[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB12450.2

[Show Plain Result]


## Summary of Sequence Search
    1::469
    3::412     1e-43  35%  429 aa  PF00324 AA_permease "Amino acid permease"
    1::469

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRMLGEMSAVN
PF00324         ------------------LIAIGGIIGTGLFVGSGSAAANAGPGALLAWLIAGLLVLLVALSYAELASAY


                         .         .         *         .         .         .         .:140
query           PTSGSFSQYAHDAIGPWAGFTIGWLYWFFWXXXXXXXXXXXXXXXQYWFHDIPXXXXXXXXXXXXXXXNV
PF00324         PVAGGFYTYASRALGPFLGFLTGWLYWLSWVVTIAAEATAAGYYLGFWFPDLPAWVWSLIALVFLVLLNL


                         +         .         .         .         .         *         .:210
query           YSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSEPVGFSNLTGKGGFFPEXXXXXXXXXXXXXX
PF00324         LGVKLSGELEFIFTLIKVLAIILFIILGIVLLAGGGPSN-----GNWWDPGGFFPPGGFLGFLAALAIAF


                         .         .         .         +         .         .         .:280
query           XXMGTEIVAIAAGETSNPIESVTKATRSVVWRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVP
PF00324         FAFGFEAVATAAEEAKNPKKNIPRAIILSLLIILVLYILVILALGGVVPYDDLALLASPFVIAFQAAGGP


                         .         *         .         .         .         .         +:350
query           AAAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNY
PF00324         WAASIINAGILISALSSLNSSLYAASRMLYALARDGLLPKFFAKHNKRGVPVNALLLTAIISLLLLLLVS


                         .         .         .         .         *         .         .:420
query           FSPDTVFLFLVNSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMA
PF00324         LGPGTAFNFLLSLSTIGTLIAYLLIALALLRFRKALKAQGRDLLPFKAPLGPLGPILGLAALLLVLLLLF


                         .         .         +         .         .         .         .:490
query           Fxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00324         F------------------------------------------------