[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB13610.1

[Show Plain Result]


## Summary of Sequence Search
    1::442
   12::267     6e-41  49%  285 aa  PF00082 Peptidase_S8 "Subtilase family"
    1::442

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00082         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00082         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYRGPA
PF00082         ----TGKGVVVAVIDTGIDPHPDLQDNGDGFNDNDNVNS-PRDDNGHGTHVAGIIAGNGNNGGGVV-GVA


                         .         .         .         +         .         .         .:280
query           PEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEA
PF00082         PGAKIAAVKVLDDGGSGSDADILAAIDYAV-------DDGADVINLSLGGSPDSGRPDDIAALDDAIDYA


                         .         *         .         .         .         .         +:350
query           WSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAP
PF00082         VAKGVLVVAAAGNDGPDSGTVGSPGASPNVITVGASTSDGNFAAF---VFSFSSRGPTSNGGLKPDIAAP


                         .         .         .         .         *         .         .:420
query           GVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKxxxxxxxxxx
PF00082         GVNILS--TPDD----------PGGGYALMSGTSMAAPHVAGVAALLLSAHPDLPPAAIK----------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxx
PF00082         ----------------------