420
    1::127     1e-13  36%  148 aa  PF00535 Glycos_transf_2 "Glycosyl transferase family 2"
    7::169     4e-07  25%  259 aa  PF03142 Chitin_synth_2 "Chitin synthase"
   10::98      9e-05  25%  354 aa  PF03071 GNT-I "GNT-I family"
    1::420

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
PF00535         ---------------------------------------------------SVIIPTYNEEEYLERCLES
PF03142         ----------------------------------------------------------------------
PF03071         -------------------------------------LPASKLPNNKVPVIPVLVIACNRPSYLRRCLDS


                         .         .         *         .         .         .         .:140
query           MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
PF00535         LLNQTYP--NFEIIVVDDGSTDGTAEIAEELAAKDPRIRVIRLE---ENLGKAGARNAGLRAAKGDYILF
PF03142         -----------------------------------------------------------------DYVLM
PF03071         LLKYRPSAEQFPIIVSQDGGHEETADVILSYGDQVTYIQQPITVPPKEKKFK------------------


                         +         .         .         .         .         *         .:210
query           YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
PF00535         LDADDILDPDFLEKLVAAL-EENPVDVVVGSRIYIDGNGSLLTR--------------------------
PF03142         VDADTKVAPDSLTRLVAAMEKDPRIGGVCGETKIANKGDSWVTMIQVFEYYISHHLEKAFESVFGSVTCL
PF03071         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGN
PF00535         ----------------------------------------------------------------------
PF03142         PGCFSMYRISALK--GVLEEYSLGEDRHLTTLMLKAGFRTEYVPDAIAATVVPDTFGVLLSQRRRWARST
PF03071         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QYVVLKFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------
PF03142         FRNLLELL--------------------------------------------------------------
PF03071         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------
PF03142         ----------------------------------------------------------------------
PF03071         ----------------------------------------------------------------------