[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB13009.1

[Show Plain Result]


## Summary of Sequence Search
    1::218
    1::223     1e-24  40%  224 aa  PF05389 MecA "Negative regulator of genetic competence (MecA)"
    1::218

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWXXXXXXXXXXXXXXXGPLWIQVQALDKG
PF05389         MKIERINENTIRCTLTKDDLEERGLKLEDLWYNREKAEELFRDMMDEADEELGFEADGPLMIQVIPLSDG


                         .         .         *         .         .         .         .:140
query           LEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVI
PF05389         LELIITKVEDEELDTRFSDFSPD--VDDPDDEDFEDLLEDSEEEEEEMEQKEPDETLHRIYSFDDLEDVI


                         +         .         .         .         .         *         .:210
query           SLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALE
PF05389         SLAKLAFYDGESSLYKYDGRYYLVLDEEEHSEEEFNRVCAILLEYGNPSTATIAYLKEHGKCIIEENALE


                         .         .         .         +         .         .         .:280
query           TIKxxxxx
PF05389         TLR-----