[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB13391.1

[Show Plain Result]


## Summary of Sequence Search
    1::494
    1::185     5e-27  41%  187 aa  PF08245 Mur_ligase_M "Mur ligase middle domain"
    3::77      8e-16  47%   84 aa  PF02875 Mur_ligase_C "Mur ligase family, glutamate ligase domain"
    5::72      2e-09  47%   76 aa  PF01225 Mur_ligase "Mur ligase family, catalytic domain"
    1::494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
PF08245         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         --------------------------VGIDSRGMSPGALFVALKGERVDGHDFIADAVAAGAAAVLSEAE


                         .         .         *         .         .         .         .:140
query           VDVNVPVIIVRQSLRALSxxxxxxxxxxxxxxxxxxITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
PF08245         ------------------------------------VTGTNGKTTTTAMLAAILSAAGLRVGTYGL----
PF02875         ----------------------------------------------------------------------
PF01225         VEPGIPVEDRSEALAALA----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSHALSLGRVHGCDYDIAVFTNLTQDHLDYHKT
PF08245         ----------NTNEEIGLPAALALLAEAGVDVAVLEVGSGGEGRLDATILKPDVAVITNIGPDHLDRLGT
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDEYRHAKSLLFSQLGGAFNHEHPKRAVLNADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGT
PF08245         LEAIAAAKAGIFKRLP-------PDGAVLNADDPELAELAAKAGARVVTFGLDEDADVRADDITVSADGG
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SFDLVTNKGTKHITMSLVGQFNVYNVLAAVAxxxxxxxxxxxxxxxxxxxxxxxGRFELVNQQQEFPVIV
PF08245         AFTLVTPGGELEVTLPLPGRHNVYNALAAIA---------------------------------------
PF02875         ------------------------------------------------------GRFEVVGEANGVTVID
PF01225         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DYAHTPDSLENVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDxxxxxxxxxxxx
PF08245         ----------------------------------------------------------------------
PF02875         DYAHNPDAIEAALEALRQLVDGRLIAVLGPGGDRDRDLHPEFGELAAELADDVILTGD------------
PF01225         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08245         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
PF08245         ----
PF02875         ----
PF01225         ----