[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB13612.1

[Show Plain Result]


## Summary of Sequence Search
    1::150
    2::98      8e-14  38%   99 aa  PF02566 OsmC "OsmC-like protein"
    1::150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
PF02566         --------------------------------------GGGEGPNPEELLLAALAACFAMTLRLVAAKKG


                         .         .         *         .         .         .         .:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
PF02566         IDLEDVEVEVEGELDPEGGRFT-EIVLHVTVTVPGLDAEE-----AERLVERAHKKCPVSRSLRGPVEVT


                         +         .         .         .         .         *         .:210
query           Lxxxxxxxxx
PF02566         L---------