[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB13082.1

[Show Plain Result]


## Summary of Sequence Search
    1::250
    1::123     7e-07  37%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::250

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTLLSMCNLMRTPDS
PF00005         -------------------------------------------------------STLLRLLAGLLKPTS


                         .         .         *         .         .         .         .:140
query           GEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQLYSPEKLASLAGLPPELLDR
PF00005         GKILLDGVELRKLRIGYVFQDPALF----PHL--TVRENIAFGLKNDEKLKEIKKKEAKEEILEAKFLYR


                         +         .         .         .         .         *         .:210
query           SARDLSGGQRQRLSLARTLSNPSSILLLDEITSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         YPHELSGGQRQRVAIARALIKEPKVLLLDEPTS-------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------------------------