[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB13622.1

[Show Plain Result]


## Summary of Sequence Search
    1::700
    3::505     1e-81  38%  506 aa  PF02867 Ribonuc_red_lgC "Ribonucleotide reductase, barrel domain"
    4::81      2e-15  50%   81 aa  PF08343 RNR_N "Ribonucleotide reductase N-terminal"
    5::80      9e-08  40%   80 aa  PF00317 Ribonuc_red_lgN "Ribonucleotide reductase, all-alpha
    1::700

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxLNNEIMIXXXXXXXXXXXXEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
PF02867         ----------------------------------------------------------------------
PF08343         -----------LNNELNLDVDGQIQLDKDKEALEAFFEEHVNPNTVFFHSLEERLDYLVEEGYYEAEVLD
PF00317         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LYSFEDIKEVFKTAYAKKFxxxxFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
PF02867         ----------------------------------------------------------------------
PF08343         KYSFEFIEELFQYAYAQKF---------------------------------------------------
PF00317         -----------------------YLAAKVLYDRYLLKDNDGE-IIESPQDMFMRVALELADDDEEWAEEF


                         +         .         .         .         .         *         .:210
query           VNLMINQEYQPSTPTFLNAGRKRRxxxxSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
PF02867         ----------------------------SCFLLSVEDSLEGIFDTLKEAARLSKYGGGVGLNFSNLRAKG
PF08343         ----------------------------------------------------------------------
PF00317         YDLMSSLKFMPATPTLMNAGTPLR----------------------------------------------


                         .         .         .         +         .         .         .:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
PF02867         SPIRGTGGKSSGVVPFLKIFDDAAGAVKQGGTRRGAKMVYLDIWHPDIEEFIDLKKNNGDERVRLQNLNI
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
PF02867         SVWVPDLFMEAVEEDEDWTLFSPRDVPGLEDLYGEEFE--ELYEEYEADGGIVKKTVKARELWEKIAESA
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
PF02867         WETGEPGILFKDTINRWNPLPHLGRIRASNPCGEI----------------PLPEDAVCNLGSINLAKFV
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
PF02867         DFEKLEEAVRLAVRALDNVID-MNYYPLPEIAKGNKRYRRIGLGVMGLADLLAKLGIPYDSEEARALADE
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
PF02867         IFETIAYYAYKASAELAKERG-AFPGFEGSKYARGILFHDRAAEDLSELYAK-------------EDWDE
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
PF02867         LREKIKKHGLRNSQLTAIAPTGTISLIDGTTSGIEPIFALVREVAGGEFKIVNPIPEIPEELKAYYKTAY
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYxxxxxxxxxxxxxxxx
PF02867         EIDPEDHIDMQAARQKFIDQSISKTLNLPNDATVEDLKELYLYAWKLGLKTTYY----------------
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------